Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E002808.843ON54954923910.0
NCAS0B002908.843ON54251119880.0
KNAG0G034308.843ON54250917670.0
YML116W (ATR1)8.843ON54251316020.0
NCAS0A02540singletonON53949215780.0
Smik_13.188.843ON54549315740.0
Skud_13.258.843ON53749115600.0
Suva_13.278.843ON55351115420.0
KNAG0J002608.843ON55049515370.0
NCAS0C004008.843ON51750915170.0
NDAI0K004008.843ON55351014760.0
KLTH0C03806g8.843ON52550014590.0
KAFR0A028408.843ON52047314510.0
KAFR0B03930singletonON55550914550.0
CAGL0B02343g8.843ON53750614420.0
Kwal_27.102458.843ON51550814270.0
TDEL0B005508.843ON53747514200.0
Suva_13.4678.843ON54351014150.0
SAKL0D01386g8.843ON52146514070.0
Skud_13.4518.843ON53950014080.0
KAFR0B039408.843ON54750913920.0
YMR279C8.843ON54050813810.0
Smik_13.4928.843ON54351113740.0
Kpol_541.168.843ON52850413650.0
TBLA0D032708.843ON55050613361e-179
CAGL0M03003g8.843ON55849313311e-179
TPHA0C047908.843ON55648613041e-175
TBLA0D03280singletonON58050912891e-172
TBLA0C01160singletonON60049810051e-129
Smik_15.560na 1ON5165177617e-94
KLTH0C10560gna 1ON5154837591e-93
Suva_8.435na 1ON5154757555e-93
YOR378Wna 1ON5154777494e-92
KLLA0B00352gna 1ON4984767406e-91
Skud_15.545na 1ON5165037372e-90
Kwal_23.6547na 1ON5115087232e-88
TDEL0G04950singletonON5124786851e-82
KNAG0D00130na 1ON5654544302e-45
SAKL0C06116gsingletonON1851253928e-44
KAFR0C04860na 1ON5343693683e-37
CAGL0L02519gna 1ON5294243383e-33
NCAS0A05720na 1ON5634563041e-28
NDAI0K02730singletonON6045372961e-27
NCAS0C03460na 2ON6302121271e-06
KLLA0F13684g2.473ON5711511242e-06
SAKL0F00440gsingletonON5444701224e-06
KLLA0C18931gna 3ON5531591215e-06
SAKL0C05588gsingletonON6771431215e-06
Smik_13.2722.473ON5611751153e-05
YMR088C (VBA1)2.473ON5621031126e-05
Suva_13.2652.473ON5611191118e-05
AGR076C8.272ON6862741091e-04
TDEL0G03260singletonON6121671082e-04
Skud_13.2442.473ON5621031072e-04
Kpol_1039.192.242ON5732011072e-04
NDAI0H022002.473ON5711371072e-04
Kwal_34.15746na 3ON5181581063e-04
NDAI0D010202.242ON5921971054e-04
SAKL0A08228gsingletonON5691471054e-04
YKR105C (VBA5)singletonON5822091046e-04
ABL040W2.473ON567771010.001
SAKL0E02992g2.473ON570981000.002
TDEL0A024902.473ON55478990.002
NCAS0A078102.473ON568183990.002
Smik_6.24na 4ON544471980.003
NCAS0G029902.242ON581201970.003
Smik_16.81na 2ON625196970.004
KLTH0D16962gsingletonON571128950.006
Skud_18.3singletonON590197950.006
CAGL0J01375g2.473ON564141940.008
SAKL0B12716gsingletonON632202940.008
KLTH0C10142gsingletonON573147940.009
SAKL0D04510gna 5ON531147930.009
KAFR0J009302.242ON566194930.010
KLLA0E24113g8.570ON57569930.010
YGR224W (AZR1)na 2ON613127930.011
SAKL0F00198gsingletonON537212920.013
SAKL0A00726gsingletonON598203920.013
YPR198W (SGE1)singletonON543131920.014
KNAG0E025602.473ON57879920.016
SAKL0E08756g2.242ON565109910.018
TDEL0B019008.446ON68783900.023
Smik_11.368singletonON580167900.026
KLTH0E03234gsingletonON521143890.031
CAGL0B02079gna 2ON624153890.031
Suva_10.11singletonON540159890.032
ZYRO0G00352gsingletonON494109890.034
Kwal_14.728singletonON568145890.035
Skud_16.503singletonON543134880.039
Skud_7.560na 2ON642150870.057
KLTH0H16214gsingletonON551142870.060
KLTH0B00132gsingletonON568145860.072
ZYRO0G03234g2.473ON56278860.075
KLTH0C10120gsingletonON651130840.13
ZYRO0E10230gsingletonON558174840.14
KLLA0F03311g2.242ON542109830.15
Smik_17.11singletonON544131830.17
YNL065W (AQR1)2.242ON586109830.17
Kpol_416.6singletonON59790830.19
Skud_14.2672.242ON562109820.20
Suva_14.2762.242ON562109820.20
Kwal_23.48242.242ON553109810.26
Skud_6.16na 4ON549469800.35
KLLA0A04631g8.272ON57967800.35
SAKL0E08778g2.241ON600193790.55
KLTH0G09372g2.242ON551109780.59
TBLA0G025502.242ON613110780.65
TPHA0M00120singletonON619179780.74
Kpol_543.448.272ON64348770.99
TDEL0F039908.272ON63169771.0
ZYRO0A03564g3.245ON684161761.1
Skud_2.1553.245ON688164751.7
KLTH0B00594gsingletonON618127751.7
Kwal_27.116388.446ON72384751.9
TPHA0G031502.473ON60065741.9
YIL120W (QDR1)2.242ON563216742.1
KLTH0H05456gna 6ON56884742.2
ZYRO0C01430g8.272ON590267742.2
Kpol_513.33singletonON62679732.7
SAKL0H16808g8.272ON65748733.0
CAGL0J09944g2.242ON592109733.1
NDAI0A02050singletonON617483733.1
TDEL0D038003.245ON640163723.2
Suva_9.712.241ON561202723.8
Suva_4.2753.245ON683164723.9
TDEL0D06610singletonON49787714.0
ZYRO0G21890gsingletonON57684714.2
TBLA0B00840singletonON637118714.7
SAKL0D11000g1.451ON657125714.8
Kpol_416.5singletonON60773705.6
ZYRO0G07414gsingletonON70781705.9
NDAI0D016805.284ON516107706.1
KAFR0I01560singletonON63281707.0
Kwal_26.9616singletonON562131697.0
TBLA0F030408.272ON90651707.5
KLTH0E10406g8.446ON73383697.6
Kwal_14.1585na 6ON57084699.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E00280
         (549 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      925   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      770   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   685   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   621   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   612   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   610   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   605   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   598   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   596   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      588   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               573   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   566   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   563   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   565   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   560   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   554   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   551   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   549   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   546   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   546   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   540   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   536   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   533   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   530   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   519   e-179
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   517   e-179
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   506   e-175
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   501   e-172
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   391   e-129
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   297   7e-94
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   296   1e-93
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   295   5e-93
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   293   4e-92
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   289   6e-91
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   288   2e-90
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   283   2e-88
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   268   1e-82
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   170   2e-45
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   155   8e-44
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     146   3e-37
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   134   3e-33
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            121   1e-28
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   118   1e-27
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    54   1e-06
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    52   2e-06
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    52   4e-06
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    51   5e-06
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    51   5e-06
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    49   3e-05
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    48   6e-05
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    47   8e-05
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    47   1e-04
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               46   2e-04
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    46   2e-04
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    46   2e-04
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    46   2e-04
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    45   3e-04
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    45   4e-04
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    45   4e-04
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    45   6e-04
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    44   0.001
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    43   0.002
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    43   0.002
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    43   0.002
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    42   0.003
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    42   0.003
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    42   0.004
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    41   0.006
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    41   0.006
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    41   0.008
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    41   0.008
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    41   0.009
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    40   0.009
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    40   0.010
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    40   0.010
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    40   0.011
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    40   0.013
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    40   0.013
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    40   0.014
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    40   0.016
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    40   0.018
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    39   0.023
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    39   0.026
KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {...    39   0.031
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    39   0.031
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    39   0.032
ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly s...    39   0.034
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    39   0.035
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    39   0.039
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    38   0.057
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    38   0.060
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    38   0.072
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    38   0.075
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    37   0.13 
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    37   0.14 
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    37   0.15 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    37   0.17 
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    37   0.17 
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    37   0.19 
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    36   0.20 
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    36   0.20 
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    36   0.26 
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    35   0.35 
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    35   0.35 
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    35   0.55 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    35   0.59 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    35   0.65 
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                35   0.74 
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    34   0.99 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    34   1.0  
ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} simila...    34   1.1  
Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON...    33   1.7  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    33   1.7  
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    33   1.9  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    33   1.9  
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    33   2.1  
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    33   2.2  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    33   2.2  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    33   2.7  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    33   3.0  
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    33   3.1  
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    33   3.1  
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...    32   3.2  
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    32   3.8  
Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON...    32   3.9  
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    32   4.0  
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    32   4.2  
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    32   4.7  
SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} simila...    32   4.8  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    32   5.6  
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    32   5.9  
NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {O...    32   6.1  
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      32   7.0  
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    31   7.0  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    32   7.5  
KLTH0E10406g Chr5 (938423..940624) [2202 bp, 733 aa] {ON} weakly...    31   7.6  
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    31   9.0  

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  925 bits (2391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/549 (84%), Positives = 465/549 (84%)

Query: 1   MLKHFHRHNSKNVXXXXXXXXXXXXXXXXXXXXXXXXXNNEVSEDELPSSEQEDNTIGDH 60
           MLKHFHRHNSKNV                         NNEVSEDELPSSEQEDNTIGDH
Sbjct: 1   MLKHFHRHNSKNVEEEKEITQSTSSIIEEECSSITKEENNEVSEDELPSSEQEDNTIGDH 60

Query: 61  SKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIAS 120
           SKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIAS
Sbjct: 61  SKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIAS 120

Query: 121 FPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGL 180
           FPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGL
Sbjct: 121 FPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGL 180

Query: 181 GIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWA 240
           GIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWA
Sbjct: 181 GIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWA 240

Query: 241 FYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQ 300
           FY                 PNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQ
Sbjct: 241 FYAFAIASAINLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQ 300

Query: 301 KAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWXXXXXXXX 360
           KAY              FFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGW        
Sbjct: 301 KAYIIVLLIISIIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSF 360

Query: 361 XXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLI 420
                LLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLI
Sbjct: 361 YYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLI 420

Query: 421 MLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYS 480
           MLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYS
Sbjct: 421 MLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYS 480

Query: 481 MSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXXXXXXXXYMAEVLWAKRKERL 540
           MSLCLGMGTTVERQINKSGKEILKGYRAAEY               YMAEVLWAKRKERL
Sbjct: 481 MSLCLGMGTTVERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERL 540

Query: 541 SSNRDHDMS 549
           SSNRDHDMS
Sbjct: 541 SSNRDHDMS 549

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/511 (75%), Positives = 420/511 (82%)

Query: 39  NNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLS 98
           + ++ E E     Q +    +HSKWQNPDYFQN+WQEYLFIFSCMMSQLLNQAATPQTLS
Sbjct: 32  HGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLS 91

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
           IMNIITDSF SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTL+GGY+FFIIWS+I
Sbjct: 92  IMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSII 151

Query: 159 SGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
           SG T YSH+D FFI+SRAFQGL IAFILPNVMGIVGNIYKPD+ RKNIVISMIGASAPIG
Sbjct: 152 SGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIG 211

Query: 219 AFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSI 278
           AF GSLFAGLIGTE+P QWPWAFY                 PN++PTN+HGFAMDWIGS+
Sbjct: 212 AFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSV 271

Query: 279 MAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKN 338
           +AVIGLILLNFVWNQGPIVGWQ AY              FFTYE+KYA+SP+LPVEVTKN
Sbjct: 272 LAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAESPLLPVEVTKN 331

Query: 339 RHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAF 398
           RHIIMILAALFLGW             LLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAF
Sbjct: 332 RHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAF 391

Query: 399 IKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILS 458
           IK+ISA+ ILF SM+AFNIG+IMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILS
Sbjct: 392 IKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILS 451

Query: 459 DGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXX 518
           DGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSG ++LKGYR AEY       
Sbjct: 452 DGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAG 511

Query: 519 XXXXXXXXYMAEVLWAKRKERLSSNRDHDMS 549
                   Y+ E+LW KRK+ L++N   D+S
Sbjct: 512 LGIIITAIYLGEILWGKRKQHLAANVVPDLS 542

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/509 (65%), Positives = 389/509 (76%), Gaps = 3/509 (0%)

Query: 44  EDELPSSEQEDN---TIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIM 100
            D+L S  +      T   + KWQ+  YFQN+WQEY+F+ +CMMSQLLNQA  PQTLS+M
Sbjct: 34  SDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLM 93

Query: 101 NIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISG 160
           NI+T SF S    +TWL+ASFPLVSGSFILISGR+GDIYGLK +L+GG +FFIIW+LISG
Sbjct: 94  NILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISG 153

Query: 161 FTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAF 220
           FT+Y+H+D FFI+SR+FQGLG+AFILPNVMG VGNIYKP+T RKNIVIS+IGA AP+GAF
Sbjct: 154 FTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAF 213

Query: 221 MGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMA 280
           MG+ FAGLIGT+NP  WPW+FY                 PN+IPTN+HGF+MDWIGS +A
Sbjct: 214 MGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLA 273

Query: 281 VIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRH 340
           V+GLILLNFVWNQGPI GW KAY              FF YE+ YA SP+LP  +T+NRH
Sbjct: 274 VVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRH 333

Query: 341 IIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIK 400
           ++MIL ALFLGW             LLNLRHYS +WAG TYFMFAIWG VA+V+VG  I+
Sbjct: 334 MVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIR 393

Query: 401 RISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDG 460
           +ISAS+ILFFSMIAF++G+IMLSVTPV QTYFRMNLGTMIILSFGMDMSFPAAAIILSD 
Sbjct: 394 KISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDS 453

Query: 461 LTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXX 520
           L  QYQGMAGSLANTMVNYSMSLCLGMG+TVE QIN++GK++LKGYRAAEY         
Sbjct: 454 LPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLA 513

Query: 521 XXXXXXYMAEVLWAKRKERLSSNRDHDMS 549
                 YM E LW  RKER+ S  + ++S
Sbjct: 514 VILSLIYMCERLWIDRKERMESTSETNLS 542

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/513 (59%), Positives = 365/513 (71%), Gaps = 2/513 (0%)

Query: 39  NNEVSEDELPS--SEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQT 96
           +N + E    +  ++ ED  +  + KWQNP+YF+  WQEYLFIF+CM+SQLLNQA T QT
Sbjct: 30  DNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQT 89

Query: 97  LSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWS 156
           LSIMNI++DSF SEG  ++WL+ASFPLVSGSFILISGR+GDIYGLKK L+ GY+  IIWS
Sbjct: 90  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 149

Query: 157 LISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAP 216
           LI G T YS +D FFIISRAFQGLGIAF+LPNV+GI+GNIY   T RKNIVIS +GA AP
Sbjct: 150 LICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAP 209

Query: 217 IGAFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIG 276
           IGA +G LFAGLIGTE+PKQWPWAFY                 P+ IPTNIH F+MDWIG
Sbjct: 210 IGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIG 269

Query: 277 SIMAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVT 336
           S++ VIGLILLNFVWNQ PI GW +AY              F  YEI++AK+P+LP  V 
Sbjct: 270 SVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTPLLPRAVI 329

Query: 337 KNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVG 396
           K+RH+I I+ ALF GW              LN+R Y+ALWAG TYFMF IWG +AA++VG
Sbjct: 330 KDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVG 389

Query: 397 AFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAII 456
             IK +S SV LFFSM+AFN+G IM SVTPV +TYFR  LGTMIILSFGMD+SFPA++II
Sbjct: 390 FTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSII 449

Query: 457 LSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXX 516
            SD L M+YQGMAGSL NT+VNYSMSLCLGMG TVE Q+N  GK +LKGYR A+Y     
Sbjct: 450 FSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGL 509

Query: 517 XXXXXXXXXXYMAEVLWAKRKERLSSNRDHDMS 549
                     YM E     R+ R ++  D  ++
Sbjct: 510 ASLACMISGLYMVESFIKGRRARAAAEYDCTVA 542

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/492 (59%), Positives = 357/492 (72%)

Query: 50  SEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKS 109
           S   D+ + D S WQNP+YF +K++EY FIF+CM++ LLNQA   Q LS MN+I++SF S
Sbjct: 37  SNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQVLSTMNVISESFHS 96

Query: 110 EGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDI 169
           + GK+TWL+ASFPLVSGSFILISGRIGDIYGLKKT+IGGY+F IIWSL+ GF D++HND 
Sbjct: 97  DSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWSLLCGFADFTHNDT 156

Query: 170 FFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLI 229
           FFI+ RAFQGLGI+FILPNVMG++GNIYK  T RKNIVISMIG +AP GA MG+L+ GLI
Sbjct: 157 FFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTAPTGACMGALWGGLI 216

Query: 230 GTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMAVIGLILLNF 289
            TEN KQWPW FY                 PN IPTN+H FAMDWIGSI+ V+GLIL NF
Sbjct: 217 VTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWIGSIIGVVGLILFNF 276

Query: 290 VWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIMILAALF 349
           VWNQGP+ GW KAY              F  YE+KY  SP+LPVEVTKN  I+ IL+ LF
Sbjct: 277 VWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEVTKNGQILTILSILF 336

Query: 350 LGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILF 409
           LGW              LNLR YS +W G TYFMF IWGT+AA+IV   IK++  +++LF
Sbjct: 337 LGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIVAFTIKKVGPAILLF 396

Query: 410 FSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMA 469
           FS + F +G +MLSVTP+ Q Y+RMNLG  IIL FGMD+SFPA++IILSD L MQYQGMA
Sbjct: 397 FSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSIILSDHLPMQYQGMA 456

Query: 470 GSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXXXXXXXXYMA 529
           GSL NT++NY+ SLCLGMGTTVERQINKSG+++LKGYR+A Y                + 
Sbjct: 457 GSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAVGLGGLGSCIAFINLC 516

Query: 530 EVLWAKRKERLS 541
             LW KR++RL+
Sbjct: 517 YTLWMKRRDRLA 528

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/493 (61%), Positives = 353/493 (71%)

Query: 53  EDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGG 112
           ED  +  + KWQNP YF+  WQEYLFIF+CM+SQLLNQA T QTLSIMNI++DSF SEG 
Sbjct: 49  EDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGN 108

Query: 113 KETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFI 172
            ++WL+ASFPLVSGSFILISGR+GDIYGLKK L+ GY+  IIWSLI G T+YS +D FFI
Sbjct: 109 SKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFI 168

Query: 173 ISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTE 232
           I RAFQGLGIAF+LPNV+GI+GNIY   T RKNIVIS +GA APIGA +G LFAGLIGTE
Sbjct: 169 ICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTE 228

Query: 233 NPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWN 292
           NP QWPWAFY                 PNNIPTNIH F+MDWIGS++ VIGLILLNFVWN
Sbjct: 229 NPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWN 288

Query: 293 QGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGW 352
           Q PI GW +AY              F  YE+ +AKSP+LP  V K+ H+I I+ ALF GW
Sbjct: 289 QAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGW 348

Query: 353 XXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSM 412
                         LN+RHY+ALWAG TYFMF IWG +AA++VG  IK +S SV LFFSM
Sbjct: 349 GSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSM 408

Query: 413 IAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSL 472
           +AFN+G IM SVTPV +TYFR  LGTMIILSFGMD+SFPA++II SD L M+YQGMAGSL
Sbjct: 409 VAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSL 468

Query: 473 ANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXXXXXXXXYMAEVL 532
            NT+VNYSMSLCLGMG TVE Q++  GK +LKGYR A+Y               YM E  
Sbjct: 469 VNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESF 528

Query: 533 WAKRKERLSSNRD 545
               K + ++  D
Sbjct: 529 INDHKAKAATEND 541

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/491 (60%), Positives = 348/491 (70%)

Query: 49  SSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFK 108
           S++  +    D  +WQNP+YF+N W EYLFIF+CM+SQLLNQA T QTLSIMNII +SF 
Sbjct: 43  STDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFG 102

Query: 109 SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHND 168
           S     TWL+ASFPLVSGSFILISGR+GDIYGLKK L  GY+  IIWSLI G T YS +D
Sbjct: 103 SNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSD 162

Query: 169 IFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGL 228
            FFIISRAFQGLGIAF+LPNV+GI+GNIY   T RKNIVIS++GA AP+GA +G LFAGL
Sbjct: 163 TFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGL 222

Query: 229 IGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMAVIGLILLN 288
           IGT+NPKQWPWAFY                 PNNIPTNI  F+MDWIGS + VIGL+L+N
Sbjct: 223 IGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMN 282

Query: 289 FVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIMILAAL 348
           FVWNQ PI GW +AY              F  YE ++AKSP+LP  V K+RH+I I+ AL
Sbjct: 283 FVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLAL 342

Query: 349 FLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVIL 408
           F GW              LN+RHYSA+WAG TYFMF IWG +AA++VG +IK++S SV L
Sbjct: 343 FFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFL 402

Query: 409 FFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGM 468
           F SM+AFNIG IM SVTPV +TYFR  LGTMIILSFGMD SFPA++II SD L M+YQGM
Sbjct: 403 FLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGM 462

Query: 469 AGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXXXXXXXXYM 528
           AGSL NT+VNYSMSLCLGMG TVE  ++  GK +LKGYR A+Y               YM
Sbjct: 463 AGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYM 522

Query: 529 AEVLWAKRKER 539
            E +    K +
Sbjct: 523 VERIIKDHKAK 533

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/511 (57%), Positives = 352/511 (68%)

Query: 39  NNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLS 98
           N E +   +  +  ED  +    KWQNP+YF+  WQEYLFIF+CM+SQLLNQ+ T QTLS
Sbjct: 43  NKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLS 102

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
           IMNI+ DSF S+    +WL+ASFPLVSGSFILISGR+GDI+GLK  L+ GY+  IIWSLI
Sbjct: 103 IMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLI 162

Query: 159 SGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
            G T YS +D FFI+SRAFQGLGIAF+LPNV+GI+GN+Y   T RKNIVIS IGA APIG
Sbjct: 163 CGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIG 222

Query: 219 AFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSI 278
           A +G  FAGLIGT NP QWPWAFY                 PNNIPTN+H F+MDWIGS 
Sbjct: 223 ATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSG 282

Query: 279 MAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKN 338
           + VIGL+LLN VWNQ PI GW +AY              F  YEI +AKSP+LP  V K+
Sbjct: 283 LGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKD 342

Query: 339 RHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAF 398
           RH+I I+ +LF GW              LN+RHY+ LWAG +YFMF IWG +AA++VG  
Sbjct: 343 RHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFS 402

Query: 399 IKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILS 458
           IKR+S SV LFF+M+AFN+G IM SVTPV +TYFRM +GTMIILSFGMD+SFPA++II S
Sbjct: 403 IKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFS 462

Query: 459 DGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXX 518
           D L M+YQGMAGSL NT+VNYSMSLCLGMG TVE Q++  GK ILKGYR A+Y       
Sbjct: 463 DYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLAS 522

Query: 519 XXXXXXXXYMAEVLWAKRKERLSSNRDHDMS 549
                   YM E      + +  +     MS
Sbjct: 523 LACIISGLYMVECYIKDHRAKAVAEDKRSMS 553

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/495 (59%), Positives = 347/495 (70%), Gaps = 1/495 (0%)

Query: 39  NNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLS 98
            N  +E E     + + T  D + WQNP YF N+WQEY FI +CM++QLLNQA   Q  +
Sbjct: 39  KNCSTESEAEWCSESEFTDND-TPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATA 97

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
            MNI+ D+F S   K+TWL+ASFPLVSGSFIL+SGRIGDIYGLKKTLIGGYL  +IWSLI
Sbjct: 98  PMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLI 157

Query: 159 SGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
            GF +Y+HND FFI+ RAFQGLGIAFILPNVMG++GNIYK +T RKN VIS +G  APIG
Sbjct: 158 CGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIG 217

Query: 219 AFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSI 278
           A +G +++GLI  ENPKQWPW FY                 P+ +PTNIHGF MDW GS 
Sbjct: 218 AALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSA 277

Query: 279 MAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKN 338
           + V+G+IL NFVWNQGPI GW K Y              FF YEIK+AKSP+LP EV KN
Sbjct: 278 IGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKN 337

Query: 339 RHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAF 398
           RHI MIL A+F+GW              LNLRHYSA+WAG T+FMF IWGT+AA +V   
Sbjct: 338 RHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALT 397

Query: 399 IKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILS 458
           IKR+  SV+L FSM  F +G IMLSVTPV Q+Y++MNLG  IILSFGMD+SFPA++IILS
Sbjct: 398 IKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILS 457

Query: 459 DGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXX 518
           D L  QYQGMAGSL NTMVNYS SLCLG+G+T E Q+NK+G + LKGYRAA Y       
Sbjct: 458 DFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGA 517

Query: 519 XXXXXXXXYMAEVLW 533
                   Y+ EVLW
Sbjct: 518 CGMLVAFCYLFEVLW 532

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/509 (56%), Positives = 358/509 (70%), Gaps = 4/509 (0%)

Query: 41  EVSEDELPSSEQE----DNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQT 96
           E  E  + SS+++    D+ + + + WQN  YFQ+  +EY FIF+CM + LLNQA   Q 
Sbjct: 2   ENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61

Query: 97  LSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWS 156
           LS MN+I++SF S+ G +TWL+ASFPLVSGSFILISGRIGDIYGLKKT+IGGY+F IIW+
Sbjct: 62  LSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121

Query: 157 LISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAP 216
           L+ GF DY+H+D FFI+ RAFQGLGI+FILPN+MG+VGNIYK  T RKNIVIS+IG +AP
Sbjct: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181

Query: 217 IGAFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIG 276
            GA MG+L+ GLI TE+ +QWPW FY                 P N+PTN+H FAMDW+G
Sbjct: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMG 241

Query: 277 SIMAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVT 336
           +I+ V+GLIL NFVWNQGP+ GW K Y              F  YE+K+  SP+LP EVT
Sbjct: 242 AIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVT 301

Query: 337 KNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVG 396
           KN  I+ IL  LFLGW              LNLR+YS LWAG T+FMF IWG++AA IVG
Sbjct: 302 KNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVG 361

Query: 397 AFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAII 456
             I R+  +V+LFFS + F +G +MLSVTP+ QTY+RMN+G  IILSFGMD+SFPA++II
Sbjct: 362 FTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSII 421

Query: 457 LSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXX 516
           LSD L MQYQGMAGSL NT++NYS SLCLGMGTTVERQINK+G+E+L+GYR+A Y     
Sbjct: 422 LSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGL 481

Query: 517 XXXXXXXXXXYMAEVLWAKRKERLSSNRD 545
                      +   LW KRK RL   R 
Sbjct: 482 GGLGACVAFLNLCYDLWRKRKSRLDDIRS 510

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/510 (55%), Positives = 354/510 (69%), Gaps = 13/510 (2%)

Query: 43  SEDELPSSEQEDNTIG-------------DHSKWQNPDYFQNKWQEYLFIFSCMMSQLLN 89
           S +   + +++D+ IG             ++S WQNPDYF + ++EY+F+ +CM++ LLN
Sbjct: 30  SSERKTAIKEQDDEIGSDSTTTSSSSLQENNSSWQNPDYFSSSFKEYIFVATCMIANLLN 89

Query: 90  QAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGY 149
           QA   Q LS MN+I+DSF S  G +TWL+ASFPLVSGSFILISGR+GDIYGLK+ +IGG+
Sbjct: 90  QAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRMMIGGF 149

Query: 150 LFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVIS 209
           +F IIWSLI GFT+Y+H+D FFI++RAFQGLGI+FILPNVMG+VGNIYK  T RKN+VIS
Sbjct: 150 IFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVIS 209

Query: 210 MIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHG 269
           +IG  AP G+  G+L+ GLI TENPKQWPW FY                 P+NIPTN++G
Sbjct: 210 LIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNG 269

Query: 270 FAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSP 329
           F MDWIGS++ VIGLIL NFVWNQGPIVGW+KAY              FF YEIKYAK P
Sbjct: 270 FTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVP 329

Query: 330 ILPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGT 389
           +LP  VT+N HI+ IL  LFLGW              LNLR YS +W+G T+F+F I+GT
Sbjct: 330 LLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGT 389

Query: 390 VAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMS 449
           VAA  V   IK++  +++LFFS I F  G I++SVTPV QTY+R   G  IIL FGMD+ 
Sbjct: 390 VAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLP 449

Query: 450 FPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAA 509
           FPA++IILSD L MQYQGMA SL NT+VNYS SLCLGMGTTVERQINKSG ++LKGYRAA
Sbjct: 450 FPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAA 509

Query: 510 EYXXXXXXXXXXXXXXXYMAEVLWAKRKER 539
            Y                +   +W+KR  +
Sbjct: 510 LYFGVGIAGLGACIAFLNVCHDIWSKRNAK 539

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/500 (54%), Positives = 348/500 (69%), Gaps = 1/500 (0%)

Query: 40  NEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSI 99
           +++S   + + E  D  +   S+ QNPDYF  +W+EYLF+ S M+SQLLNQAA  Q   +
Sbjct: 15  SDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPL 74

Query: 100 MNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLIS 159
            +++++  K++  ++ WL+ASFPLVSGSFIL+SG++GDIYGLKKTL+GGY   +IWSLI 
Sbjct: 75  FDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLIC 134

Query: 160 GFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGA 219
           G + Y+HN  FFI++R+FQGLGIAF+LPNV GIVGNIYKP+T+ KN+V SMIGA APIGA
Sbjct: 135 GLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGA 194

Query: 220 FMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIM 279
            +G LF+GLIGTE+ + W W FY                 P+NIPTN+H F MDW+GS +
Sbjct: 195 TLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFL 253

Query: 280 AVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNR 339
            V GLI+ NFVWNQ P  GW  AY              F  +E ++AK P+LP  V  NR
Sbjct: 254 GVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNR 313

Query: 340 HIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI 399
            ++MILA+LFLGW             +LNLRHY+ LWAG +YFMFAI+GT+AA +VG  I
Sbjct: 314 KLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTI 373

Query: 400 KRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 459
            +   ++IL  S+IAF++G IMLSVTPVDQTYFRM+LGTM+ILSFGMD+SFPA++IILSD
Sbjct: 374 HKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSD 433

Query: 460 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXX 519
            L  QYQGMAGSL NTM+NYSMSLCLG+  T ERQ+NK G ++LKGYRAA Y        
Sbjct: 434 QLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASV 493

Query: 520 XXXXXXXYMAEVLWAKRKER 539
                  Y  E  W +R+ER
Sbjct: 494 GIFVSGAYAIEDWWTRRRER 513

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/473 (59%), Positives = 348/473 (73%), Gaps = 1/473 (0%)

Query: 39  NNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLS 98
            +++S D+  S+E+ +  + + SKWQ+P YF+N +QEYLF+ SCM +QLLNQA TPQTLS
Sbjct: 14  QSDISIDK-SSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLS 72

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
           IMN+++DSF S    +TWL+ASFPLV+GSFILISGRIGDIYGLKKTLIGGY+F IIWSLI
Sbjct: 73  IMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLI 132

Query: 159 SGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
            GFT YS +D F II+RAFQGLGIAF LPNV+G +GNIY   + RKN+VIS+I ASAP+G
Sbjct: 133 CGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVG 192

Query: 219 AFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSI 278
           A +G  FAGLI TE+P QWPW+FY                 P+NIPTN++GF MDWIGS 
Sbjct: 193 AAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSA 252

Query: 279 MAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKN 338
           + V GLIL NF WNQGPIVGW  AY              F TYEI +A SP++  E+T +
Sbjct: 253 LIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREITHS 312

Query: 339 RHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAF 398
           R++I+ +  LFLGW             +LNLRHYS +WAG +YF+F I+G +A+  VG  
Sbjct: 313 RNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGIS 372

Query: 399 IKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILS 458
           IK+I+A VIL FSM+ F +G  +LSV PVDQ+YF++ L  M IL  G+D SFPAA IILS
Sbjct: 373 IKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILS 432

Query: 459 DGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEY 511
           DGL M+YQGMAGSLA TMVNYSMSLCLGMG TVERQINK G+++LKGYR+AEY
Sbjct: 433 DGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEY 485

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/509 (54%), Positives = 346/509 (67%), Gaps = 3/509 (0%)

Query: 41  EVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIM 100
            V E   P +E+  +   +++ WQNP YF ++W+EYLFI +CM+S LLNQA   Q  S M
Sbjct: 50  SVFEGTSPDAEKFSD---NNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTM 106

Query: 101 NIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISG 160
           N+I  +F ++   +TWL+ASFPLVSGSFIL+SGRIGDIYGLK+T+IGG +  IIWSLI G
Sbjct: 107 NVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICG 166

Query: 161 FTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAF 220
           F +YS +  FFII RAFQGLGIAF+LPNVMG+VGNIYK  + RKNIVIS IG  AP GA 
Sbjct: 167 FANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAA 226

Query: 221 MGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMA 280
            G+ +AGLI T+  KQWPW FY                 P+ +P N+HGF+MDW GS++ 
Sbjct: 227 FGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVG 286

Query: 281 VIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRH 340
           VIGLIL NFVWN+ PIVGW+KAY              FF YEIK+AKSP+LP  VT N +
Sbjct: 287 VIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHN 346

Query: 341 IIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIK 400
           IIMIL+A+F+GW             LLNLR Y+ L AG ++ MF +WGT+AA  V   IK
Sbjct: 347 IIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIK 406

Query: 401 RISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDG 460
           R+  SV+LF SM+AF +G IMLS+TPV QTY++M  G  IIL+FGMD+SFPA++IILSD 
Sbjct: 407 RVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDA 466

Query: 461 LTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXX 520
           L M+YQGMAGSL NT+VNYS SLCLGMGTT E Q+NK+G ++LKGYRAA Y         
Sbjct: 467 LPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVG 526

Query: 521 XXXXXXYMAEVLWAKRKERLSSNRDHDMS 549
                 ++ E L  KR    +     DMS
Sbjct: 527 VIIAALFLFESLRQKRGRTAALTAKKDMS 555

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/506 (54%), Positives = 351/506 (69%), Gaps = 6/506 (1%)

Query: 39  NNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLS 98
           NN++ +++    + +   I  + KWQNP+YF +  +EYLF+ SC +SQLLNQA   QT  
Sbjct: 30  NNDIVDEK----QCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQP 85

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
           IMNI+ DS  S+ GK+ WL+A+FPL+SGSFILISGRIGDIYGLKKTL+ GYLF I+WSLI
Sbjct: 86  IMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLI 145

Query: 159 SGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
            G T Y+H+D FFI+SRAFQGLGI+ ILPN++GIVG+IY   ++RKN+VIS+IG  APIG
Sbjct: 146 CGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIG 205

Query: 219 AFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSI 278
           A +G++F+GLIGTE+  QWPWAFY                 PN IPTN+HG  MDWIGS 
Sbjct: 206 ATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSG 265

Query: 279 MAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAK-SPILPVEVTK 337
           + V+GLI+LNFVWNQ PI GW  AY              FF YE+ +   +P+LP EV K
Sbjct: 266 LGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLK 325

Query: 338 NRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGA 397
           +   I++L ALF GW              LNLRHY+ LWAG TYFMF IWG VAA++VG 
Sbjct: 326 SPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGF 385

Query: 398 FIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIIL 457
            IK++  S+ILF SM+AFN G I++SVTP+ QTYFR +LG MIILSFGMD+SFPA++I+L
Sbjct: 386 TIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILL 445

Query: 458 SDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXX 517
           SD L +QYQGMAGSL NTMVNYSMS CLG+   VE+ +N  GK++LKGYR A Y      
Sbjct: 446 SDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLA 505

Query: 518 XXXXXXXXXYM-AEVLWAKRKERLSS 542
                     M +E++  ++ E+ S+
Sbjct: 506 SMACIISGALMLSEIIQGRKNEKDSA 531

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/508 (53%), Positives = 349/508 (68%), Gaps = 8/508 (1%)

Query: 39  NNEVSEDELPSS----EQED---NTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQA 91
           ++E + ++L SS    E+ D     IG  S+ QNPDYF   W+EY+F+ S M+SQLLNQA
Sbjct: 7   DDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQA 66

Query: 92  ATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLF 151
           AT QT  + ++++    ++  ++ WL+ASFPLVSGSFIL+SG++GDIYGLKKTL+GGY+ 
Sbjct: 67  ATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVV 126

Query: 152 FIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMI 211
            +IWSLI G + Y+HN  FF+++R+FQGLGIAF+LPNVMGIVGNIYKP+T+ KN+V S+I
Sbjct: 127 VVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLI 186

Query: 212 GASAPIGAFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFA 271
           GA APIGA +G +F+GLIG      W W FY                 PNNIPTN++ + 
Sbjct: 187 GACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYK 245

Query: 272 MDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPIL 331
           MDWIGS + V GLIL NFVWNQ PI GW  AY              F TYEI++AK P+L
Sbjct: 246 MDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQPLL 305

Query: 332 PVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVA 391
           P  V  NR ++MIL++LF GW             +LNLRHYS LWAG TYFMFAIWG VA
Sbjct: 306 PHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVA 365

Query: 392 AVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFP 451
           +++VG  I +   +VILF SM+AF+ G IML+VTPV QTYFRM LG MIILSFGMD+SFP
Sbjct: 366 SLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFP 425

Query: 452 AAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEY 511
           AA+IILSD L  QYQGMAGSL +TM++YSMSLCLG+  T E Q+NK+G ++LKGY+AA Y
Sbjct: 426 AASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALY 485

Query: 512 XXXXXXXXXXXXXXXYMAEVLWAKRKER 539
                          +M E  W  R++R
Sbjct: 486 VGIGLASLGVVISGAFMIEDWWTSRRKR 513

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/475 (57%), Positives = 334/475 (70%), Gaps = 2/475 (0%)

Query: 39  NNEVSEDELPSSEQEDNTIGDH--SKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQT 96
            N   ED++ ++E+E     +   S WQ+P+YF+ KW E LF+ SCMM QLLNQA +  T
Sbjct: 25  RNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMT 84

Query: 97  LSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWS 156
           LS M ++     S   K +WL+ASFPLVSGSFILISGR+GDIYGLKK L+ GY++  IWS
Sbjct: 85  LSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWS 144

Query: 157 LISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAP 216
           LI G + +SHND FFI SRAFQGLGI+F+LPN++GIVGNIYKP T+RKNIVIS+IG  AP
Sbjct: 145 LICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAP 204

Query: 217 IGAFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIG 276
           IGA  G LFAG++       WPWAFY                 PN+IP N++ FAMDWIG
Sbjct: 205 IGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIG 264

Query: 277 SIMAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVT 336
           S + V GL+L NFVWNQ  +VGW   Y              FF +EIKYAK P+LP EVT
Sbjct: 265 SALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVT 324

Query: 337 KNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVG 396
           ++R IIMILA+L  GW             +L LR+YS +WAG T+FM +I G +AA+ VG
Sbjct: 325 ESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVG 384

Query: 397 AFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAII 456
             IKR+  +V+LFFSMIAF  G I+LSVTPV +TYFR  LG M+ILSFGMD+SFPAA+II
Sbjct: 385 FSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASII 444

Query: 457 LSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEY 511
           LSD L+MQYQGMAGSL NT+VNYSMSL LG+G T+ERQINKSG  +L+G+RAA Y
Sbjct: 445 LSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALY 499

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/510 (53%), Positives = 345/510 (67%), Gaps = 3/510 (0%)

Query: 43  SEDE---LPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSI 99
           SEDE     +S  +   + + S WQ+P YF +  +E +FI +CM++QLLNQA     L+I
Sbjct: 34  SEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTI 93

Query: 100 MNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLIS 159
           MN+++ SF SE  K+ WL+ASFPLV+GSFILISGR+GDIYGLKK L+ GY+  I+WSLI 
Sbjct: 94  MNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLIC 153

Query: 160 GFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGA 219
           G + YS+ND FFI  RAFQGLGIAFILPNVMG+VG++YK  + RKN+VIS IGA AP G 
Sbjct: 154 GLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAGG 213

Query: 220 FMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIM 279
             G LF GLI  E+ +QWPW FY                 PNNIPTN+HGF+MDW GS++
Sbjct: 214 MFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVL 273

Query: 280 AVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNR 339
           AVIGLIL NFVWNQ P  GW  AY              FF YE+KYAK P+LP  VTKNR
Sbjct: 274 AVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNR 333

Query: 340 HIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI 399
           H+IMIL A+FLGW              LNLRHYS +W G TYF+F I+GT+AA +V   I
Sbjct: 334 HMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSI 393

Query: 400 KRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 459
           KR+  + +L F+++AF++G IM SV PV Q+++++N G   IL FGMD+SFPA++IILSD
Sbjct: 394 KRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSD 453

Query: 460 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXX 519
           GL M+YQGMAGSL NT++NYS SLCLGMG TVE QINK+GK++LKGYR A Y        
Sbjct: 454 GLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASL 513

Query: 520 XXXXXXXYMAEVLWAKRKERLSSNRDHDMS 549
                  YM E  W  R++R   +   +MS
Sbjct: 514 GVLISFTYMLETFWNNRRDRQKDSVITEMS 543

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/465 (59%), Positives = 333/465 (71%), Gaps = 5/465 (1%)

Query: 50  SEQEDNTIGDHSKW---QNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDS 106
           +E  D  + D  KW   Q+P YF   W+EYLFIF+ MMSQLLNQA T QTLS++NI++ +
Sbjct: 26  TEHSDVQV-DDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKN 84

Query: 107 FKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSH 166
           F S   ++TWL+ASFPLVSGSFIL+SG+IGDIYGLKKTL+ GY+  IIWSLI G T Y+ 
Sbjct: 85  FDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTS 144

Query: 167 NDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFA 226
           +  FFIISRAFQGLGIAFILPN+MGIVGNIY   T RKN+VIS+IGA APIGA MG LF+
Sbjct: 145 SVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFS 204

Query: 227 GLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMAVIGLIL 286
           GLIGT + ++W W FY                 PN IPTN+ G +MDWIGS + ++G+IL
Sbjct: 205 GLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMIL 263

Query: 287 LNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIMILA 346
            NFVWNQGPIVGW  AY              FF YE KYA  P++P     N  ++M L 
Sbjct: 264 FNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLL 323

Query: 347 ALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASV 406
           A+F GW             +LNLR Y+ LWAG +YFMF IWG +AA+ VG  IKRI  S+
Sbjct: 324 AVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSL 383

Query: 407 ILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQ 466
           ILF SM+AF+ G IMLSVTPVDQTYFRM LG MIILSFGMD+SFPA++IILSD L M+ Q
Sbjct: 384 ILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQ 443

Query: 467 GMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEY 511
           GMAGSL +TM+NYSMS+CLG+  TVE QINK+G ++LKGYRAA Y
Sbjct: 444 GMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALY 488

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/500 (54%), Positives = 344/500 (68%), Gaps = 3/500 (0%)

Query: 42  VSEDE---LPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLS 98
           VS DE     +S  + N I + S WQ+P YF +  +E +FI +CM++QLLNQA     L 
Sbjct: 32  VSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALC 91

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
           IMN+++ SF SE   + WL+ASFPL +GSFILISGR+GDIYGLKK L+ GY+  I+WS+I
Sbjct: 92  IMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGYVIIIVWSII 151

Query: 159 SGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
           SG + YS+ND FFI  RAFQG+GIAFILPN+MG+VG++YK  + RKN+VIS+IGA  P G
Sbjct: 152 SGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTG 211

Query: 219 AFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSI 278
           A  G +F GLI TE+P QWPW FY                 PNN+PTN+HG +MDW GS+
Sbjct: 212 ALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSV 271

Query: 279 MAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKN 338
           +AVIGLIL NFVWN+ PI GW KAY              FF YEIKYA+ P+LP  VTKN
Sbjct: 272 LAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKN 331

Query: 339 RHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAF 398
           RH+IMIL A+F+GW              LNLRHYS +W G TYF+FAI+GT+AA  V   
Sbjct: 332 RHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFS 391

Query: 399 IKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILS 458
           IKR+  +++L F+++AF+ G IM SV PV+Q+Y+++N     +L FGMD+SFPA++IILS
Sbjct: 392 IKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILS 451

Query: 459 DGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXX 518
           DGL MQYQGMAGSL NT++NYS SLCLGMG TVE QINKSGK +L+GYRAA Y       
Sbjct: 452 DGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLAS 511

Query: 519 XXXXXXXXYMAEVLWAKRKE 538
                   YM E +W +RK+
Sbjct: 512 LGVLISVTYMLETVWNERKK 531

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/509 (51%), Positives = 339/509 (66%)

Query: 39  NNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLS 98
           ++ V +D++  ++ + ++I ++SKWQ+P YF++ WQEY FI +CM++ LLNQA   QTLS
Sbjct: 37  SDSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLS 96

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
            MN++ DS  S+G  +TWL+ASF L SGSFIL+SGRIGDIYGLK T IGG + F IWS++
Sbjct: 97  TMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSIL 156

Query: 159 SGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
            G + Y+ N  FFII RAFQGLG+AF+LPNVMG+VGNIY   + RKNIVIS IG  AP+G
Sbjct: 157 CGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVG 216

Query: 219 AFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSI 278
              G ++ GLI   N  QWPW F+                 PN++PTNI+   MDWIGS+
Sbjct: 217 QTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSL 276

Query: 279 MAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKN 338
           + VIGLIL+NFVWNQ PI GW KAY              FF YE+K A+SP+LP EVTKN
Sbjct: 277 LGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKN 336

Query: 339 RHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAF 398
           RHI+ I+ +LFLGW              LNLRH+S LWAG+T+F+F I+G++ A+ V   
Sbjct: 337 RHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFT 396

Query: 399 IKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILS 458
           I ++  SV+   S I F  G I+ SVT  DQTY+R +LG  IIL+ GMD+SFP ++IILS
Sbjct: 397 INKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILS 456

Query: 459 DGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXX 518
           D L MQYQGM+GSL NT+ NY+ SLCLGMGTT E Q N  GK++LKGYRAA Y       
Sbjct: 457 DLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGA 516

Query: 519 XXXXXXXXYMAEVLWAKRKERLSSNRDHD 547
                   YMAE LW + ++R  + +  D
Sbjct: 517 LGFAFSFSYMAEDLWIRYRKRRQNEKKED 545

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/508 (53%), Positives = 342/508 (67%), Gaps = 5/508 (0%)

Query: 43  SEDELPS---SEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSI 99
           +EDE  +   S  +   + + S WQ+P YF +  +E +FI +CM++QLLNQA     L I
Sbjct: 34  TEDEEVTTIVSSTKSTQVTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCI 93

Query: 100 MNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLIS 159
           MN+++ SF SE   + WL+ASFPL +GSFILISGR+GDIYGLKK LI GY+  I+WS+IS
Sbjct: 94  MNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIIS 153

Query: 160 GFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGA 219
           G + YS++D FFI SRAFQG+GIAFILPN+MG+VG++YK  + RKNIVIS IGA AP G 
Sbjct: 154 GLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTGG 213

Query: 220 FMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIM 279
             G LF GLI TE+P QWPW FY                 PNN+PTNIHG +MDW GS +
Sbjct: 214 MFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSAL 273

Query: 280 AVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNR 339
           A+IGLIL NFVWNQ PIVGW K Y              FF YE KYA+ P+LP  +TKNR
Sbjct: 274 AIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVYESKYAEVPLLPRAMTKNR 333

Query: 340 HIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI 399
           H+IMIL A+FLGW              LNLRHYS +W G TYF+F I+G++AA  V   I
Sbjct: 334 HMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSI 393

Query: 400 KRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 459
           KR+  +++L FS++AF+ G IM SV PV+Q+Y+++N     IL FGMD+SFPA++IILSD
Sbjct: 394 KRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSD 453

Query: 460 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXX 519
           GL MQYQGMAGSL NT++NYS SLCLGMG TVE QINKSG ++LKGYRAA Y        
Sbjct: 454 GLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASL 513

Query: 520 XXXXXXXYMAEVLWAKRKERLSSNRDHD 547
                  YM E LW   + R S +R  +
Sbjct: 514 GVVISVTYMLENLW--NRHRKSEDRSLE 539

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/511 (53%), Positives = 344/511 (67%)

Query: 39  NNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLS 98
           + E  E    +S  E N + + S WQ+P YF +  +E +FI +CM++QLLNQA     L 
Sbjct: 33  STEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALC 92

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
           IMN+++ SF SE   + WL+ASFPL +GSFILISGR+GDIYGLKK L+ GY+  IIWS+I
Sbjct: 93  IMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSII 152

Query: 159 SGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
           SG + YS++D FFI  RAFQGLGIAFILPN+MG+VG++YK  + RKN+VIS+IGA AP G
Sbjct: 153 SGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAG 212

Query: 219 AFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSI 278
              G +F GLI TE+P+QWPW FY                 PNN+PTN+HG +MDW GS 
Sbjct: 213 GMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGST 272

Query: 279 MAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKN 338
           +AV+GLIL NFVWNQ PI GW +AY              FF YEIKYA+ P+LP  VTKN
Sbjct: 273 LAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAEVPLLPHAVTKN 332

Query: 339 RHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAF 398
           RH+IMIL A+FLGW              LNLRHYS +W G TYF+F I+G++AA  V   
Sbjct: 333 RHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFS 392

Query: 399 IKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILS 458
           IKR+  +++L F+++AF+ G IM SV PV+Q+Y+++N     IL FGMD+SFPA++IILS
Sbjct: 393 IKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILS 452

Query: 459 DGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXX 518
           DGL MQYQGMAGSL NT++NYS SLCLGMG TVERQINKSG+ +LKGYRAA Y       
Sbjct: 453 DGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIYLGIGLAS 512

Query: 519 XXXXXXXXYMAEVLWAKRKERLSSNRDHDMS 549
                   YM E  W K KE      + + S
Sbjct: 513 LGLLISVTYMLENFWNKHKESEKKRLEAETS 543

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/504 (51%), Positives = 340/504 (67%), Gaps = 6/504 (1%)

Query: 43  SEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNI 102
           + DE PS E +++++      +NPDYF +  QEY FIFSCM+SQLLN A T QTLSIMN+
Sbjct: 28  ANDESPSMELKNSSL------RNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNV 81

Query: 103 ITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFT 162
           +T    S    + WL+ASFPLVSGSFIL+SGR+GDIYGLKK LI GY+  +IWSLI+G +
Sbjct: 82  LTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLS 141

Query: 163 DYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMG 222
            YSH+ IFFII+RAFQGLGI+ +LPNV+G++G IYKP T +KN+VIS++GA +PIGA +G
Sbjct: 142 GYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLG 201

Query: 223 SLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMAVI 282
            LF+GL+ TE+   WPWAFY                 PNNIPTN++  +MDWIGS   V+
Sbjct: 202 GLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVL 261

Query: 283 GLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHII 342
           GLIL NFVWNQ P  GW  AY              F  YE++YA++P+LP E+ +NR +I
Sbjct: 262 GLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLI 321

Query: 343 MILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRI 402
           MIL A+  GW             +LNLR+YS LWAG +YF+F I GT+ A+  G  +K+I
Sbjct: 322 MILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKI 381

Query: 403 SASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLT 462
             +V+L FSM+ FN+G I+ SVTPV QTYFR  LGTMIIL  GMD+SFPA++IILSD L 
Sbjct: 382 RPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLP 441

Query: 463 MQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXXXX 522
            Q+QGMAGSL NT++NYS SL LG+  TVE+  NK+G ++L+GYR A Y           
Sbjct: 442 NQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVL 501

Query: 523 XXXXYMAEVLWAKRKERLSSNRDH 546
               YM E ++   K+R   + ++
Sbjct: 502 IAGLYMVETIFDSYKDRKEKDCEN 525

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  519 bits (1336), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 253/506 (50%), Positives = 331/506 (65%), Gaps = 2/506 (0%)

Query: 43  SEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNI 102
           S  ++ S++  DN   + S +QNPDYF+NK+QE+ FIFS M+ QLL+QA   QTLSIMN+
Sbjct: 44  SLTQVLSTDTADND--ESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNV 101

Query: 103 ITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFT 162
           +     S   ++ WL++SFPL  GSFIL+SGR+GDIYGLKK L+GGY+   +WS+I G +
Sbjct: 102 LAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLS 161

Query: 163 DYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMG 222
            Y+HND FFI +RAFQGLG+AF LPN++G++G IY+P   RKN++IS+IGA +P GA +G
Sbjct: 162 SYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLG 221

Query: 223 SLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMAVI 282
            LFAGL    +   WPW+FY                 PN+IPTNIHG  MDW+GS++ V 
Sbjct: 222 GLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVF 281

Query: 283 GLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHII 342
           GLI+LNFV+NQ PIVGWQ AY              F  YE+KYAK+P++P  ++ NR ++
Sbjct: 282 GLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGML 341

Query: 343 MILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRI 402
           MIL +LF GW              LNLRHYS LWAG++YF+F I G+  A++ G  IK+I
Sbjct: 342 MILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKI 401

Query: 403 SASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLT 462
             SV+   SM+ F  G I+ + TPV+QT+FR  LG M +L  GMD SFPA++IILSD L 
Sbjct: 402 KPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLP 461

Query: 463 MQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXXXX 522
           MQYQGMAGSL NT++NYS S+CLGM  TVE + N  GK++L GYRAA Y           
Sbjct: 462 MQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVC 521

Query: 523 XXXXYMAEVLWAKRKERLSSNRDHDM 548
               YM E LW  R   L  N+  D+
Sbjct: 522 VSGGYMIECLWKDRVLSLEENKQTDI 547

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  517 bits (1331), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 273/493 (55%), Positives = 340/493 (68%), Gaps = 1/493 (0%)

Query: 54  DNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGK 113
           D+   + S +QNP+YF+  ++E +FI SCM++QLLNQA   Q+LS MN++ D FKS   K
Sbjct: 64  DDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSK 123

Query: 114 ETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFII 173
           + WL+ASFPLVSGSFILISGR+GDIYGLKK L  GY+   +WS+I G   Y+++D FFI+
Sbjct: 124 QPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIV 183

Query: 174 SRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTEN 233
            R+FQGLGIAFILPN+MG+VGNIYK  T RKNIVIS IG  AP GA +G+LF GLI TE+
Sbjct: 184 CRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTED 243

Query: 234 PKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQ 293
            +QWPW FY                 PNN+PTN++   MDWIGS++ V GL+LLN VWNQ
Sbjct: 244 AEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQ 303

Query: 294 GPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWX 353
            PIVGW +AY              F  YEIKYA SP+LP  V +N+ I+MILAALF GW 
Sbjct: 304 APIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWG 363

Query: 354 XXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMI 413
                        LNLR Y+ LWAG T+FMF IWGTVAA +V   IK++  +V+L FSM+
Sbjct: 364 SFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMV 423

Query: 414 AFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLA 473
           AF+ G IMLSVTPV QTY+RMN+G  IILSFGMD+SFPA++IILSD L MQYQGMAGSL 
Sbjct: 424 AFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLV 483

Query: 474 NTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXXXXXXXXYMAEVLW 533
           NT+VNYS SLCLGMG TVE+Q N  G ++LKGYR+A Y               ++   + 
Sbjct: 484 NTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDII 543

Query: 534 AKR-KERLSSNRD 545
           AKR ++R+ S  +
Sbjct: 544 AKRHRKRIESECE 556

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  506 bits (1304), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 248/486 (51%), Positives = 313/486 (64%)

Query: 64  QNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPL 123
           Q P YF +K  E+ FIF+C+M QLLNQA T Q++SIMNII + F SE  K+ WL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 124 VSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIA 183
           VSGSFIL+ GR GDIYGLKK L+ GY    IWS+I G T Y+H+D FFI+++AFQGLG++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 184 FILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYX 243
           FILPN++G+VG IY+P + +KNI IS IGA AP+GA  G LF+G++  ++ K WPW FY 
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 244 XXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAY 303
                           P+N+PTN +   MDWIGS + V+GL+L +FVWNQ P+ GW KAY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 304 XXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWXXXXXXXXXXX 363
                         FF YEI YA+ P+LP  +T NRHIIMIL A+F+GW           
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 364 XXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLS 423
              LNLRH+S +W G  YF F + G   A  VG  IK I  S+IL  S+  F +G ++ +
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 424 VTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSL 483
           VTP DQTY+R   G M++L  GMD+SFPA++IILSD L  +YQGMAGSL NTMVNYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 484 CLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXXXXXXXXYMAEVLWAKRKERLSSN 543
           CLG+ TTVE+QIN SG ++LKGYRAA Y               YM E  W   KE+    
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545

Query: 544 RDHDMS 549
            D + S
Sbjct: 546 NDIESS 551

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  501 bits (1289), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 247/509 (48%), Positives = 330/509 (64%), Gaps = 4/509 (0%)

Query: 40  NEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSI 99
           + VS D   +SE     +   +K  +P YF+N+  EYLFI SCM+SQ ++QA   Q LSI
Sbjct: 67  SSVSNDSDINSEN----LQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSI 122

Query: 100 MNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLIS 159
           MNI+ +   +E  ++ WL+ASF L  GSFIL+SGR+GDIYGLKK L+GGY    IWSLI 
Sbjct: 123 MNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLIC 182

Query: 160 GFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGA 219
           GF+ YSHND FFI SRAFQGLG+AF+LPN +G++G IY+P + +KN++I  +GA +PIGA
Sbjct: 183 GFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGA 242

Query: 220 FMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIM 279
            +G LFAG+IGT++PKQWPW+FY                 PNNIPTNI+  +MDWIG+I+
Sbjct: 243 TLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAIL 302

Query: 280 AVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNR 339
            + GL++LNFV+NQ PIVGWQ AY              F  YE+KYAK+P++P  ++ NR
Sbjct: 303 GIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNR 362

Query: 340 HIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI 399
            ++MIL ALF GW             +LN+R Y+A WAG +YF+F + G   A + G  +
Sbjct: 363 GMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMM 422

Query: 400 KRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 459
           K++  SVIL+ SMI F  G +ML+VTP+ Q+YF+  LG M +L  G+D+SFPAA+IILSD
Sbjct: 423 KKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSD 482

Query: 460 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXX 519
            L +QYQGMAGSL  T+ NYS S+CLGM  +VE   N +G+ ILKGYR A          
Sbjct: 483 ALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGL 542

Query: 520 XXXXXXXYMAEVLWAKRKERLSSNRDHDM 548
                  YM   L   R+   S+N+   +
Sbjct: 543 GIIVSGIYMVINLITIRENSKSTNKPKHL 571

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  391 bits (1005), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 196/498 (39%), Positives = 285/498 (57%), Gaps = 2/498 (0%)

Query: 49  SSEQEDNT--IGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDS 106
           S+   DN   I +    + PD F+N++QE+ F+   ++ Q L+Q    Q LS MNI+ + 
Sbjct: 94  SATPPDNKPFITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEE 153

Query: 107 FKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSH 166
             +   ++ WL+A+FPL  G  ILISGR+GDI+GLKK L+ GY+   IW+LI GF+ Y+H
Sbjct: 154 LHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAH 213

Query: 167 NDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFA 226
           +D  FI+SR FQGLG+A  LPN+  ++G IYKP   +KN++  +IGA +PIGA +G +FA
Sbjct: 214 SDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFA 273

Query: 227 GLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFAMDWIGSIMAVIGLIL 286
           GL    N K WPW+FY                 PN+I  N  G  MDWIGS + + GL++
Sbjct: 274 GLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVV 333

Query: 287 LNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIMILA 346
           LNFV+NQ PI GW  AY              F  YE+  A  P++P  +  N  +I+IL 
Sbjct: 334 LNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILL 393

Query: 347 ALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASV 406
            LF GW              LNLRHYS LWA ++ F+  I GT+  +I    ++R+   +
Sbjct: 394 TLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPI 453

Query: 407 ILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQ 466
           +LFFSM+ F  G I+ +VTP+ QT+FR   G+M +   GM  SFP+A+++ ++ L   Y+
Sbjct: 454 LLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYK 513

Query: 467 GMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXXXXXXXX 526
            MAGSL N  +NY+ S+C+GM  +     N  G+++L G+RAA Y               
Sbjct: 514 SMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGL 573

Query: 527 YMAEVLWAKRKERLSSNR 544
           YM   +W  R +++  N+
Sbjct: 574 YMIGSIWTDRNQKMKENK 591

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  297 bits (761), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 178/517 (34%), Positives = 277/517 (53%), Gaps = 19/517 (3%)

Query: 39  NNEVSEDEL----PSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATP 94
           ++ V+E+ L     + +++D  + D    Q        W E  F+     +QL+ QA   
Sbjct: 4   SSPVTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLW-ESAFVGVLCSAQLMTQAGLG 62

Query: 95  QTLSIMNIITDSFKSEG-GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFI 153
           Q+L+ ++II DSF +   G+ +W  +++ L  G+FILI+GR+GDI+G KK  + G+ ++ 
Sbjct: 63  QSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYA 122

Query: 154 IWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGA 213
           +WSL++GF+ YS N IFF   RAFQG+G AF+LPN + I+G  YKP  +RKN+V S+ GA
Sbjct: 123 LWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-RRKNMVFSLFGA 180

Query: 214 SAPIGAFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTN--IHGFA 271
           SAP G  +G++F+ ++G      WPWA++                 P+    N  +  F 
Sbjct: 181 SAPGGFVLGAVFSSMLG--QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFK 238

Query: 272 M----DWIGSIMAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAK 327
           +    D+ GS+  V+GLIL NF WNQGP+VGWQ  Y              F   E + A 
Sbjct: 239 LLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR-AA 297

Query: 328 SPILPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIW 387
            P+LP     +     +L+ +  GW             + + R  + L +   +   AI 
Sbjct: 298 FPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAIS 356

Query: 388 GTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMD 447
           G  AA++ G  +     S ++FF+M AF +G I+++  PV QTY+     ++I++ +GMD
Sbjct: 357 GFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMD 416

Query: 448 MSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYR 507
           MSFPAA I+LSD +  ++QG+A SL NT+VNYS+S+ LG+  T+E  +N  G  +LKGYR
Sbjct: 417 MSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYR 476

Query: 508 AAEYXXXXXXXXXXXXXXXYMAEVLWAKRKERLSSNR 544
            + Y               Y       K K+R+S  +
Sbjct: 477 CSWYLGIGLSGFGIFVAATYAVSTF-MKSKKRVSEKQ 512

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  296 bits (759), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 174/483 (36%), Positives = 264/483 (54%), Gaps = 19/483 (3%)

Query: 39  NNEVSEDELPSSEQEDN----TIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATP 94
            N+  +D L      D     +   H+  Q P+       E  F+     +QL+ QA   
Sbjct: 8   ENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLLG---EAAFVGVICGAQLMTQAGLG 64

Query: 95  QTLSIMNIITDSFKSEG-GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFI 153
           Q+++ ++II DSF +   G+ +W  A++ L  G+FILI+GR+GD+YG KK  I G+ ++ 
Sbjct: 65  QSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYA 124

Query: 154 IWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGA 213
           +WSL++GF+ YS N IFF   RAFQG+G A +LPN + I+G  Y P  +RK +++S+ GA
Sbjct: 125 LWSLLAGFSVYS-NQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPG-RRKAMILSLFGA 182

Query: 214 SAPIGAFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPN----NIPTNIHG 269
           +AP G  +G++F+ + G      WPWA++                 P      + T++  
Sbjct: 183 TAPAGFVLGAVFSSIFGQLT--WWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVST 240

Query: 270 FA-MDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKS 328
           +  +D  GS+  VIGL+LLNF WNQGP+VGWQ  Y              F   E + A  
Sbjct: 241 YQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR-APH 299

Query: 329 PILPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWG 388
           P+LP+    +     +L  +  GW             L  LR +S L     +   AI G
Sbjct: 300 PLLPLSALSS-DAAFVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISG 358

Query: 389 TVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDM 448
             AA+  G  I R+ AS+++ F+M AF +G I+++  PV Q Y+     ++I++ +GMDM
Sbjct: 359 LCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDM 418

Query: 449 SFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRA 508
           SFPAA I+LSD +  ++QG+A SL N +VNYS+S+ LG+  TVE ++N  G  +LKGYR 
Sbjct: 419 SFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRG 478

Query: 509 AEY 511
           A Y
Sbjct: 479 AWY 481

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  295 bits (755), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 173/475 (36%), Positives = 265/475 (55%), Gaps = 14/475 (2%)

Query: 44  EDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNII 103
           E    +++ +D  + +  + Q+       W E  F+     +QL+ QA   Q+++ ++II
Sbjct: 13  ETSAETTKTDDEVLLNQFELQDETPGSLVW-EAAFVGVLCSAQLMTQAGLGQSIAPLHII 71

Query: 104 TDSF-KSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFT 162
            DSF  +  G+ +W  +S+ L  G+FILI+GR+GDI+G +K  I G+ ++ +WSL++GF+
Sbjct: 72  GDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGFS 131

Query: 163 DYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMG 222
            YS N IFF   RAFQG+G AF+LPN + I+G  YKP  +RKN+V S+ GASAP G  +G
Sbjct: 132 VYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-KRKNMVFSLFGASAPGGFVLG 189

Query: 223 SLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPN-NIPT-NIHGFAM----DWIG 276
           ++F+ ++G      WPWA++                 P+  +P+ +   F M    D+ G
Sbjct: 190 AVFSSMLG--QLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLERVDFAG 247

Query: 277 SIMAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVT 336
           S+  VIGLIL NF WNQGP+VGW+  Y              F   E + A  P+LP    
Sbjct: 248 SVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AAYPLLPFAAL 306

Query: 337 KNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVG 396
            +     +L  +  GW             +   R  S L +   +   AI G  AAV  G
Sbjct: 307 SS-DAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCAAVTTG 365

Query: 397 AFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAII 456
             +    AS ++ F+M AF +G+I+++  PV QTY+     ++I++ +GMDMSFPAA I+
Sbjct: 366 FLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIM 425

Query: 457 LSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEY 511
           LS+ +  ++QG+A SL NT+VNYS+S+ LG+  T+E Q+N  G   LKGYR + Y
Sbjct: 426 LSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWY 480

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  293 bits (749), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 172/477 (36%), Positives = 265/477 (55%), Gaps = 14/477 (2%)

Query: 75  EYLFIFSCMMSQLLNQAATPQTLSIMNIITDSF-KSEGGKETWLIASFPLVSGSFILISG 133
           E  F+     +QL+ QA   Q+L+ ++II +SF  +  G+ +W  +++ L  G+FILI+G
Sbjct: 42  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAG 101

Query: 134 RIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIV 193
           R+GDI+G KK  + G+ ++ +WSL++GF+ YS N IFF   RAFQG+G AF+LPN + I+
Sbjct: 102 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAIL 160

Query: 194 GNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXX 253
           G  YKP  +RKN+V S+ GASAP G F+G++F+ ++G      WPWA++           
Sbjct: 161 GRTYKPG-RRKNMVFSLFGASAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIACFVLAV 217

Query: 254 XXXXXXPNN-IPT-NIHGFAM----DWIGSIMAVIGLILLNFVWNQGPIVGWQKAYXXXX 307
                 P+  +P+ +   F +    D+ GS+  V+GLIL NF WNQGP+VGWQ  Y    
Sbjct: 218 AGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 277

Query: 308 XXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLL 367
                     F   E + A  P+LP     +     +L+ +  GW             + 
Sbjct: 278 LIVGTFFLVIFAYIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 335

Query: 368 NLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPV 427
           + R  + L +   +   AI G  AAV  G  +     S ++ F+M AF +G I+++  PV
Sbjct: 336 DSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPV 395

Query: 428 DQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGM 487
            QTY+     ++I++ +GMDMSFPAA I+LSD +  ++QG+A SL NT+VNYS+S+ LG+
Sbjct: 396 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 455

Query: 488 GTTVERQINKSGKEILKGYRAAEYXXXXXXXXXXXXXXXYMAEVLWAKRKERLSSNR 544
             T+E ++N  G + LKGYR + Y               Y A   + K K+R+S  +
Sbjct: 456 AGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATY-AWSTFMKSKKRISEKQ 511

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  289 bits (740), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 168/476 (35%), Positives = 261/476 (54%), Gaps = 17/476 (3%)

Query: 42  VSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMN 101
           +S  +L S E++D+ +      QN   + +  +E   I     +QL+ QA   Q++  + 
Sbjct: 1   MSSKKLNSHEEQDSLL-----LQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQ 55

Query: 102 IITDSFKSEG-GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISG 160
           II DSF  +  G+ +W  ++F L  G+FILI+GR+GD +G KK  + G+L++ +WS+++G
Sbjct: 56  IIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAG 115

Query: 161 FTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAF 220
           F+ YS N IFF   RAFQG+G AF LPN + I+   Y+P  +++N++ S+ GA AP G  
Sbjct: 116 FSVYS-NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPG-RKQNMIFSLFGACAPSGFV 173

Query: 221 MGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFA-----MDWI 275
           +G++F+ L+       WPWA++                 P++ P +          +D  
Sbjct: 174 VGAVFSSLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVA 231

Query: 276 GSIMAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEV 335
           GS+  V+GLIL NF WNQGP+VGW+ +Y              F   E + AK P+LPV  
Sbjct: 232 GSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVR- 289

Query: 336 TKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIV 395
             +   I ++  +  GW             + NLR    L +   +   AI G  AA+  
Sbjct: 290 KLSSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMST 349

Query: 396 GAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAI 455
              + R S S ++  +MIAF +G I+++  PV QTY+     ++I++ +GMDMSFPAA I
Sbjct: 350 EFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATI 409

Query: 456 ILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEY 511
           ILS  +   +QG+A SL NT++NYS+S+ LG   T+E QI+    ++LKGYR A Y
Sbjct: 410 ILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYY 465

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  288 bits (737), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 171/503 (33%), Positives = 266/503 (52%), Gaps = 16/503 (3%)

Query: 51  EQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSF-KS 109
           +++D  + D    Q+       W E  F+     +QL+ QA   Q+L+ ++II  SF  +
Sbjct: 20  KKDDEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTT 78

Query: 110 EGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDI 169
             G+ +W  +++ L  G+FILI+GR+GDI+G KK  + G+ ++ +WSL++GF+ YS N I
Sbjct: 79  NPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NKI 137

Query: 170 FFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLI 229
           FF   RAFQG+G AF+LPN + I+G  YK   +RKN+V S+ GA AP G  +G++F+ L+
Sbjct: 138 FFDCCRAFQGMGPAFLLPNAIAILGRTYK-SGKRKNMVFSLFGACAPGGFVLGAVFSSLL 196

Query: 230 GTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFA------MDWIGSIMAVIG 283
           G      WPWA++                 P+    + H  +      +D+ GS+  VIG
Sbjct: 197 G--QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIG 254

Query: 284 LILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIM 343
           LIL NF WNQGP+VGWQ  Y              F   E + A  P+LP     +     
Sbjct: 255 LILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR-AAFPLLPFAALSS-DTAF 312

Query: 344 ILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRIS 403
           +L+ +  GW             + + R  + L +   +   A+ G  AA+  G  + R  
Sbjct: 313 VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTP 372

Query: 404 ASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTM 463
            S ++ F+M AF  G I+++  PV QTY+     ++I++ +GMDMSFPAA I+LSD +  
Sbjct: 373 PSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPH 432

Query: 464 QYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXXXXXX 523
           ++QG+A SL NT+VNYS+S+ LG+  T+E  +N  G + LKGYR + Y            
Sbjct: 433 EHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFV 492

Query: 524 XXXYMAEVLWAKRKERLSSNRDH 546
              Y       K+ ++ +S + H
Sbjct: 493 AAIYAWSTF--KKSKKRTSEKQH 513

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  283 bits (723), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 172/508 (33%), Positives = 266/508 (52%), Gaps = 16/508 (3%)

Query: 46  ELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITD 105
           EL + E E   +   S  + P   Q+  +E LF+     +QL+ QA   Q+++ + II +
Sbjct: 14  ELKNEEGESLQL-VQSHVEKP---QSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGN 69

Query: 106 SFK-SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDY 164
           SF  S  G+ +W  A++ L  G+FILI+GR+GD++G KK  + G+L++ +WSL++GF+ Y
Sbjct: 70  SFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVY 129

Query: 165 SHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSL 224
           S N IFF   RA QG+G AF+LPN + I+G  Y P  +RK +V S+ GA+AP G  +GS+
Sbjct: 130 S-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPG-KRKQMVFSIFGATAPGGFVLGSV 187

Query: 225 FAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFA-----MDWIGSIM 279
           F+ +        WPWA++                 P   P  I   A     +D  G+  
Sbjct: 188 FSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATT 245

Query: 280 AVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNR 339
            ++GL L+NF WNQGP+VGWQ  Y              F   E + A+ P+LP       
Sbjct: 246 GILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPLLPFAALST- 303

Query: 340 HIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI 399
            +  +L  +  GW             L + R  S L     +   AI G  AA+  G  +
Sbjct: 304 DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYIL 363

Query: 400 KRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 459
             + A  ++  +MIAF +G ++++  P++QTY+     ++II+ +GMDMSFPAA I++S+
Sbjct: 364 SHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISN 423

Query: 460 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYXXXXXXXX 519
            +  ++QG+A SL NT+VNYS+SL LG   T+E ++N  G   L+GYR A Y        
Sbjct: 424 AMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGL 483

Query: 520 XXXXXXXYMAEVLWAKRKERLSSNRDHD 547
                  Y    L   ++E+LS    ++
Sbjct: 484 GVLVAIVYAWSTLKKFKEEQLSEKSSNN 511

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  268 bits (685), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 158/478 (33%), Positives = 254/478 (53%), Gaps = 17/478 (3%)

Query: 40  NEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSI 99
           +E +E  +  +++      D   W     F    +EY F+F+ +M+Q  NQA     L +
Sbjct: 15  SECTERSISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILPL 74

Query: 100 MNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLIS 159
           +N+++DSF  +     +L+ S+P+V GSF+LI GR+G+++G K+TL+GGY+  I+ SL+ 
Sbjct: 75  VNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLLG 129

Query: 160 GFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQ--RKNIVISMIGASAPI 217
           G + YS + IF++I RAFQG+G+A ILPN        Y+   +  RK I+ ++IG  A  
Sbjct: 130 GLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGAST 189

Query: 218 GAFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTN----IHGFAMD 273
           GAF+G+  +G+  T +   W WA+Y                 P+NI       ++G  + 
Sbjct: 190 GAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNITKKNKPCLNG--LG 247

Query: 274 WIGSIMAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPV 333
           W  +     GL++LN   N   +     ++              F  +E+K+++ P+   
Sbjct: 248 WFSN--RSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSK 305

Query: 334 EVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAV 393
           E+  N  + ++LA++F GW             LLNLR+YS L AG+TY    I G VA +
Sbjct: 306 ELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEI 365

Query: 394 IVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAA 453
            +   +KR    + L FS + F   +I+LSVTP+ Q+YFR  LG+MI L+ G+D SFP++
Sbjct: 366 GISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSS 425

Query: 454 AIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEY 511
           AIIL + L  +Y  M   L N + NY++S   G+  +  R +  S  E++K YR   Y
Sbjct: 426 AIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSL--SSIELIKYYRYVYY 481

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  170 bits (430), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/454 (25%), Positives = 205/454 (45%), Gaps = 20/454 (4%)

Query: 48  PSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSF 107
           P+ E+ D          N     +   E +F+     SQ+L  A   Q +  M++I + F
Sbjct: 55  PAPEEHDPPCTGEEATLN----MSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWF 110

Query: 108 K-SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSH 166
           K +      W    +    GSF+LI+G++GD+ G K   + GY +  +WSL++GF+ Y  
Sbjct: 111 KLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCP 170

Query: 167 NDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFA 226
           +  FF   RA QG+G AF   + + I+G  Y P  +RKN + S  GA    G  +G +F+
Sbjct: 171 SSHFFFFCRAAQGIGAAFTFTSALSILGKSYPP-CKRKNFIFSFFGACGSFGVVLGMVFS 229

Query: 227 GLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNI-----PTNIHGFAMDWIGSIMAV 281
            L        W WA++                 P ++      +N+  F  D++G+ + V
Sbjct: 230 ALF--TQLAHWSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSNV--FYFDYLGAFLFV 285

Query: 282 IGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILP-VEVTKNRH 340
            GL+L +  WNQ P  G+ + Y                  E K    P+LP   ++ N  
Sbjct: 286 TGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETK-VDDPLLPWTHISANT- 343

Query: 341 IIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIK 400
            + +L A+F  +              L  +  + L A       A+ G  AA+     + 
Sbjct: 344 -LKVLLAIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLN 402

Query: 401 -RISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 459
             +   + +  S++AF +  I+++     QTY+     T I++SFG+D+SFP+A ++LS+
Sbjct: 403 IHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSN 462

Query: 460 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVER 493
            +  +++G+  SL   ++NY+ +L      +V R
Sbjct: 463 RIPDKFKGLGASLVGAVLNYATALGPPTAASVLR 496

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  155 bits (392), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 96/125 (76%)

Query: 83  MMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLK 142
           MMSQLLNQ  T QTL ++N+++  F+S   ++T L+AS PLVSGSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 143 KTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQ 202
            TL+ GY   I+WS I G T Y+ +  FF+I+RAFQGLG+AF+LPNVMG V N+Y   + 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 203 RKNIV 207
           RKN+V
Sbjct: 121 RKNMV 125

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 473 ANTMVNYSMSLCLGMGTTVERQINKSGKEIL 503
              M+ YSM +CLG+  TVE +++K G + L
Sbjct: 153 GQAMLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  146 bits (368), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 103/369 (27%), Positives = 178/369 (48%), Gaps = 10/369 (2%)

Query: 128 FILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSH-NDIFFIISRAFQGLGIAFIL 186
           F++I+G++GDI G K   I GY +  +WSL++GF+ Y+  N +FF   R  QG+G AF+ 
Sbjct: 104 FVIIAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLT 163

Query: 187 PNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYXXXX 246
           P  + ++G  Y P  +RKN V S  GA  P G   GS+F+ L        W W ++    
Sbjct: 164 PTGLALLGKHYPP-CKRKNYVFSFYGACGPFGIVAGSVFSALF--TQLTTWAWTYWSMAV 220

Query: 247 XXXXXXXXXXXXXP-NNIPTNIHG--FAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAY 303
                        P +N P       ++ D++G    + G+IL + VWNQ P+  ++  Y
Sbjct: 221 TCLIITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPY 280

Query: 304 XXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWXXXXXXXXXXX 363
                             + +  K P++P + +   ++I  L  +F G+           
Sbjct: 281 VYSLLIVSVVFMTMALIIDSR-VKDPLIPWK-SMCSNVIKALIVVFFGFLGFTIWLFYSW 338

Query: 364 XXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI-KRISASVILFFSMIAFNIGLIML 422
              L  ++ S L A   +    I G  AA      + K++   + L  ++ AF I  I++
Sbjct: 339 RFYLVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILI 398

Query: 423 SVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMS 482
           S   + +TY+       +I++ G+D++FP+A ++LS+G+  + QG+A +LA T +NY  +
Sbjct: 399 STMTLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTA 458

Query: 483 LCLGMGTTV 491
           L  G+ T +
Sbjct: 459 LGPGVATLI 467

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  134 bits (338), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 109/424 (25%), Positives = 198/424 (46%), Gaps = 22/424 (5%)

Query: 74  QEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSE---GGKETWLIASFPLVSGSFIL 130
           +E   +   + SQL+      Q + I   + + ++ E   GG   W  AS+ L S   +L
Sbjct: 37  REIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMVL 96

Query: 131 ISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSH-NDIFFIISRAFQGLGIAFILPNV 189
           I+G++GD+ G K+ ++ G+++  IWSLI+GF+ Y   N  F+  +RA QG+G  FI+PN 
Sbjct: 97  IAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPNS 156

Query: 190 MGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYXXXXXXX 249
           + I+G  Y     +K I+ S+ G     G  +G+ F+ L       +W W ++       
Sbjct: 157 LAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLT--KWAWNYWALACVCV 214

Query: 250 XXXX-XXXXXXPNNIPTNIHGFAM----DWIGSIMAVIGLILLNFVWNQGPIVGWQK--A 302
                      P+NI    +   +    D++G+I  V GL+L +  + Q   +GW     
Sbjct: 215 LYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWSPPHT 274

Query: 303 YXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWXXXXXXXXXX 362
           Y              F  + +     P++P++  +   +++IL  ++ G+          
Sbjct: 275 YITLIIGVILILIAMFVDWRV---DDPLVPLQHLR-ADVVVILICVYFGFLSFVIWANWF 330

Query: 363 XXXLLNLRHYSALWAGTTYFMFAIWGTVAAVI--VGAFIKRISASVILFFSMIAFNI-GL 419
                 + + S L         AI G++ A I  V      I A  ++  SM+ F +  +
Sbjct: 331 WQFYELVHNDSPLRIAAKLVPLAI-GSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVPNI 389

Query: 420 IMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNY 479
           +M +VTP + TY+     + II  F +D++ P A ++ SD +  + QG+A SL  T+++Y
Sbjct: 390 LMATVTP-NTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVISY 448

Query: 480 SMSL 483
           ++S+
Sbjct: 449 AISI 452

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  121 bits (304), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 108/456 (23%), Positives = 193/456 (42%), Gaps = 31/456 (6%)

Query: 59  DHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKET--- 115
           D  +  NP    ++ +E +FI     SQ ++ AA  Q +  M+ IT  F+    +     
Sbjct: 55  DQLESMNPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAG 114

Query: 116 WLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSH--NDIFFII 173
           W  A+F +  G+FI+ +G++ D+ G K   I GY ++ +WSL+ G + Y+      FF  
Sbjct: 115 WANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFF 174

Query: 174 SRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTEN 233
            R  QG+G A + P+ + ++G  Y P   +KNIV S+ G   P+G  +G +F+ +     
Sbjct: 175 GRGCQGIGAAALFPSSLALLGKYYPPSC-KKNIVFSLYGFCVPLGVVVGGVFSAIF--TQ 231

Query: 234 PKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNI-------------HGFAMDWIGSIMA 280
              W W ++                 P   P  I             H    D++G+ + 
Sbjct: 232 LAHWSWNYWSMAIVSAFFTLISCFYIP---PDEIIKSEEQKKKRAWFHLPKFDYLGTFLY 288

Query: 281 VIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRH 340
           V  L+L    WNQ     ++                     E  Y   PI+P      + 
Sbjct: 289 VASLLLFAVCWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVEF-YVDDPIIPARKIHPQT 347

Query: 341 IIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIK 400
           I  +L  +F  +                +R+ + L     +   +I G +AA+     I 
Sbjct: 348 IKALL-VVFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLIS 406

Query: 401 R-ISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 459
             +   + L     +F +  I+       ++Y+     T+II+S G+D+SFP+A ++LS+
Sbjct: 407 TAVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSN 466

Query: 460 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQI 495
           G+  + +G++ +L  T +NY      G+G  + + I
Sbjct: 467 GVPQELRGISAALVGTALNYGT----GIGPPIAQTI 498

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 113/537 (21%), Positives = 220/537 (40%), Gaps = 74/537 (13%)

Query: 40  NEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSI 99
            E  +D+  S +   +++    K Q+P    +   + +FIF    SQ +  A+  Q +  
Sbjct: 39  TETVQDQ-QSHKVTHSSLIRLQKLQSPT--NSYLNDIIFIFLICSSQFITLASASQAILQ 95

Query: 100 MNIITDSFK---SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWS 156
           M+ ++  FK   +   +  W+ ASF +  G+FI+++G++ DI   +   I GY++F +W+
Sbjct: 96  MDSLSVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWT 155

Query: 157 LISGFTDY-SHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYK-PD-------------- 200
           LI+GF  Y   N IF  I R  QG+G A + P+ + ++   Y  P+              
Sbjct: 156 LITGFASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTS 215

Query: 201 -------------------------------TQRKNIVISMIGASAPIGAFMGSLFAGLI 229
                                             K+I  S+ GA AP+G  +G +F+ + 
Sbjct: 216 APSPSHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIF 275

Query: 230 GTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIP-----TNIHGFA----MDWIGSIMA 280
                  WPW ++                    IP     +N +        D++G I+ 
Sbjct: 276 --TQLATWPWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILG 333

Query: 281 VIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSPILPVEVTKNRH 340
           +  LIL    W+Q  +  ++  +                 +E  Y  +PI+P+    +  
Sbjct: 334 ISALILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWE-YYFNNPIIPIR-QIHPG 391

Query: 341 IIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVI-VGAFI 399
            I  L  +F  +                ++  S +     +   ++ G ++A   +   +
Sbjct: 392 TIKALLVVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIV 451

Query: 400 KRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSD 459
           KR+   + L     +F +  I+L    +D +Y+     ++I +S G+D+SFP+A ++L++
Sbjct: 452 KRVPVQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTN 511

Query: 460 GLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSG-------KEILKGYRAA 509
           G+  + QG+  +L  +++NY  ++   +  T+ +   +S        K  LKG   A
Sbjct: 512 GIPPEIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIA 568

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 90/212 (42%), Gaps = 17/212 (8%)

Query: 41  EVSEDELPSSEQEDNTIGDHSKWQ---NPDYFQNKWQEYL----FIFSCMMSQLLNQAAT 93
           E++   +      D  + +H + +   N  Y +N   E L     +++C  S  L     
Sbjct: 32  EIASHGINEESGTDAEVSNHVEKKPNFNSKYGKNAMGEDLPSGIVLYTCAFSLALAIFLA 91

Query: 94  PQTLSIMN-IITDSFKSEGG--KETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYL 150
              + I++ II D  K  G   K  W+ A + L +    L+ GRI  I G K  ++   +
Sbjct: 92  ALDIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAII 151

Query: 151 FFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISM 210
            F I SLISG  + S N    I  R   G+G + I      I  N+   D +R+ ++I+ 
Sbjct: 152 IFEIGSLISGVAN-SMN--MLIGGRVIAGVGGSGIQSLAFVIGSNLV--DERRRGLIIAC 206

Query: 211 IGASAPIGAFMGSLFAGLIGTENPKQWPWAFY 242
           + ++  + + +G    G   T     W W FY
Sbjct: 207 MSSAFAVASVIGPFLGGAFTTH--ATWRWCFY 236

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 73/151 (48%), Gaps = 14/151 (9%)

Query: 79  IFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDI 138
           ++S  M   L    +    +IMN + + F+ E  K+ W++ SF L + +F  + G++ D+
Sbjct: 43  LYSLWMGSFLGSLDSTIVANIMNKVAEEFE-ESDKKQWIVTSFLLTNTAFQPLYGKLSDL 101

Query: 139 YGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYK 198
            G K  L+  + FF++  L   FT  S N + F I+RA  G+G   I       V +I  
Sbjct: 102 AGRKTALMVAHSFFLVGCL---FTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICT 158

Query: 199 PDTQ-----RKNIVI---SMIGASAPIGAFM 221
           P  +       N+V    SM+G   PIG ++
Sbjct: 159 PKERGVYQGYANVVFGTGSMLG--GPIGGWL 187

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 99/470 (21%), Positives = 171/470 (36%), Gaps = 45/470 (9%)

Query: 69  FQN-KWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGS 127
           FQN  +  Y+ +   M+S   +       LS    I ++++ E    +W + ++ +    
Sbjct: 16  FQNISFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALTAYAITFAG 75

Query: 128 FILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILP 187
           FI   GR+GDI G     +     F I SLI    +   N   F + RA QG+  A I+P
Sbjct: 76  FIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVN---NFGTFAVFRALQGIAAAGIVP 132

Query: 188 NVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYXXXXX 247
           +   ++  +      +    I   G S   G  +G +  G   T     +   FY     
Sbjct: 133 SGYALIPTLSDEHEVQSFFAIVSCGFSTSFG--IGFIIGGAF-TLTRIGYKGIFYLTFAV 189

Query: 248 XXXXXXXXXX---XXPNNIPTN---------IHGFAMDWIGSIMAVIGLILLNFVWNQGP 295
                           N  P               ++D+IGS M +   IL+     +G 
Sbjct: 190 MLVISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMFISSTILIVVGLTEGG 249

Query: 296 IVGWQKAYXXXXXXXXXXXXXXFFTYEIKY---------AKSP-----------ILPVEV 335
              W+K                FF + I Y         A +P           ++P +V
Sbjct: 250 -ESWKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKVYNYFRTIQVLIPKDV 308

Query: 336 TKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIV 395
              ++ I I  A+F  +                +   S L A        +   +  V++
Sbjct: 309 LMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVSMLIPNVVI 368

Query: 396 GAFIKRIS---ASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPA 452
                 IS   A V+ FF M   +I LI L +   D  Y+++   +  +++FG  + FP 
Sbjct: 369 AIKSDLISPRKAVVLGFFIMFIGSIILIQLHLI-TDNLYWKIFFCSQSLIAFGAAIFFPY 427

Query: 453 AAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINK-SGKE 501
           +  IL      +Y+G+A  +  T   + + +   + T++   IN+ SGK 
Sbjct: 428 SLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINELSGKS 477

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 75/159 (47%), Gaps = 5/159 (3%)

Query: 69  FQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSF 128
           F     ++L     +++  L+ A+    + ++  I   F     +  W + S+ +    F
Sbjct: 15  FHQDTLKHLKFICILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGF 74

Query: 129 ILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPN 188
           I   GR+GDI G    +    +F +I+ + S       N I F + RAFQG+  A I+P 
Sbjct: 75  IAFFGRVGDIVGNGIMMC---VFSVIFGIFSLLCAVVPNFIAFTVFRAFQGMAGAGIVPC 131

Query: 189 VMGIVGNIYK-PDTQRK-NIVISMIGASAPIGAFMGSLF 225
              +V  +++ P+ QR  +I+ S+I A A +G  +G  F
Sbjct: 132 AYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAF 170

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 67/143 (46%), Gaps = 8/143 (5%)

Query: 100 MNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLIS 159
           + +I + FK +  K  W+++ + L      L+ GR   I G K +L+   L F   SLIS
Sbjct: 142 IEVIAEQFK-DYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLIS 200

Query: 160 GFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGA 219
             ++ S N    I  R   G+G + I  ++  ++ +   PD  R  I+IS++  S  + A
Sbjct: 201 AISN-SMN--MLIGGRVVAGIGGSGI-QSLCFVIASTLTPDRSRV-IIISVLSCSYAVAA 255

Query: 220 FMGSLFAGLIGTENPKQWPWAFY 242
            +G    G + T     W W FY
Sbjct: 256 VVGPFLGGALTTH--VTWRWCFY 276

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 79/175 (45%), Gaps = 23/175 (13%)

Query: 70  QNKWQEY-------LFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFP 122
           + K+ EY         +FS  +   L+        +IMN + + F SE  ++ W+  SF 
Sbjct: 23  EQKFHEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEF-SESSRKQWIATSFL 81

Query: 123 LVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGI 182
           L + +F  + G++ DI G K  L+  + FF I  L++ F   + N   F I+RA  G+G 
Sbjct: 82  LTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCF---ARNVTEFSIARAICGIG- 137

Query: 183 AFILPNVMGIVGNIYKPD--TQRKNIVIS-----MIGASAPIGAFMGSLFAGLIG 230
                  +  +G+I   D  T R+  V       + G    +GA +G +F   IG
Sbjct: 138 ----AGGLNAIGSIAVSDICTARERGVYQGYANIVFGLGQLLGAPLGGVFIETIG 188

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 4/103 (3%)

Query: 79  IFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDI 138
           +FS  +   L+   +    +IMN + + F SE  K+ W+  SF L + +F  + G++ DI
Sbjct: 39  LFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 139 YGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLG 181
            G K  L+    FF +  L++ F   + N   F I+RA  G+G
Sbjct: 98  TGRKSALLTAQFFFGLGCLLTCF---ARNVTEFSIARAICGIG 137

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 58/119 (48%), Gaps = 11/119 (9%)

Query: 70  QNKWQEY-------LFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFP 122
           + K+ EY         +FS  +   L+   +    +IMN + + F SE  K+ W+  SF 
Sbjct: 23  EQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFL 81

Query: 123 LVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLG 181
           L + +F  + G++ DI G +  L+    FF +  L++ F   + N   F I+RA  G+G
Sbjct: 82  LTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLMTCF---ARNVTEFSIARAVCGIG 137

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/274 (21%), Positives = 98/274 (35%), Gaps = 34/274 (12%)

Query: 98  SIMNIITDSFKSEGG---KETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFII 154
           +I+  + D   SE     + +W+  ++ L S +F  + G++ DI+G +  L+   L F +
Sbjct: 158 TIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCL 217

Query: 155 WSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQR---KNIVISMI 211
            +LI G    S N    ++ R   G+G    L ++  I      P   R   + I     
Sbjct: 218 GALICGM---SKNLWVLVLGRFVAGIG-GGGLTSMCSITTTDIVPLRSRALYQGICNVFF 273

Query: 212 GASAPIGAFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXXXXPNNIPTNIHGFA 271
           G     G  +G LFA     +    W  AF                      P + H  A
Sbjct: 274 GLGTACGGLVGGLFA-----DRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGA 328

Query: 272 -------------MDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXF 318
                        +DW G++  V+ L     V +   + G    +              F
Sbjct: 329 GQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYF 385

Query: 319 FTYEIKYAKSPILPVEVTKNRHIIMILAALFLGW 352
             +E+  A  PILP+   +NR    +LAA    W
Sbjct: 386 IYHELYVATDPILPIRFLENRS---VLAASLSNW 416

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 76/167 (45%), Gaps = 10/167 (5%)

Query: 79  IFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGG---KETWLIASFPLVSGSFILISGRI 135
           +++C++S +L+       + I++ I ++   E G   K  W+ A + L S    LI GRI
Sbjct: 54  LYACVISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRI 113

Query: 136 GDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGN 195
             + G K +++   + F + SL++   +        I  R   GLG + I      I+  
Sbjct: 114 AAVCGFKSSMLTAIIIFEVGSLVAALANSMD---MLIGGRVIAGLGGSGIQTLCFVIIST 170

Query: 196 IYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFY 242
           +   +  ++ ++I+ +G++  I + +G    G   T     W W F+
Sbjct: 171 LV--EESKRGLLIACMGSAFGIASVVGPFLGGAFTTH--VTWRWCFW 213

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 4/103 (3%)

Query: 79  IFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDI 138
           +FS  +   L+   +    +IMN + + F SE  ++ W+  SF L + +F  + G++ DI
Sbjct: 39  LFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 139 YGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLG 181
            G K  L+    FF +  L++ F   + N   F I+RA  G+G
Sbjct: 98  TGRKSALLIAQFFFGLGCLLTCF---ARNVTEFSIARAICGIG 137

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 82/201 (40%), Gaps = 10/201 (4%)

Query: 39  NNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLS 98
             EV E +L S++ +  TI D  ++  P    +  Q+++ +    M    +   +P    
Sbjct: 66  TREVEESDLESAD-DVKTIKDSQEYVAPYTLFSYSQKWIMVGLLTMCGFWSSLGSPIYYP 124

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
            +  +   F  +       +  + L  G    + G + DIYG +  ++ G L +I+ S+ 
Sbjct: 125 ALRQLEKQFDIDENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVILFGMLVYIVASIA 184

Query: 159 SGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
               + S+  I F+  R  Q  GI+ I+    G VG+ +    +R   V ++ G      
Sbjct: 185 LACAN-SYGVIIFL--RCLQSCGISPIIAISSGCVGD-FTMKAERGTFVGAVSGL----- 235

Query: 219 AFMGSLFAGLIGTENPKQWPW 239
             +G  F  LIG      W W
Sbjct: 236 VLLGQAFGSLIGAALAAAWDW 256

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 66/137 (48%), Gaps = 10/137 (7%)

Query: 98  SIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSL 157
           +IMN + + F +E  K+ W+  SF L + +F  + G++ DI G K  ++  + FF +  L
Sbjct: 65  NIMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCL 123

Query: 158 ISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVIS----MIGA 213
           ++ F   + N   F I+RA  G+G   I  N M  +       T+ + I       + G 
Sbjct: 124 LTCF---AQNVTQFSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYANIVFGM 178

Query: 214 SAPIGAFMGSLFAGLIG 230
              +GA +G LF   IG
Sbjct: 179 GQVLGAPLGGLFLDHIG 195

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 68/158 (43%), Gaps = 10/158 (6%)

Query: 62  KWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASF 121
           K QN  Y Q      L  F C    LLN A     +S++  + +++K      +W + S+
Sbjct: 18  KCQNSRY-QLGINITLIFFGCTF-DLLNVAGV---ISVIEDLGETYKLGYTGASWALTSY 72

Query: 122 PLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFT-DYSHNDIFFIISRAFQGL 180
            +    FI   GR+GDI G           F ++SL+     D+    +F    RA QG+
Sbjct: 73  AITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAVVRDFPTFAVF----RALQGI 128

Query: 181 GIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
             A I+P    ++  + +P   +K   I   G S+ IG
Sbjct: 129 SAAGIVPCGYALIPLLAEPQDIQKFFSIVSCGFSSTIG 166

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 84/197 (42%), Gaps = 13/197 (6%)

Query: 43  SEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNI 102
           S D +P  E+ + T    + +    Y Q KW     +F  +M    +   +P     +  
Sbjct: 72  SLDTVPDEEKLEQTSESTAPYTLLSYKQ-KWG---MVFLLVMCGFWSSLGSPIYYPALRQ 127

Query: 103 ITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFT 162
           +   F  +  K    +  + L  G    +SG + D++G +  ++GG + +++ S I    
Sbjct: 128 LEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVAS-IGLAC 186

Query: 163 DYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMG 222
             S+  I F+  R  Q +GI+  +    G+VG     D   K+   + +GA++ +   +G
Sbjct: 187 APSYGVICFL--RCIQSIGISPTIAISSGVVG-----DFTLKHERGTFVGATSGL-VLLG 238

Query: 223 SLFAGLIGTENPKQWPW 239
             F  LIG     +W W
Sbjct: 239 QCFGSLIGAVLTARWDW 255

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 68/147 (46%), Gaps = 10/147 (6%)

Query: 97  LSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWS 156
           ++I+N I D F +   K  WLI  + L +  F L+ GR   I+G K TL+   + F I S
Sbjct: 41  VTILNTIADKFNAYS-KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 157 LISGFTDYSHNDIFFII-SRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASA 215
           L+   +    N +  II  R   G G + I   V  I  ++   D   +  +++++  S 
Sbjct: 100 LVIAVS----NSMDMIIGGRVIAGCGASGIQTLVFAIATSLV--DEHTRGTIVTLLSLSY 153

Query: 216 PIGAFMGSLFAGLIGTENPKQWPWAFY 242
            + + +G    G + TE    W W FY
Sbjct: 154 AVASALGPYIGGAL-TEYV-TWRWCFY 178

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 83/209 (39%), Gaps = 25/209 (11%)

Query: 44  EDELPSSEQE-DNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNI 102
           E+   SS+QE +   G  +         N     L ++ C+ S  L    T   + I+  
Sbjct: 2   EETKYSSQQEIEGACGSDASLNARG--SNDSPMGLSLYLCLASLTLVLFITALDILIVGT 59

Query: 103 ITDSFKSEGG---KETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLIS 159
           I D    + G   K  WL+  + L +    LI GR   I G + +LI   L F   SLI+
Sbjct: 60  IIDVVAEQFGNYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLIA 119

Query: 160 GFTDYSHNDIFFIISRAFQGLG------IAFILPNVMGIVGNIYKPDTQRKNIVISMIGA 213
                 +  IF    R   G+G      + F++   M  VG   +P      +VIS++  
Sbjct: 120 ALASSMNMLIF---GRVVAGVGGSGLQTLCFVIGCTM--VGERSRP------LVISILSC 168

Query: 214 SAPIGAFMGSLFAGLIGTENPKQWPWAFY 242
           +  + A +G +  G   T     W W FY
Sbjct: 169 AFAVAAIVGPIIGGAFTTH--VTWRWCFY 195

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
           IMN I + F  E  K+ W+  SF L + +F  + GR  DI G K  L+    FF++ +L+
Sbjct: 67  IMNKIAEEFH-ESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTLL 125

Query: 159 SGFTDYSHNDIFFIISR 175
           + F   + N   F I+R
Sbjct: 126 TCF---ARNVTEFAIAR 139

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 79  IFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDI 138
           +FS  M   L         +IMN + + F+ E  K+ W+  SF L + +F  + G++ DI
Sbjct: 54  VFSLWMGSFLGALDGTIVANIMNRVAEEFQ-ESDKKQWIATSFLLTNTAFQPLYGKLSDI 112

Query: 139 YGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRA 176
            G K  L+  + FF +  L++ F   + N   F I+RA
Sbjct: 113 TGRKFALLVAHTFFCLGCLLTCF---ARNVTEFSIARA 147

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
           IMN + + F SE  K+ W+  SF L + +F  + G++ D+ G K  L+  Y F +I  L+
Sbjct: 58  IMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIGCLL 116

Query: 159 SGFTDYSHNDIFFIISRA 176
              T  + N   F ++RA
Sbjct: 117 ---TCLARNVTEFAVARA 131

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 80/183 (43%), Gaps = 15/183 (8%)

Query: 52  QEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEG 111
           +EDN + +     N         ++  + S  +   L+   +    +IMN + + F+ E 
Sbjct: 21  EEDNGLEEQYHEYNLSL-----PKFPILLSLWLGSFLSSLDSTIVANIMNKVAEEFE-ES 74

Query: 112 GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFF 171
            K+ W+  SF L + +F  + G++ DI G K  ++  + FF +   ++ F   + N   F
Sbjct: 75  DKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFLTCF---AQNITQF 131

Query: 172 IISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVIS----MIGASAPIGAFMGSLFAG 227
            I+RA  G+G   +  N M  +       T+ + I       + G    +GA +G LF  
Sbjct: 132 SIARAICGIGAGGV--NAMSSITVSDICSTRERGIYQGYANIVFGLGQLLGAPLGGLFID 189

Query: 228 LIG 230
            +G
Sbjct: 190 SVG 192

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 101/471 (21%), Positives = 170/471 (36%), Gaps = 39/471 (8%)

Query: 60  HSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIA 119
            +K Q   Y  N     +F+  C    LLN A+    +S+++ +   +       +W + 
Sbjct: 17  RNKCQKSPYQLNVNVGLIFL-GCTF-DLLNVASM---ISLIDDLAKKYNISYTTASWSLT 71

Query: 120 SFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQG 179
           S+ +    FI   GR+GDI G           F I SL+        N   F + RA QG
Sbjct: 72  SYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLCAVMP---NFPAFAVFRAIQG 128

Query: 180 LGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFM---GSLFAGLIGTENPKQ 236
           +  A ++P    ++  +   +  +K   I   G S+ IG  +   G+  A  IG      
Sbjct: 129 ICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIGYRGIFY 188

Query: 237 WPWAFYXXXXXXX---XXXXXXXXXXPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQ 293
             +A                      P  I       ++D+IGS++ V G IL+     +
Sbjct: 189 LTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTE 248

Query: 294 GPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAK-------------------SPILPVE 334
           G    W +                FF +   YAK                     ++PV+
Sbjct: 249 GG-ESWNRPVTYVTLIIGILLFFGFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPVD 307

Query: 335 VTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVI 394
           V   ++ I I+ A  L                      S L AG       I   V   +
Sbjct: 308 VLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNAL 367

Query: 395 VGAFIKRIS--ASVILFFSM-IAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFP 451
                 ++     V L FS+ +A +I LI L +   D  ++++   +  ++ FG+ + +P
Sbjct: 368 CAFESTKLKPRVGVALGFSLALAGSIILIQLHLIK-DNVFWKIFFSSQALVGFGVAIFYP 426

Query: 452 AAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINK-SGKE 501
            A  I   G   Q +G+A  +A T     + +   +  +V   IN+  GKE
Sbjct: 427 YALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINEMKGKE 477

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 82/201 (40%), Gaps = 11/201 (5%)

Query: 39  NNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLS 98
             E+  D L SS++E N     S   +P       Q++  +    M    +   +P    
Sbjct: 55  TREIDGDSLQSSDEEKNEQASES--TSPYTLLTYKQKWGMVALLTMCGFWSSLGSPIYYP 112

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
            +  +   F  +  K    +  + L  G    ISG + D++G +  ++ G L +++ S I
Sbjct: 113 ALRQLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVAS-I 171

Query: 159 SGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
                 S+  I F+  R  Q +GI+  +    G+VG     D   K+   + +GA++ + 
Sbjct: 172 GLACAPSYGVIVFL--RIIQSIGISPTIAISSGVVG-----DFTLKHERGTFVGATSGL- 223

Query: 219 AFMGSLFAGLIGTENPKQWPW 239
             +G  F  LIG      W W
Sbjct: 224 VLLGQCFGSLIGAVLAAAWNW 244

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 88/196 (44%), Gaps = 13/196 (6%)

Query: 49  SSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFK 108
           SSE ++ +I + +  +N +  +     Y+ + +  +S  L   A    + +  II +  K
Sbjct: 35  SSEHDETSIPEDNVKKNVELSKGSIL-YVSLVAVALSLFL---AALDVMIVSTIIEEVAK 90

Query: 109 SEGGKET--WLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSH 166
             G      WL   + L +   +LI GRI    G K T++   + F I SLIS     S 
Sbjct: 91  QLGSYSEIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALAS-SM 149

Query: 167 NDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFA 226
           N    I  R   G+G   I  ++  ++G+    +++R  ++I+++ +S  I + +G    
Sbjct: 150 N--MLIGGRVIAGIGGCGI-QSLSFVIGSTLVEESKR-GMLIAILSSSFAIASVVGPFLG 205

Query: 227 GLIGTENPKQWPWAFY 242
           G+  +     W W FY
Sbjct: 206 GVFTSS--VTWRWCFY 219

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 9/128 (7%)

Query: 116 WLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFII-S 174
           WL+A + L +  F+L+ GRI  + GLK +L+   + F   SL++G    + N +  +I +
Sbjct: 46  WLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLMAG----AANSMGMLIGA 101

Query: 175 RAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENP 234
           R   G G + I   V G+  +I   + + +  VI+++G +  +    G    G  G    
Sbjct: 102 RVISGFGGSGIESLVYGVGTSIV--EEKHRARVITVLGIAYMLAEGAGPFVGG--GLAEH 157

Query: 235 KQWPWAFY 242
             W W FY
Sbjct: 158 VSWRWCFY 165

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 76/197 (38%), Gaps = 12/197 (6%)

Query: 49  SSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFK 108
           SS+ E     D     N +    K    L++  C+ S  L    T   + I+  I D   
Sbjct: 16  SSQPEIEEASDSDTSLNVNGGDAKMGLSLYL--CLASLTLVLFITALDILIVGTIIDVVA 73

Query: 109 SEGG---KETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYS 165
            + G   K  WL+  + L +    L+ GR   I G + +LI   L F   SL++      
Sbjct: 74  KQFGNYSKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAGSLVAALA--- 130

Query: 166 HNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLF 225
            N +  +I            L  +  ++G     D + + +VIS++  +  + A +G + 
Sbjct: 131 -NSMNMLIVGRVVAGVGGSGLQTLCFVIG-CTMVDERSRPLVISILSCAFAVAAIVGPII 188

Query: 226 AGLIGTENPKQWPWAFY 242
            G   T     W W FY
Sbjct: 189 GGAFTTH--VTWRWCFY 203

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 18/141 (12%)

Query: 98  SIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSL 157
           +IMN + + F+ E  K+ W+  S+ L + +F  + G++ D+ G K  ++  + FF +  L
Sbjct: 59  NIMNRVAEEFQ-ESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCL 117

Query: 158 ISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRK--------NIVIS 209
           ++ F +       F I+RA  G+G   I  N M  +  +    TQR+        NIV  
Sbjct: 118 LTCFANSVTQ---FAIARAICGVGGGGI--NAMSSI-TVSDICTQRERGIYQGYANIV-- 169

Query: 210 MIGASAPIGAFMGSLFAGLIG 230
             G    +GA +G LF   +G
Sbjct: 170 -FGLGQILGAPIGGLFIDTLG 189

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 82/202 (40%), Gaps = 17/202 (8%)

Query: 42  VSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMN 101
           + ED   + ++    +GD         + N     L +F   +  L+  A+       + 
Sbjct: 14  IVEDRSSAQDESSGHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMSAS-------IE 66

Query: 102 IITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGF 161
           +I++ F  +  K  W+++ + L      L+ GR   I+G K +L+   L F   SLIS  
Sbjct: 67  VISEQFN-DYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLISAV 125

Query: 162 TDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQR-KNIVISMIGASAPIGAF 220
           ++ S N    I  R   G+G + I      I   +    T+R + + IS++  +  + A 
Sbjct: 126 SN-SMN--VLIGGRVVAGIGGSGIQSLCFVIASTL---TTERSRGVAISVLSCAYAVAAV 179

Query: 221 MGSLFAGLIGTENPKQWPWAFY 242
            G    G   T     W W FY
Sbjct: 180 AGPFMGGAFTTH--VTWRWCFY 199

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 71/147 (48%), Gaps = 10/147 (6%)

Query: 97  LSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWS 156
           +++   I + FK +  +  WL+  + L +  F L+ GR+  I GLK +L    + F I S
Sbjct: 28  ITLYETIGEKFK-DYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGS 86

Query: 157 LISGFTDYSHNDIFFII-SRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASA 215
           LI   +    N +  II  R   G G + I  +++ +VG     +  R  +VI+++G + 
Sbjct: 87  LIVAVS----NSMGMIIGGRVVAGCGGSGI-QSLVFVVGTSLVEERNR-GMVITVLGLAF 140

Query: 216 PIGAFMGSLFAGLIGTENPKQWPWAFY 242
            +   +G +  G   TEN   W W FY
Sbjct: 141 AVAFAVGPVIGGAF-TENVS-WRWCFY 165

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 62/147 (42%), Gaps = 5/147 (3%)

Query: 96  TLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIW 155
           TL++  I  D F     + TW I    ++     ++ G IGD YG K + I    F ++ 
Sbjct: 95  TLNVKKISHD-FDVTTKQVTWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFMMVL 153

Query: 156 SLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASA 215
            +I+GF    HN  +F+I+RAF G+ +  I  N      +   P+    + +        
Sbjct: 154 EIITGFI--KHNFKYFLIARAFFGVVLGGIFGNSAAQCFDDCPPEAH--SFISGFFQQGY 209

Query: 216 PIGAFMGSLFAGLIGTENPKQWPWAFY 242
            +G  +  +F   +      +W   F+
Sbjct: 210 TLGYLLAVIFTRALADTTKDRWRSCFW 236

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 79/194 (40%), Gaps = 8/194 (4%)

Query: 39  NNEVSEDELPSSEQEDNTIGDH--SKWQN-PDYFQNKWQEYLFIFSCMMSQLLNQAATPQ 95
            NE+ +D+  S    D     H     QN P       Q++  +F   ++   +   +P 
Sbjct: 50  TNELGDDDTSSECSHDEQEQQHIVEGEQNYPHTLLTYRQKWFMVFLMTITGFWSSLGSPI 109

Query: 96  TLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIW 155
               +  +   F  +  K    +  + L  G    ISG + D+YG +  ++GG L F++ 
Sbjct: 110 YYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVA 169

Query: 156 SLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASA 215
           S I      S+  I F+  R  Q +GI+  +    G+V + +    +R   V +  G   
Sbjct: 170 S-IGIAKAPSYGVIVFL--RCIQSIGISPTIAISSGVVSD-FTVKRERGTFVGATSGL-V 224

Query: 216 PIGAFMGSLFAGLI 229
            IG  +G L   +I
Sbjct: 225 LIGQGIGPLLGAVI 238

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 173 ISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTE 232
           I R FQ +G + ++P  +G V ++  P  + K +   M+G +  +G  +G +F GLI   
Sbjct: 206 ILRVFQAIGTSAVIPLGVGTVSDLISPMNRAKGVSYFMLGPN--MGPILGPIFGGLI-LM 262

Query: 233 NPKQWPWAF 241
           N  QW W F
Sbjct: 263 NGNQWRWLF 271

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 116 WLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISR 175
           WL   + L +    LI GRI    G K+T++   + F I SLIS   +        I  R
Sbjct: 106 WLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLISALANSMS---MLIGGR 162

Query: 176 AFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPK 235
              G+G   I  ++  ++G+    ++QR  I+I+++  S  I + +G    G+    +  
Sbjct: 163 VIAGVGGCGI-QSLSFVIGSTLVEESQR-GILIAVLSCSFAIASVVGPFLGGVF--TSSV 218

Query: 236 QWPWAFY 242
            W W FY
Sbjct: 219 TWRWCFY 225

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 87/212 (41%), Gaps = 37/212 (17%)

Query: 42  VSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMN 101
           + ED   + ++    +GD         + N     L +F   +  L+  A+       + 
Sbjct: 14  IVEDRSSAQDESSGHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMSAS-------IE 66

Query: 102 IITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGF 161
           +I++ F  +  K  W+++ + L      L+ GR   I+G K +L+   L F   SLIS  
Sbjct: 67  VISEQFN-DYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLISAV 125

Query: 162 TDYSHNDIFFIISRAFQGLG------IAFILPNVMGIVGNIYKPDTQR-KNIVISMIGAS 214
           ++ S N    I  R   G+G      + F++ + +          T+R + + IS++  +
Sbjct: 126 SN-SMN--VLIGGRVVAGIGGSGIQSLCFVIASTL---------TTERSRGVAISVLSCA 173

Query: 215 APIGA----FMGSLFAGLIGTENPKQWPWAFY 242
             + A    FMGS F   +       W W FY
Sbjct: 174 YAVAAVASPFMGSAFTTHV------TWRWCFY 199

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 87/203 (42%), Gaps = 12/203 (5%)

Query: 43  SEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNI 102
           S  EL +  Q +++  +  +       Q++  +   +++C+ S  L    +   + I++ 
Sbjct: 8   SSKELCT--QAESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILIVST 65

Query: 103 ITDSFK---SEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLIS 159
           I ++     +E  K  WL+  + L +    L+ GR   I G K +++   + F + SL+S
Sbjct: 66  IIETVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLVS 125

Query: 160 GFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGA 219
              + S N    I  R   G+G + +      I+  +   + + + + IS++  S  + +
Sbjct: 126 ALAN-SMN--MLIGGRVISGVGGSGLQTLCFLIISTLV--NERSRGMAISVLSCSFAVAS 180

Query: 220 FMGSLFAGLIGTENPKQWPWAFY 242
            +G    G   T     W W FY
Sbjct: 181 IVGPFLGGAFTTH--VTWRWCFY 201

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 57/131 (43%), Gaps = 7/131 (5%)

Query: 112 GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFF 171
           G   WL+  + L +  F+L+ GR+ +I G K+ L+   + F I SLIS  ++     I  
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISG 102

Query: 172 IISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGT 231
            +   F G GI     ++  +VG     +  R  I+I+ +  S  I   +G    G    
Sbjct: 103 RVVAGFGGSGI----ESLAFVVGTSIVRENHR-GIMITALAISYVIAEGVGPFIGGAFNE 157

Query: 232 ENPKQWPWAFY 242
                W W FY
Sbjct: 158 H--LSWRWCFY 166

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 98  SIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSL 157
           +IMN I   F +E  K+ W+  S+ L + +F  + G++ DI G K  +I  + FF +  L
Sbjct: 64  NIMNSIAAEF-AESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFALGCL 122

Query: 158 ISGFTDYSHNDIFFIISRA 176
           ++ F   + N   F I+RA
Sbjct: 123 LTCF---AQNVTQFSIARA 138

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 55/109 (50%), Gaps = 9/109 (8%)

Query: 131 ISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVM 190
           ISG + D+YG +  ++ G L +++ S+    ++ S+  I F+  R  Q  GI+ ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASIGLACSN-SYGVIVFL--RCVQSAGISPLIAISS 208

Query: 191 GIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           G+VG+ +   ++R + V ++ G      A MG  F  LIG      + W
Sbjct: 209 GVVGD-FTTKSERGSFVGAVSGF-----ALMGQAFGSLIGAGLTAAYDW 251

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 3/83 (3%)

Query: 130 LISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNV 189
           L+ GR+G+ +G ++T+  G L F+I  L  GF D     +  II R   GLG+  +   V
Sbjct: 163 LLVGRLGEKWGRRRTIKYGSLIFVIGGLFQGFADKM---MHLIIGRTISGLGVGLLSTIV 219

Query: 190 MGIVGNIYKPDTQRKNIVISMIG 212
                 I  P  + K   I   G
Sbjct: 220 PIYQSEISPPHNRGKLACIEFTG 242

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 66/167 (39%), Gaps = 10/167 (5%)

Query: 79  IFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGG---KETWLIASFPLVSGSFILISGRI 135
           ++ C+ S  L    T   + I+  I D    + G   K  WL+  + L +    L+ GR 
Sbjct: 34  LYLCLTSLTLVLFITALDILIVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLVWGRF 93

Query: 136 GDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGN 195
             I G + +LI   L F   SL++       N +  +I            L  +  ++G 
Sbjct: 94  ASIIGFQHSLILAVLIFEAGSLVAALA----NSMNMLIVGRVVAGVGGSGLQTLCFVIGC 149

Query: 196 IYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFY 242
               +  R  +VIS++  +  + A +G +  G   T     W W FY
Sbjct: 150 TMVNERSRP-LVISILSCAFAVAAIVGPIIGGAFTTH--VTWRWCFY 193

>KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease;ureidosuccinate
           permease; expression is constitutive but sensitive to
           nitrogen catabolite repression
          Length = 521

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 61/143 (42%), Gaps = 6/143 (4%)

Query: 98  SIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSL 157
           SIM +  D  K  G + +W+   F L    F + S      + + K      +F ++W  
Sbjct: 100 SIMGLRKD-LKMHGNQYSWVGTCFYLGYMIFEIPSSLALQRFPIAKV---SAVFIVLWGF 155

Query: 158 ISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPI 217
           +   T    N   FI +R   G+  + + P  M +    Y+ + Q   +  S+  ASA +
Sbjct: 156 VLCMTSLPKNYASFIATRTVLGILESAVTPAFMLLTSQWYRREEQF--LRTSIWSASAGL 213

Query: 218 GAFMGSLFAGLIGTENPKQWPWA 240
           GA +GSL A  +   +P   P A
Sbjct: 214 GAILGSLIAYGLAVRDPSSLPIA 236

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 65/153 (42%), Gaps = 9/153 (5%)

Query: 92  ATPQTLSIMNIITDSFKSEG--GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGY 149
           A    +++  II +  +  G   K  WL   + L +   +LI GRI  + G K + +   
Sbjct: 56  AALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAI 115

Query: 150 LFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVIS 209
           + F + SL+S   +        I  R   G+G + +   V  I   +   + + + ++I+
Sbjct: 116 VIFEVGSLVSALANSMD---MLIGGRVIAGIGGSGVQSLVFVISSTLV--EERNRGLIIA 170

Query: 210 MIGASAPIGAFMGSLFAGLIGTENPKQWPWAFY 242
           ++ +S  I + +G    G   T     W W FY
Sbjct: 171 VMSSSFGIASVVGPFLGGAFTTH--VTWRWCFY 201

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 66/159 (41%), Gaps = 8/159 (5%)

Query: 60  HSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIA 119
            ++ Q   Y  N     +F+  C    LLN A+    +S+++ +   +       +W + 
Sbjct: 17  RNRCQKSTYQLNVNVALIFL-GCTF-DLLNVASM---ISLIDDLAQKYDISYTTASWSLT 71

Query: 120 SFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQG 179
           S+ +    FI   GR+GDI G          FF I SL+        N   F + RA QG
Sbjct: 72  SYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLCAVM---PNFPAFAVFRAIQG 128

Query: 180 LGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIG 218
           +  A ++P    ++  +   +  +K   I   G S+ IG
Sbjct: 129 ISAAGLVPCAYALIPMLAPEEEVQKYFSIVSCGFSSTIG 167

>ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W
          Length = 494

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 12/109 (11%)

Query: 141 LKKTLIGGYLFFIIWS-----LISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGN 195
           LK+T +  Y+ F+++S     L SGF   SH  +  +  R   G       P +  I+  
Sbjct: 114 LKRTNVKYYMSFLVFSWSIITLCSGFVK-SHKSLLAL--RVLLGTFEGGFFPAMTLIISI 170

Query: 196 IYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENP---KQWPWAF 241
           +YKP  Q K I     G+SA  GAF G +  GL   ++    + W W +
Sbjct: 171 VYKPQEQAKRIAF-FFGSSALSGAFGGLIATGLASVKDAGGLEGWRWLY 218

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 64/145 (44%), Gaps = 8/145 (5%)

Query: 98  SIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSL 157
           +I++ +  SF  +  K  W++  + L +  F L+ GRI    G + +++   + F   SL
Sbjct: 65  TIIDTVCKSF-GDYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSL 123

Query: 158 ISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPI 217
           IS     S N    I  R   G+G + +    + +V      D + + +V+S++  +  I
Sbjct: 124 ISALAR-SMN--MLIAGRVVSGVGGSGL--QTLSLVIGCQLVDEKSRPLVLSLLNCTFAI 178

Query: 218 GAFMGSLFAGLIGTENPKQWPWAFY 242
            + +G    G   T     W W FY
Sbjct: 179 ASIIGPFIGGAFTTH--VTWRWCFY 201

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 58/134 (43%), Gaps = 13/134 (9%)

Query: 112 GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFF 171
           G   WL+  + L +  F+L+ GR+ +I G  + L+   + F + SLIS  ++     I  
Sbjct: 43  GNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISG 102

Query: 172 IISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGA---SAPIGAFMGSLFAGL 228
            +   F G GI     ++  +VG     +  R  ++ ++  +   +  +G F+G  F   
Sbjct: 103 RLIAGFGGSGI----ESLAFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAF--- 155

Query: 229 IGTENPKQWPWAFY 242
                   W W FY
Sbjct: 156 ---NEHLSWRWCFY 166

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 67/150 (44%), Gaps = 9/150 (6%)

Query: 95  QTLSIMNIITDSFKSEGGKET--WLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFF 152
            T+ +  II +  K  G      WL   + L +    LI GRI    G K+T++   + F
Sbjct: 92  DTMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIF 151

Query: 153 IIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIG 212
            + SLIS   + S N    I  R   G+G   I  ++  ++G+    ++ R  ++I+++ 
Sbjct: 152 EVGSLISALAN-SMN--VLIGGRVIAGVGGCGI-QSLSFVIGSNLVEESNR-GVLIAILS 206

Query: 213 ASAPIGAFMGSLFAGLIGTENPKQWPWAFY 242
            S  I + +G    G+  +     W W FY
Sbjct: 207 CSFAIASVVGPFLGGVFTSR--VTWRWCFY 234

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 60/142 (42%), Gaps = 10/142 (7%)

Query: 60  HSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIA 119
             + QN  Y Q      L    C    LLN A     +S++  + +++  E    +W + 
Sbjct: 20  RRRCQNSKY-QLIINMALIFLGCTF-DLLNVAGV---ISVIEDLGETYGLEYTTASWALT 74

Query: 120 SFPLVSGSFILISGRIGDIYGLKKTL-IGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQ 178
           S+ +     I   GR+GDI G      I G+ F +   L +  T++      F + RA Q
Sbjct: 75  SYAITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVVTNFPA----FAVLRALQ 130

Query: 179 GLGIAFILPNVMGIVGNIYKPD 200
           G+  A ++P    ++  +  P+
Sbjct: 131 GIAAAGLVPCGYALIPTLADPE 152

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 37.7 bits (86), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 65/145 (44%), Gaps = 8/145 (5%)

Query: 98  SIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSL 157
           +I++ +  SF  +  K  W++  + L +  F L+ GR+  + G + ++I   + F   SL
Sbjct: 66  TIIDTVCTSF-GDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSL 124

Query: 158 ISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPI 217
           IS     S N    I  R   G+G + +    + +V      + + + +V+S++  +  +
Sbjct: 125 ISALAK-SMN--MLISGRVIAGVGGSGL--QTLSLVIGCQLVNEKSRPLVLSLLNCTFAV 179

Query: 218 GAFMGSLFAGLIGTENPKQWPWAFY 242
            + +G    G   T     W W FY
Sbjct: 180 ASIVGPFLGGAFTTH--VTWRWCFY 202

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
           IMN + + F+ E  K+ W+  SF L + +F  + G++ DI G +  L+  + FF +  L+
Sbjct: 56  IMNRVAEEFE-ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLGCLL 114

Query: 159 SGFTDYSHNDIFFIISRA 176
           + F         F ++RA
Sbjct: 115 TCFAQSVEQ---FALARA 129

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 13/130 (10%)

Query: 116 WLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISR 175
           WL+  + L S  F L+ GR+  + GLK  L+   L F I SLI+     S++    I  R
Sbjct: 82  WLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAV---SNSMGMLIAGR 138

Query: 176 AFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLI--GTEN 233
              G G + I  +++ IVG     +  R  +++ +        AF+GS   G I  G  N
Sbjct: 139 VVAGAGGSGI-QSLVYIVGTSLVSERSRGMVIMVL------TFAFVGSNAGGPILGGALN 191

Query: 234 P-KQWPWAFY 242
               W W F+
Sbjct: 192 EHASWRWCFF 201

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 75/174 (43%), Gaps = 15/174 (8%)

Query: 71  NKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSF--KSEGGKETWLIASFPLVSGSF 128
            KW     IF C +S   N +  P  LS   +I+  F   S+    + +I  F +  G  
Sbjct: 78  KKWSIVTVIFVCQLSMNFNGSVYPHALS---LISKEFHVSSQAANTSQMI--FKVAYGFG 132

Query: 129 ILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPN 188
             +     + YG +  +     F  IW ++ G    + N    I++R   G+  A     
Sbjct: 133 CELWAPWSEEYGRRNIMQLSLFFTNIWQILGG---KAPNFGTIIVARFLGGISQAG-GSV 188

Query: 189 VMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFY 242
            +G+V ++++P  Q     ++ +  ++ +GA +G +F GL+  E    W W F+
Sbjct: 189 TLGVVADMWQP--QDHGYAVAYVVLASVLGAVIGPVFGGLM--EEHLSWHWNFW 238

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 131 ISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVM 190
           ISG + D+YG +  ++ G L ++I S I      S+  + F+  R  Q  GI+ I+    
Sbjct: 137 ISGGLADVYGRRPIILLGMLIYVIAS-IGLACSKSYGAVVFL--RCLQSAGISPIIAINS 193

Query: 191 GIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           G+ G+ +   ++R   V ++ G +      MG  F  LIG      + W
Sbjct: 194 GVAGD-FTVKSERGTFVGAVSGFT-----LMGQAFGSLIGAALTAAYDW 236

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 56/131 (42%), Gaps = 7/131 (5%)

Query: 112 GKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFF 171
           G   WL+  + L +  F+L+ GR+ +I G  + L+   + F I SLIS  ++     I  
Sbjct: 43  GNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGG 102

Query: 172 IISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGT 231
            +   F G GI     ++  +VG     +  R  I+I+ +  S  I   +G    G    
Sbjct: 103 RVIAGFGGSGI----ESLAFVVGTSIVQENYR-GIMITALAVSYVIAEGVGPFIGGAF-- 155

Query: 232 ENPKQWPWAFY 242
                W W FY
Sbjct: 156 NEHLSWRWCFY 166

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 131 ISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVM 190
           +SG + D +G +  ++ G L ++I S I      S+  I F+  R  Q +GI+  +    
Sbjct: 155 VSGGLADCFGRRPIILAGMLIYVIAS-IGLACAPSYGVIIFL--RCIQSIGISPTIAISS 211

Query: 191 GIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           G+VG     D   K+   + +GA++     +G  F  LIG     +W W
Sbjct: 212 GVVG-----DFTLKHERGTFVGATSGF-VLLGQCFGSLIGAVLTARWDW 254

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 265 TNIHGFAMDWIGSIMAV--IGLILLNFVWNQGPIVGWQKAYXXXXXXXX-XXXXXXFFTY 321
           T I  + +D+IG ++AV   GL+L+ F    G    W+ A                F T+
Sbjct: 269 TEIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTW 328

Query: 322 EIKYAKSPILPVEVTKNRHII-MILAALFL 350
           EIK+AK P+ P +  K+R +   ++ A+FL
Sbjct: 329 EIKFAKYPLTPWKTVKDRGVFSALIIAIFL 358

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 131 ISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVM 190
           ISG + D +G +  ++ G L +++ S I      S+  I F+  R  Q +GI+  +    
Sbjct: 155 ISGGLADCFGRRPIILAGMLIYVVAS-IGLACAPSYGVIIFL--RCIQSIGISPTIAISS 211

Query: 191 GIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           G+VG     D   K+   + +GA++     +G  F  LIG     +W W
Sbjct: 212 GVVG-----DFTLKHERGTFVGATSGF-VLLGQCFGSLIGAVLTARWDW 254

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 131 ISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVM 190
           + G + D +G +  ++GG L +++ S +      S+  I F+  R  Q +GI+  +    
Sbjct: 155 VCGGLADCFGRRPIILGGMLVYVVAS-VGLACAPSYGVIIFL--RCVQSIGISPTIAISS 211

Query: 191 GIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           G+VG     D   K+   + +GA++     +G  F  LIG     +W W
Sbjct: 212 GVVG-----DFTLKHERGTFVGATSGF-VLLGQCFGSLIGAVLTARWDW 254

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 9/109 (8%)

Query: 131 ISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVM 190
           ISG + D+YG +  ++ G L ++  S+    ++ S+  I F+  R  Q  GI+ I+    
Sbjct: 141 ISGGLADVYGRRPVILIGMLIYVCASIGLACSN-SYGVIVFL--RCLQSAGISPIIAINS 197

Query: 191 GIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           G+VG+ +    +R   V ++ G +      MG  F  LIG      + W
Sbjct: 198 GVVGD-FTVKQERGTFVGAVSGFT-----LMGQAFGSLIGAALTAAFDW 240

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 92/469 (19%), Positives = 165/469 (35%), Gaps = 44/469 (9%)

Query: 60  HSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIA 119
            +K Q   Y  N     +F+  C    LLN A+    +S+++ +  ++       +W + 
Sbjct: 17  RNKCQKSRYQLNVNVGLIFL-GCTF-DLLNVASM---ISLIDDLAKTYNISYTTASWSLT 71

Query: 120 SFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQG 179
           S+ +    FI   GR+GDI G           F + SL+        N   F + RA QG
Sbjct: 72  SYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLCAVMP---NFPAFAVFRAIQG 128

Query: 180 LGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           +  A ++P    ++  +   +  +K   I   G S+ IG  +G +  G   T     +  
Sbjct: 129 ICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGAFATTKIG-YRG 185

Query: 240 AFYXXXXXXXXXXXXX---------XXXXPNNIPTNIHGFAMDWIGSIMAVIGLILLNFV 290
            FY                          P     +    ++D+IGS++ V G IL+   
Sbjct: 186 IFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIFVAGSILIVVG 245

Query: 291 WNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAK-------------------SPIL 331
             +G    W +                FF +   Y K                     ++
Sbjct: 246 LTEGG-ESWNRPVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQLLI 304

Query: 332 PVEVTKNRHIIMILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIWGTVA 391
           P++V   ++ I I+ A  L                      S L AG       I   + 
Sbjct: 305 PIDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIG 364

Query: 392 AVIVGAFIKRISASV---ILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDM 448
             +      ++   V   I FF  +A +I LI L +   D  ++++      ++ FG+ +
Sbjct: 365 NALCAFESTKLRPRVGVAIGFFLALAGSIILIQLHLVKED-LFWKIFFSAQALVGFGVAI 423

Query: 449 SFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINK 497
            +P A  I   G   + +G+A  +A T     + +   +  +V   IN+
Sbjct: 424 FYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVLGNINE 472

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 115 TWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIIS 174
           +W+  ++ L S +F  + G+I DI+G +  +I   LFFI+  LI G    S N    +  
Sbjct: 99  SWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGL---SKNLWTLVAG 155

Query: 175 RAFQGLG 181
           R   G+G
Sbjct: 156 RFIAGIG 162

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 39/193 (20%), Positives = 77/193 (39%), Gaps = 14/193 (7%)

Query: 48  PSSEQEDNTIGDHSKWQNPDYFQ-NKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDS 106
           PSS   +N        Q P Y +  K ++ +    C  + L +  + P     + II + 
Sbjct: 54  PSSANPNN----EKTCQEPPYSRFGKSEKSILAVLCASAGLFSTISAPIYYPALTIIEED 109

Query: 107 FKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSH 166
           F          +  + ++ G   ++ G + D  G +  ++     + + + I   +  ++
Sbjct: 110 FNISQEMVNITVVVYFILQGLAPMLMGGLADKVGRRPIVLCSIALYAV-ACIGLASAQNY 168

Query: 167 NDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFA 226
            ++ F+  R  Q  GI+ ++    GI+G+I     +R   +  M G        +GS F 
Sbjct: 169 GEVLFL--RCLQSAGISPVVAVNNGIIGDITT-KAERGGYLGLMAGTQV-----IGSAFG 220

Query: 227 GLIGTENPKQWPW 239
            LIG     +W W
Sbjct: 221 ALIGAGITARWGW 233

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 9/109 (8%)

Query: 131 ISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVM 190
           ISG + D+YG +  ++ G L ++  S I      S+  I F+  R  Q  GI+ I+    
Sbjct: 141 ISGGLADVYGRRPVILMGMLIYVCAS-IGLACSQSYGVIVFL--RCLQSAGISPIIAINS 197

Query: 191 GIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           G+VG+ +    +R   V ++ G +      MG  F  LIG      + W
Sbjct: 198 GVVGD-FTLKHERGTFVGAVSGFT-----LMGQAFGSLIGAALTAAFDW 240

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 11/110 (10%)

Query: 131 ISGRIGDIYGLKKTLIGGYLFFIIWSL-ISGFTDYSHNDIFFIISRAFQGLGIAFILPNV 189
           +SG + DIYG +  ++ G L +++ S+ I+    Y       I  R  Q  GI+ ++   
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASIGIAACNSYG----VIIFLRCLQSTGISPLIAIS 208

Query: 190 MGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
            G VG+ +    +R   V ++ G        MG  F  LIG      + W
Sbjct: 209 SGAVGD-FTVKAERGTFVGAVSGL-----VLMGQAFGSLIGAALAAAYNW 252

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 75/179 (41%), Gaps = 6/179 (3%)

Query: 272 MDWIGSIMAVI--GLILLNFVWNQGPIVGWQKAYXXXXXXXX-XXXXXXFFTYEIKYAKS 328
           +D+IG +M  +  G IL+ F    G    WQ A+               F  +EIK+++ 
Sbjct: 283 LDFIGLLMLCVTFGCILIPFTLAGGLQSEWQTAHIIVPEVIGWCLALPLFLLWEIKFSRH 342

Query: 329 PILPVEVTKNRHIIM-ILAALFLGWXXXXXXXXXXXXXLLNLRHYSALWAGTTYFMFAIW 387
           P+ P  + K+R II  I  A  + +             ++++ H S   A     +++  
Sbjct: 343 PLTPWALIKDRGIIFAIFIAFHINFCWYMQGDYMYTVLIVSV-HESVKSATRITSLYSFV 401

Query: 388 GTVAAVIVGAFIKRISASV-ILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFG 445
             +   I+G FI +I  +   + F ++ + I   +L     D       +G++ +L FG
Sbjct: 402 SVITGTILGMFITKIRRTKPFIVFGVVCWFIAFGLLVHYRGDNNSHSGIIGSLCLLGFG 460

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 115 TWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFT 162
           +W+  ++ L S +F  I G+I DI+G K  LI   + F + SLI G +
Sbjct: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 113 KETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFI 172
           K +W+  S+ L S +F  + G++ DI+G K  L+   + F+I  L+ G    S +  + +
Sbjct: 147 KVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGL---SKSFWWLV 203

Query: 173 ISRAFQGLG 181
           I+R   G+G
Sbjct: 204 IARFVAGVG 212

>ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} similar
           to YBR043C, uniprot|P38227 Saccharomyces cerevisiae
           YBR043C (QDR3)
          Length = 684

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 65/161 (40%), Gaps = 9/161 (5%)

Query: 79  IFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDI 138
           +F    S ++   AT      ++ I + +K+        +  + +  G F L    I ++
Sbjct: 126 VFVIAFSSMMGPMATSIVYPAIDPIKEDYKTTSIMVNVSVGVYQISLGVFPLWWSSISEM 185

Query: 139 YGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYK 198
            G +   +  +L  + +++ +G    S N   FII R   G   A +     G V ++Y 
Sbjct: 186 NGRRTVYVLSFLLLLAFNVGTGL---SPNINDFIILRVLSGGAAASVQSVGAGTVADLYV 242

Query: 199 PDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           P+ +  NI I        +G  M  L + +IG      +PW
Sbjct: 243 PEERGTNIGIYY------MGPLMAPLVSPIIGAALVSGFPW 277

>Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON}
           YBR043C (REAL)
          Length = 688

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 65/164 (39%), Gaps = 13/164 (7%)

Query: 76  YLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRI 135
           +L  FS MM  +     T      +N IT  FK+        I  + L  G F L    +
Sbjct: 111 FLIAFSSMMGPM----GTSIIFPAINAITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSM 166

Query: 136 GDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGN 195
            ++ G + T I  +     +++ S F    ++   FI  R   G   A +     G V +
Sbjct: 167 SELEGRRTTYITSFALLFAFNIGSAFAPDINS---FIALRMLCGAASASVQSVGAGTVAD 223

Query: 196 IYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           +Y  + + KN+    +G        +  L + +IG+    +WPW
Sbjct: 224 LYISEDRGKNLSYYYLGP------LLAPLLSPIIGSLLVNRWPW 261

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 51/127 (40%), Gaps = 7/127 (5%)

Query: 116 WLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISR 175
           WL+  + L +    L+ GR G + G K +++   + F + SLI+     + +    I  R
Sbjct: 114 WLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAA---AATSMTMLIGGR 170

Query: 176 AFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPK 235
              G+G + I      I   +    T  +   IS++  +  + +  G    G   T    
Sbjct: 171 VISGIGGSGIQTLCFVITSTLVTDRT--RGTAISILSCAFAVASVAGPFLGGAFATH--V 226

Query: 236 QWPWAFY 242
            W W FY
Sbjct: 227 TWRWCFY 233

>Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199C -
           Hypothetical ORF [contig 27] FULL
          Length = 723

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 5/84 (5%)

Query: 130 LISGRIGDIYGLKKTLIGGYLFFIIWSLI-SGFTDYSHNDIFFIISRAFQGLGIAFILPN 188
           L+ GR+G+ +G ++T+  G   FII  L  +  T  SH     II R   GLG+  +   
Sbjct: 171 LMVGRLGEKWGRRRTIRYGSFVFIIGGLFQTSATKLSH----LIIGRVISGLGVGLLSTI 226

Query: 189 VMGIVGNIYKPDTQRKNIVISMIG 212
           V      I  P  + K   I   G
Sbjct: 227 VPIYQSEISPPHNRGKLACIEFTG 250

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 99  IMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLI 158
           IMN + + F +   K+ W+  S+ L + +F  + GR+ DI G K T +    FF + S +
Sbjct: 89  IMNRVAEDFNASNQKQ-WIATSYLLTNTAFQPLYGRLSDIIGRKYTQLIVPFFFGMGSFL 147

Query: 159 SGFTD 163
           + F+ 
Sbjct: 148 TTFSK 152

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 44/216 (20%), Positives = 80/216 (37%), Gaps = 31/216 (14%)

Query: 39  NNEV---SEDELPSSEQEDNTIGDHSKWQNPDYFQ-------NKWQEYLFIFSCMMSQLL 88
           NN V   S D +  ++ E +    HS+  N   F        +  Q+ L +  C  +   
Sbjct: 24  NNNVDRSSSDAISDNDAERS--NSHSEIDNESNFDMVPYSRFSHKQKMLLVVQCAFTGFF 81

Query: 89  NQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGG 148
           +  A      ++ II   F          I  + +  G    I G + D +G +      
Sbjct: 82  STVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGVAPSIMGGLADTFGRRP----- 136

Query: 149 YLFFIIWSLISGFTDY-----SHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQR 203
               ++W++++ F        +HN    +  R  Q  GI+ ++    GI+G++     +R
Sbjct: 137 ---IVLWAILAYFCACIGLACAHNYAQILALRCLQAAGISPVIAINSGIMGDV-TTKVER 192

Query: 204 KNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
              V  + G        +G+ F  LIG     +W W
Sbjct: 193 GGYVGLVAGFQV-----VGTAFGALIGAGLSSKWGW 223

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 4/84 (4%)

Query: 98  SIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSL 157
           + MN I   F+ E  K TW+  ++ L + +   + G+  D+ G KK L+   + FI+  +
Sbjct: 70  TTMNEIASIFQ-EASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVFIVGLV 128

Query: 158 ISGFTDYSHNDIFFIISRAFQGLG 181
           + G           I++RA  G+G
Sbjct: 129 MCGAARTIEE---LIVARAICGVG 149

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 58/267 (21%), Positives = 100/267 (37%), Gaps = 25/267 (9%)

Query: 91  AATPQTL--SIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGG 148
           AA   TL  +IM  I   F +E  + +W+  ++ L S +F  + G++ DI+G K  L+  
Sbjct: 92  AAADGTLVSTIMAHIASEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLN 150

Query: 149 YLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQR---KN 205
            + F++  L+ G T         + +R   G+G   +       + +I  P   R   + 
Sbjct: 151 NIVFLVGCLMCGLTPSFWG---LVGARFISGIGGGGVTSMCSITISDIV-PLRDRALYQG 206

Query: 206 IVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYXXXXXXXXXXXXXXX---XXPN- 261
           +     G     G  +G  F     +++   W  AF                     P  
Sbjct: 207 MCNFFFGLGTACGGVVGGWF-----SDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRS 261

Query: 262 ---NIPTNIHG--FAMDWIGSIMAVIGLILLNFVWN-QGPIVGWQKAYXXXXXXXXXXXX 315
              N P +I     ++DWIG+   V+ L L     +  G  + +                
Sbjct: 262 KRVNSPASIKNKLLSVDWIGASALVVFLSLFLVTASLGGKEIAFNSKTFVALCIGSSLAC 321

Query: 316 XXFFTYEIKYAKSPILPVEVTKNRHII 342
             F   E+  AK PILP+   +NR ++
Sbjct: 322 AFFIGVELYGAKDPILPLSFLRNRSVL 348

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 3/79 (3%)

Query: 266 NIHGFAMDWIGSIM--AVIGLILLNFVWNQGPIVGWQKA-YXXXXXXXXXXXXXXFFTYE 322
           +I  + +D +G I+  A   LIL+     +G   GW  A +              F T+E
Sbjct: 261 DIFFWKLDMLGLILLVAFFALILVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWE 320

Query: 323 IKYAKSPILPVEVTKNRHI 341
           +K+A +PI P+++ K+R I
Sbjct: 321 LKFASNPITPLDLIKDRGI 339

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 115 TWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFT 162
           +W+  ++ L S +F  + G+I DI+G K  LI   + F +  LI G +
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 50/109 (45%), Gaps = 9/109 (8%)

Query: 131 ISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVM 190
            SG + D +G +  L+ G L +++ S I      S+  I F+  R  Q +GI+  +    
Sbjct: 154 CSGGLADKFGRRPVLLIGMLIYVVAS-IGLACAPSYGVIVFL--RCVQSIGISPSIAISS 210

Query: 191 GIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           G+VG+ +   ++R   V    GA++     +G  F  LIG      W W
Sbjct: 211 GVVGD-FTVKSERGTFV----GATSGF-VLLGQAFGSLIGAALAAAWDW 253

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 90/483 (18%), Positives = 175/483 (36%), Gaps = 70/483 (14%)

Query: 39  NNEVSEDELPS-SEQEDNTIGDHSKWQN----PDYFQNKWQEYLFIFSCMMSQLLNQAAT 93
            +E+ E E+ S S  E++ I   +   N     +Y+    +  LF FS  ++        
Sbjct: 17  KDEIHEQEIDSVSSTEESQINYDTGVINIEVYSEYYSTTQRRLLFFFSIFLTTYCYTLDK 76

Query: 94  PQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFI 153
               +     T S+K+     T +     ++S +  +   R  DI+G    +     F++
Sbjct: 77  RVRSTFQTEATSSYKNHSLMST-VTCITTVISAAGQIAYARAADIFGRTSLVFTAIFFYV 135

Query: 154 IWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGA 213
           I +++      + N   + +   F  LG A I+  +  +  +         N+   ++ +
Sbjct: 136 IGTVVES---QATNITRYAVGACFYSLGHAAIVLALEVLAADF-------SNLNYRILAS 185

Query: 214 SAP-IGAFMGSLFAGLIGTENPKQWPWAF----------------------YXXXXXXXX 250
           +AP +   + +  +G I ++    W W                        Y        
Sbjct: 186 AAPMLPNVINTWISGNITSDIGDHWQWGIGMWAIIFPVCCIPLLFCLFHMRYLAQYKHNR 245

Query: 251 XXXXXXXXXPNNIPT-----NIHGFAMDWIGSIMAVI--GLILLNFVWNQGPIVGWQKAY 303
                    P N+       ++  + +D +G ++ VI    +L+ F         W+ A 
Sbjct: 246 RELRSFSTIPPNMTRMEYFIDVFFWRLDILGLLLGVIFFACVLIPFTLAAKATDKWKSAS 305

Query: 304 XXXXXXXXXXXXXXFFTY-EIKYAKSPILPVEVTKNRHII-MILAALFLGWXXXXXXXXX 361
                          + + E K+AK P+ P  + K+R +   +L ALFL +         
Sbjct: 306 IIVPEVIGWLVALPLYIFWEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYVQSTYK 365

Query: 362 XXXXLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFI----KRISASVILFFSMIAFNI 417
               L++    + L A  T  MF   G + A ++G F+    +R    +    SM   + 
Sbjct: 366 YTVLLVSFDT-TVLAATRTNNMFTFVGVITANLLGIFVAKKLRRTKGFIFFGISMYIVST 424

Query: 418 GLIMLSVTPVDQTYFRM----NLGTMI---ILSFGMD-MSFPAAAIILSDGLTMQYQGMA 469
           GL+           +R+     +GT++   +L FG   + FPA A I +   T +   + 
Sbjct: 425 GLLY---------RYRIGAHAKVGTIVACCLLGFGNGFLKFPARASIQAAAYTHKNLAII 475

Query: 470 GSL 472
            SL
Sbjct: 476 TSL 478

>TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.245
           YBR043C
          Length = 640

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 63/163 (38%), Gaps = 9/163 (5%)

Query: 77  LFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIG 136
           L +     S L+   AT      +N IT+S  +        +  + L  G F L      
Sbjct: 90  LIVLIIAFSSLMGPMATSIVFPAINPITESLDTTTFMVNISVGVYSLSLGIFPLWWSSFS 149

Query: 137 DIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNI 196
           +++G +   +  ++    + + +     S N   FII R   G   A +     G V ++
Sbjct: 150 EMHGRRSVYVVSFIMLFGFCIGAAL---SPNISSFIILRVLCGAASASVQSVGAGTVSDL 206

Query: 197 YKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           Y P+ + +N+ I        +G  M  L A +I +    +W W
Sbjct: 207 YIPEDRGRNLGIYY------MGPLMAPLIAPIIASGLVTRWSW 243

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 41/202 (20%), Positives = 79/202 (39%), Gaps = 13/202 (6%)

Query: 39  NNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQ-NKWQEYLFIFSCMMSQLLNQAATPQTL 97
           + E S   + +S+ E   +G+ S ++   Y + +  Q+ L +  C  +   +  A     
Sbjct: 30  HGETSGLAVSNSQSE---VGNESDFELEPYSRFSHTQKMLLVVQCAFTGFFSTVAGSIYY 86

Query: 98  SIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSL 157
            ++ +I   F          I  + +  G    I G + D +G +  ++   L +    +
Sbjct: 87  PVLTVIEKKFNITEELANVTIVVYFVFQGLAPSIMGGLADTFGRRPVVLWAVLTYCCACI 146

Query: 158 ISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPI 217
             G    SHN    +  R  Q  GI+ ++    GI+G++     +R   V  + G     
Sbjct: 147 --GLAS-SHNYAQILALRCLQAAGISPVIAINSGIMGDV-TTKVERGGYVGLVSGFQV-- 200

Query: 218 GAFMGSLFAGLIGTENPKQWPW 239
              +G+ F  LIG     +W W
Sbjct: 201 ---VGTAFGALIGAGLSSRWGW 219

>Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON}
           YBR043C (REAL)
          Length = 683

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 64/164 (39%), Gaps = 13/164 (7%)

Query: 76  YLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRI 135
           +L  FS MM  +     T      +N IT  FK+        I  + L  G F L    +
Sbjct: 111 FLIAFSSMMGPM----GTSIIFPAINAITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSL 166

Query: 136 GDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGN 195
            ++ G + T I  +     +S+ S      ++   FI  R   G   A +     G V +
Sbjct: 167 SELEGRRTTYITSFAMLFAFSIGSALAPDINS---FIALRMLCGAASASVQSVGAGTVAD 223

Query: 196 IYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPW 239
           +Y  + + KN+    +G        +  L + +IG+    +WPW
Sbjct: 224 LYISEDRGKNLSYYYLGP------LLAPLLSPIIGSLLVNRWPW 261

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 3/87 (3%)

Query: 97  LSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWS 156
           +S+++ ++  +       +W + S+ +    FI   GR+GDI G  +        F I S
Sbjct: 49  ISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILS 108

Query: 157 LISGFTDYSHNDIFFIISRAFQGLGIA 183
           L+ G      N   F + RA QG+  A
Sbjct: 109 LLCGLMP---NFEAFAVMRALQGIAAA 132

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 4/84 (4%)

Query: 98  SIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSL 157
           + +N I   F+ +    TW+  ++ L + +   + G+I DI G +K L+ G + F +  L
Sbjct: 82  TTVNDIASQFQ-QASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFALGVL 140

Query: 158 ISGFTDYSHNDIFFIISRAFQGLG 181
           +  F +         I+RA  G+G
Sbjct: 141 LCNFANTIPQ---LAIARAICGIG 161

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 55/118 (46%), Gaps = 17/118 (14%)

Query: 126 GSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFI 185
           GSF L  GR+GDIYG +  LI   + FII ++I   +  +     ++I R   GLG   I
Sbjct: 134 GSFFL--GRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQ--YMIGRIIAGLGCGLI 189

Query: 186 LPNVMGIVGNIYKPDTQRKNIVISMIGASA---PIGAFMGSLFAGLIGTE---NPKQW 237
                 I+  +   +   KN+  +M+        +G F+G  +    GT+   N +QW
Sbjct: 190 -----AILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLG--YCTNYGTKKYHNSRQW 240

>SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} similar
           to uniprot|P25351 Saccharomyces cerevisiae YCR023C
           Hypothetical ORF
          Length = 657

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 55/125 (44%), Gaps = 5/125 (4%)

Query: 116 WLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISR 175
           +L ++F L      L  G+  D YG K  L  G       SLI GF+   +  +F   +R
Sbjct: 106 YLSSTFALCQVLSSLQWGKFSDKYGRKPALFIGLCGTCASSLILGFSQNFYQALF---AR 162

Query: 176 AFQGL--GIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTEN 233
           +  GL  G   +L  V+G V +  +      + +  +    + IG  +G  F+   G++N
Sbjct: 163 SLMGLLNGNVAVLRTVIGEVASERRHQALAFSTMPLLFQFGSVIGPMIGGFFSFPKGSDN 222

Query: 234 PKQWP 238
            K+ P
Sbjct: 223 NKEVP 227

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 2/73 (2%)

Query: 280 AVIGLILLNFVWNQGPIVGWQKAYXXXXXXXX-XXXXXXFFTYEIKYAKSPILPVEVTKN 338
           A+ G+IL+ F    G    W  A                F  +EIK+A+ P+ P +  KN
Sbjct: 282 AIFGMILIPFTLAGGEEKVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKN 341

Query: 339 RHIIMILA-ALFL 350
           R I+  L   LFL
Sbjct: 342 RGIVSALVLVLFL 354

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query: 272 MDWIGS-IMAV-IGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSP 329
           +D IG+ IM V +G IL+      G    W  +                  YE+K+A+ P
Sbjct: 310 LDTIGTFIMTVSLGCILVPLTLAGGTSSKWDDSQIIGPLVLGVVLLPMLIVYELKWAREP 369

Query: 330 ILPVEVTKNRHIIMILAALFL 350
           ILP ++ K+R +   ++  FL
Sbjct: 370 ILPWKLIKDRAVWASMSISFL 390

>NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {ON}
           Anc_5.284
          Length = 516

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 8/107 (7%)

Query: 135 IGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVG 194
           I ++YG + T I      IIW  +   T +SHN +  +  R   G   +  L    G + 
Sbjct: 134 ISELYGRRLTFIFSMTLSIIWQCL---TTWSHNVVGMMFGRFLSGFFGSAFLSIAGGSIS 190

Query: 195 NIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAF 241
           +I+  D     I +S+   S   G  +G + +G +  EN   + W F
Sbjct: 191 DIF--DKATITIPMSLYTLSCFYGPVLGPIVSGALYREN---YRWVF 232

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 272 MDWIGSIM--AVIGLILLNFVWNQGPIVGWQKAYXXXXXXXXXXXXXXFFTYEIKYAKSP 329
           +D IG ++  A +G IL+      G    W+ +               FF +E K+A  P
Sbjct: 282 IDIIGVLLMAASLGCILVPLTLAGGTSSKWRDSRIIGVFVLGFVLIPIFFIWEKKFATDP 341

Query: 330 ILPVEVTKNRHIIMILAALFL 350
           I+P ++ K+R +   L   FL
Sbjct: 342 IVPYKLVKDRGVWASLGISFL 362

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 15/131 (11%)

Query: 116 WLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISR 175
           WL+  + L +   +L+ GRI  + GLK +L+   + F   SL++         I   +  
Sbjct: 46  WLMTGYNLPNALCMLLWGRIASLVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIA 105

Query: 176 AFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPI----GAFMGSLFAGLIGT 231
            F G GI  ++  V          D + +  V++++G +  +    G F+G  FA  +  
Sbjct: 106 GFGGSGIETLVFAV-----GTRMVDEKHRARVVTILGIAYMLAEGAGPFIGGAFAEHV-- 158

Query: 232 ENPKQWPWAFY 242
                W W F+
Sbjct: 159 ----SWRWCFF 165

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 113 KETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTD 163
           K  W+  S+ L S  F  + G++ DI+G K  LI   L F    +I G ++
Sbjct: 433 KVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSN 483

>KLTH0E10406g Chr5 (938423..940624) [2202 bp, 733 aa] {ON} weakly
           similar to uniprot|Q12407 Saccharomyces cerevisiae
           YDL199C Hypothetical ORF
          Length = 733

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 3/83 (3%)

Query: 130 LISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNV 189
           L+ GR+G+ +G ++T+  G   FI+  LI      +   +  II R   GLG+  +   V
Sbjct: 180 LMVGRLGEKWGRRRTIRYGSFVFILGGLIQ---TSATRMLHLIIGRVISGLGVGLLSTIV 236

Query: 190 MGIVGNIYKPDTQRKNIVISMIG 212
                 I  P  + K   I   G
Sbjct: 237 PIYQSEISPPHNRGKLACIEFTG 259

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 98  SIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSL 157
           + MN +   F+ E    TW+  ++ L + S   + G+  D+ G KK L+   + FII  +
Sbjct: 73  TTMNEVASIFQ-EASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFAEVVFIIGLV 131

Query: 158 ISGFTDYSHNDIFFIISRAFQGLG 181
           + G            I+RA  G+G
Sbjct: 132 LCGMARTVKE---LAIARAICGIG 152

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,428,621
Number of extensions: 1740809
Number of successful extensions: 5901
Number of sequences better than 10.0: 188
Number of HSP's gapped: 5916
Number of HSP's successfully gapped: 193
Length of query: 549
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 434
Effective length of database: 40,294,809
Effective search space: 17487947106
Effective search space used: 17487947106
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)