Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E002708.844ON1198119857070.0
NCAS0B002808.844ON1081118221870.0
KAFR0A028508.844ON1042102216300.0
KNAG0G034408.844ON1053115315940.0
ZYRO0G14256g8.844ON125996614980.0
TPHA0I002708.844ON103949711121e-132
Kpol_1068.58.844ON103251211071e-132
CAGL0B02365g8.844ON105030810531e-124
Suva_13.268.844ON112229610401e-121
Smik_13.178.844ON113129610241e-119
YML117W (NAB6)8.844ON113434510181e-118
TDEL0B005408.844ON111531010111e-117
Skud_13.248.844ON112829510051e-116
Kwal_27.102398.844ON9143039731e-114
TBLA0B032808.844ON13622939651e-109
KLTH0C03784g8.844ON9973259351e-108
SAKL0D01364g8.844ON10823119311e-106
ABL122C8.844ON10432718951e-102
Ecym_46158.844ON10672728881e-101
KLLA0D01485g8.844ON11512428504e-95
Kwal_27.111586.183ON5672044653e-48
NCAS0H010406.183ON6292024612e-47
AFL061C6.183ON5232044519e-47
NDAI0F022606.183ON6802024562e-46
SAKL0A05280g6.183ON5822044512e-46
KAFR0B066906.183ON5332024492e-46
TBLA0B052106.183ON7102024563e-46
KLTH0H04906g6.183ON5692044485e-46
Ecym_22336.183ON5762074486e-46
KLLA0E19031g6.183ON6522044516e-46
Kpol_1002.696.183ON5902064406e-45
KNAG0M004306.183ON4432024317e-45
CAGL0C01419g6.183ON6392024392e-44
Suva_16.1236.183ON5962024344e-44
Smik_6.3906.183ON6252024331e-43
YPL184C (MRN1)6.183ON6122024302e-43
TPHA0J022106.183ON5932024264e-43
ZYRO0G08140g6.183ON6322024276e-43
Skud_16.946.183ON6142024267e-43
TDEL0G016206.183ON5842024203e-42
KAFR0H016208.466ON330741058e-04
KLTH0E10868g8.466ON34172960.010
Kwal_27.117308.466ON36974910.043
TPHA0L012008.466ON32293900.051
TPHA0F028206.104ON608102900.060
CAGL0H10604g2.306ON416101820.51
Suva_4.398.466ON34869810.57
TDEL0C059901.102ON33799810.62
KLLA0E07107g3.26ON45582800.81
NCAS0I009903.379ON30078790.85
KNAG0A024008.466ON30197791.00
Kpol_1031.638.466ON34476791.0
KLLA0E08779g2.306ON475158791.2
SAKL0H12012g8.466ON34474781.2
KAFR0G023206.104ON62076781.5
KAFR0A038308.670ON374221781.6
Kpol_543.175.486ON42853771.9
KAFR0A069402.368ON46794771.9
NCAS0C025608.466ON31730762.2
Skud_4.478.466ON34369762.3
Smik_4.318.466ON34130762.3
TBLA0D028108.466ON30675753.2
TPHA0B034208.229ON579183744.7
ZYRO0A02970g8.466ON32974735.0
ZYRO0F16214g1.102ON33096735.6
KLLA0C05522g6.104ON54084736.8
KLTH0F02992g1.109ON57446737.0
Smik_6.4406.261ON47167728.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E00270
         (1198 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844    2202   0.0  
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     847   0.0  
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   632   0.0  
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   618   0.0  
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   581   0.0  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   432   e-132
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   431   e-132
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   410   e-124
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   405   e-121
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   399   e-119
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   396   e-118
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   394   e-117
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   391   e-116
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   379   e-114
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   376   e-109
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   364   e-108
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   363   e-106
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   349   e-102
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   346   e-101
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   332   4e-95
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   183   3e-48
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   182   2e-47
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   178   9e-47
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    180   2e-46
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   178   2e-46
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   177   2e-46
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   180   3e-46
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   177   5e-46
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   177   6e-46
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   178   6e-46
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   174   6e-45
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   170   7e-45
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   173   2e-44
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   171   4e-44
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   171   1e-43
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   170   2e-43
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   168   4e-43
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   169   6e-43
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   168   7e-43
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   166   3e-42
KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON...    45   8e-04
KLTH0E10868g Chr5 (975831..976856) [1026 bp, 341 aa] {ON} simila...    42   0.010
Kwal_27.11730 s27 (922606..923715) [1110 bp, 369 aa] {ON} YDL209...    40   0.043
TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.4...    39   0.051
TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.1...    39   0.060
CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...    36   0.51 
Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON} Y...    36   0.57 
TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON} Anc_1...    36   0.62 
KLLA0E07107g Chr5 complement(647517..648884) [1368 bp, 455 aa] {...    35   0.81 
NCAS0I00990 Chr9 complement(178176..179043,179119..179153) [903 ...    35   0.85 
KNAG0A02400 Chr1 complement(236366..237271) [906 bp, 301 aa] {ON...    35   1.00 
Kpol_1031.63 s1031 (159123..160157) [1035 bp, 344 aa] {ON} (1591...    35   1.0  
KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...    35   1.2  
SAKL0H12012g Chr8 complement(1027110..1028144) [1035 bp, 344 aa]...    35   1.2  
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    35   1.5  
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    35   1.6  
Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON} (37962..3...    34   1.9  
KAFR0A06940 Chr1 complement(1399604..1401007) [1404 bp, 467 aa] ...    34   1.9  
NCAS0C02560 Chr3 complement(481562..482515) [954 bp, 317 aa] {ON...    34   2.2  
Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON} Y...    34   2.3  
Smik_4.31 Chr4 complement(64414..65439) [1026 bp, 341 aa] {ON} Y...    34   2.3  
TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON...    33   3.2  
TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {O...    33   4.7  
ZYRO0A02970g Chr1 complement(242160..243149) [990 bp, 329 aa] {O...    33   5.0  
ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON} conse...    33   5.6  
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    33   6.8  
KLTH0F02992g Chr6 complement(256926..258650) [1725 bp, 574 aa] {...    33   7.0  
Smik_6.440 Chr6 complement(719661..721076) [1416 bp, 471 aa] {ON...    32   8.3  

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score = 2202 bits (5707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1084/1198 (90%), Positives = 1084/1198 (90%)

Query: 1    MKSYQQQQQENPYPRYNKSFSRRGSSYYMNVQQDQRSRKPSYISLNHSVHNPNMVYQHDP 60
            MKSYQQQQQENPYPRYNKSFSRRGSSYYMNVQQDQRSRKPSYISLNHSVHNPNMVYQHDP
Sbjct: 1    MKSYQQQQQENPYPRYNKSFSRRGSSYYMNVQQDQRSRKPSYISLNHSVHNPNMVYQHDP 60

Query: 61   NGSQYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQ 120
            NGSQYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQ
Sbjct: 61   NGSQYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQ 120

Query: 121  SQMFLYSQSPAGTPNRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPNEL 180
            SQMFLYSQSPAGTPNRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPNEL
Sbjct: 121  SQMFLYSQSPAGTPNRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPNEL 180

Query: 181  FQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNTXXX 240
            FQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNT   
Sbjct: 181  FQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNTDDE 240

Query: 241  XXXXXXXXXXXRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKT 300
                       RSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKT
Sbjct: 241  KDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKT 300

Query: 301  DDGSTAXXXXXXXXXXXXXXXDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIELKTK 360
            DDGSTA               DVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIELKTK
Sbjct: 301  DDGSTANISNNQLNQIQENENDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIELKTK 360

Query: 361  CDKETLLNKHLSFLIDNKKNIRYILESIDLFXXXXXXXXXXXXXXXXAKNENENSPQGKE 420
            CDKETLLNKHLSFLIDNKKNIRYILESIDLF                AKNENENSPQGKE
Sbjct: 361  CDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNENENSPQGKE 420

Query: 421  KDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYVQIKHVX 480
            KDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYVQIKHV 
Sbjct: 421  KDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYVQIKHVK 480

Query: 481  XXXXXXXXXXXXXXXXDNKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSSPDTTYE 540
                            DNKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSSPDTTYE
Sbjct: 481  KSLNSSSKRSSVTSTTDNKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSSPDTTYE 540

Query: 541  GEXXXXXXXXXSKLQKLKLKETIQVLDIATYNTPLFQSHDSHMANITLSIVNPFEAQLMR 600
            GE         SKLQKLKLKETIQVLDIATYNTPLFQSHDSHMANITLSIVNPFEAQLMR
Sbjct: 541  GEDDIDIDIIISKLQKLKLKETIQVLDIATYNTPLFQSHDSHMANITLSIVNPFEAQLMR 600

Query: 601  PPPSNIVSPDQNHENLSYPILPPTLPSIEKFPTRDQTLNQEXXXXXXXXXXXXXXXNYQG 660
            PPPSNIVSPDQNHENLSYPILPPTLPSIEKFPTRDQTLNQE               NYQG
Sbjct: 601  PPPSNIVSPDQNHENLSYPILPPTLPSIEKFPTRDQTLNQETSGRRSLSSSSTSLSNYQG 660

Query: 661  RSNSNNYNTEAKEVKEQNKGERNEGIFFVEQPTFNTDPTMYPIVRTLEDKFNTSAQVASS 720
            RSNSNNYNTEAKEVKEQNKGERNEGIFFVEQPTFNTDPTMYPIVRTLEDKFNTSAQVASS
Sbjct: 661  RSNSNNYNTEAKEVKEQNKGERNEGIFFVEQPTFNTDPTMYPIVRTLEDKFNTSAQVASS 720

Query: 721  MGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYA 780
            MGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYA
Sbjct: 721  MGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYA 780

Query: 781  NSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEY 840
            NSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEY
Sbjct: 781  NSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEY 840

Query: 841  KEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKD 900
            KEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKD
Sbjct: 841  KEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKD 900

Query: 901  NTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQEKRRV 960
            NTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQEKRRV
Sbjct: 901  NTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQEKRRV 960

Query: 961  EQEKGKELNGGVNDNKLPSLDALGIGLQRTAPPEEQKVPESNEDDANYDSAVTESDTNTF 1020
            EQEKGKELNGGVNDNKLPSLDALGIGLQRTAPPEEQKVPESNEDDANYDSAVTESDTNTF
Sbjct: 961  EQEKGKELNGGVNDNKLPSLDALGIGLQRTAPPEEQKVPESNEDDANYDSAVTESDTNTF 1020

Query: 1021 NALGFRIQSNTDSHXXXXXXXXXXXXXXXXXIAHADDISSVNSSDVEIIIDCPHNESDTS 1080
            NALGFRIQSNTDSH                 IAHADDISSVNSSDVEIIIDCPHNESDTS
Sbjct: 1021 NALGFRIQSNTDSHDDEQNDEKGEEQEEVDVIAHADDISSVNSSDVEIIIDCPHNESDTS 1080

Query: 1081 MIQEKKKTIRKNQQKIDRLAKARNAMFPEHRETIPDINNKLFHXXXXXXXXXXXQVQGGI 1140
            MIQEKKKTIRKNQQKIDRLAKARNAMFPEHRETIPDINNKLFH           QVQGGI
Sbjct: 1081 MIQEKKKTIRKNQQKIDRLAKARNAMFPEHRETIPDINNKLFHDRKNKDKNRRKQVQGGI 1140

Query: 1141 QDQDPHLSSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEEDTT 1198
            QDQDPHLSSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEEDTT
Sbjct: 1141 QDQDPHLSSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEEDTT 1198

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1182 (43%), Positives = 681/1182 (57%), Gaps = 152/1182 (12%)

Query: 35   QRSRKPSYISLNHSVHNPNMVYQHDPNGSQYFATTQQAYYIPSPLPNAPPTPFDTAYGAT 94
            QR RKPSY  L     N  + YQ +   SQYF T QQ YY  SPLPN PPTPFDTAYGAT
Sbjct: 33   QRQRKPSYGPLGPGT-NSMLFYQGEQARSQYFPT-QQPYYQTSPLPNVPPTPFDTAYGAT 90

Query: 95   LLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQSPAGTPNRKSFSQLNSMLN---QPSS 151
            LLPSHLLMGSP+V+TP      +   SQ  ++ Q    TPNR SFSQ+ SMLN    PS+
Sbjct: 91   LLPSHLLMGSPFVATP------TTGHSQSAIFQQPYMMTPNRASFSQIPSMLNVGNPPSA 144

Query: 152  RSNFFTDSYNNRYQNNPQTRIPEVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVAS 211
            R     +  N R +++ ++++PE DP  LF +PF +SYK+LP+GDDAYRTRSLLF NV +
Sbjct: 145  RRQGNQNDPNRR-RSSYRSKVPETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVN 203

Query: 212  SIDLHSFIYDFVQYSSIESIYLISNTXXXXXXXXXXXXXXRSILLSFLSREICLSFYNNV 271
            SI+LH+F+ +FV++S IES+YLI++               RSILLSFL+RE+CL+FYNNV
Sbjct: 204  SIELHTFMTEFVRFSPIESVYLINH---HDSDKPDDDTECRSILLSFLTREVCLTFYNNV 260

Query: 272  LQRLNEFKTNLQSKSLTLNFVILNYLEKTDDGSTAXXXXXXXXXXXXXXXDVNTNEFDYR 331
            LQRL EFK  L+S++L L+FV + Y ++ ++  T                    N  D  
Sbjct: 261  LQRLKEFKAKLKSENLRLSFVSIKYQDENEEEET--------------------NIVD-E 299

Query: 332  NSMNTVNALKFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLF 391
             S  T  ++ F+L NP ATR I+I+ K  C ++ L +K L FL + + N RYILESIDL 
Sbjct: 300  PSFYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFL-NQENNSRYILESIDLV 358

Query: 392  XXXXXXXXXXXXXXXXAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYM 451
                             + ENE                       FP HYA+L+FINI M
Sbjct: 359  NV--------------TQTENE-----------------------FPKHYAILTFINILM 381

Query: 452  AMELRDYLKLNGLKHGITNASYVQIKHVXXXXXXXXXXXXXXXXXDNKDKSEVDTNESVE 511
            AME+ DYLK++G ++GI +  +VQ+                    DN D       E++ 
Sbjct: 382  AMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRASIISKDNDNND-------ETLS 434

Query: 512  GKDKKSEEAKSFNNKLSSITMSSPDTTYEGEXXXXXXXXXSKLQKLKLKETIQVLDIATY 571
             + KK++  K  N+ + S+  +  D   + E          KL+   ++E I ++D ATY
Sbjct: 435  SQQKKNDILK--NSSIISLPSAENDQVSDEEKLDKLS---EKLKSTNIEELILIVDTATY 489

Query: 572  NTPLFQSHDSHMANITLSIV---NPFEAQLMRPPPSNIVSPDQNHENLSYPILP--PTLP 626
              P F SHD H+ N TLS+    NPFE QL    P +    D    N+    LP  P  P
Sbjct: 490  PRPSFLSHDEHLPNATLSLSSSSNPFEQQL----PYSYEEDDDQRTNVRSGSLPANPQFP 545

Query: 627  SIEKFPTRDQTLNQEXXXXXXXXXXXXXXXNYQGRSNSNNYNTEAKEVKEQNKGERNEGI 686
            ++   P                         Y   + + NYNT    +   N    N+  
Sbjct: 546  NMPNLP-----------------------KGYISPNPNMNYNTP---LMYPNGYFVNDPA 579

Query: 687  FFVEQPTFNTDPTMYPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCN 746
            F +     N      PI +TLE    T++QV +S+G + GNRTIYIGN+N RSK ED+CN
Sbjct: 580  FSMNNNYNNNTNYRNPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICN 639

Query: 747  VVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLS 806
            VVRGGILQ++K I  K ICF+TFIEASAA+ FYANSFIDP++LH +TLKIGWGNY EPL 
Sbjct: 640  VVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLP 699

Query: 807  KSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIE 866
            K++ALAVT+GASRNVYVSLPEFAFKDKF+NDPEY+E+H+KYKLP   QLR DF+KYG IE
Sbjct: 700  KAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIE 759

Query: 867  QINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNV 926
            QINYL DSHCCWVNF+NI++AI+LVED  +NP ++ FS+KFN+RYDGLIINYGKDRCGNV
Sbjct: 760  QINYLKDSHCCWVNFLNISAAIRLVEDA-HNPVESKFSEKFNNRYDGLIINYGKDRCGNV 818

Query: 927  NRNLISNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKEL-NGGVNDNKLPSLDALGI 985
            N++L+SNKNSR Y+KVK  S+N KL++L+EKR+ + E+   L     +D +L  LDA GI
Sbjct: 819  NKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGI 878

Query: 986  GLQRTAPPEEQKVPESNEDDANYDSAVT----ESDTNTFNALGFRIQSNTDSHXXXXXXX 1041
            G+   +         +NE+D N +   T    ++D N FNALGF+I+   D         
Sbjct: 879  GIDTVS---------NNEEDGNIEKGNTLSKIDTDVNGFNALGFKIEPKHDMMNETMDNN 929

Query: 1042 XXXXXXXXXXIAHADDISSVNSSDVEIIIDCPHNESDTSMIQEKKKTIRKNQQKIDRLAK 1101
                          ++ISS  SS++E++I  P        +   +K    N     R + 
Sbjct: 930  TEGNNT-------LENISSDESSNIELMISSPKESVQKGDVITNQKPHSNNHHNFKRNSS 982

Query: 1102 ARNAMFPE------HRETIPDINNKLFHXXXXXXXXXXXQVQGGIQDQDPHLSSTGKQQR 1155
            +    + E      HR    + +N  F             V    ++   H ++  K+ R
Sbjct: 983  SNRQRYKETDTQNTHRNN--NNSNATFAPNKEFGFGISPNVDEHQKNNKKH-NTNDKEAR 1039

Query: 1156 VIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEEDT 1197
            VIPG+DVMAQYL QLQHSTFMYAANILG SAED +YYDE + 
Sbjct: 1040 VIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDESNA 1081

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1022 (40%), Positives = 555/1022 (54%), Gaps = 190/1022 (18%)

Query: 19  SFSRRGSSYYMNVQQDQRSRKPSYISLNHSVHNPNMVYQHDPNGSQYFATT--------- 69
           S+SR+ S ++  + Q Q+  +  Y S      NP M Y   P   Q +  T         
Sbjct: 5   SYSRKNSGFH--IYQSQQPAQDQYYSA-FDTTNPLMSY---PQFEQPYGATFPPPLSSST 58

Query: 70  --QQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYS 127
             QQ YY  SPLPNAPPTPFDTAYGATLLPSHLLMGSP++S+PN   P  Q   Q    +
Sbjct: 59  HFQQTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTPQQQYFLQQQFNT 118

Query: 128 QSPAG--TPNRKSFSQLNSMLNQP-SSRSNFFTDSYNN-------RYQNNPQTRIPEVDP 177
            +  G  TP RKSF +++   N+P SSRS+ F++   +          +N      E+  
Sbjct: 119 NNNNGSSTP-RKSFFKVS---NRPISSRSSRFSEKRKSFIINNPTTNNSNNNNNNKEI-L 173

Query: 178 NELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNT 237
            +LF +P  ISY +LP GDDAYRTRSLLF NV ++I+LHSFI +FV+ +SIESIYL+ N 
Sbjct: 174 EKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNK 233

Query: 238 XXXXXXXXXXXXXXRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYL 297
                           I+LSFLSR ICL FYNNVLQRL EFK +L S+SL LNFV L Y 
Sbjct: 234 NDSNTC---------DIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYN 284

Query: 298 EKTDDGSTAXXXXXXXXXXXXXXXDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIEL 357
           + T D                                N   +L+F+++  DATR + IEL
Sbjct: 285 KTTRD--------------------------------NQGPSLEFNIVTRDATRSLAIEL 312

Query: 358 KTK------CDKETLLNKHLSFLIDNKKNIRYILESIDLFXXXXXXXXXXXXXXXXAKNE 411
            +        +KE L  K L+ ++   +N RY+LESIDL                     
Sbjct: 313 CSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVST------------------ 354

Query: 412 NENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNA 471
                              ++S + F  +YA+LSF+NI MA+E+ DY+++   K  I   
Sbjct: 355 -------------------DKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKC 395

Query: 472 SYVQIKHVXXXXXXXXXXXXXXXXXDNKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSIT 531
           S+V I+ +                      + + ++ S EG + ++    +F +K  +  
Sbjct: 396 SFVTIQPLIENNVMNNSSALSS-------ATNIQSSVSSEGNNNQNNNGSTFFHK--NSI 446

Query: 532 MSSPDTTYEGEXXXXXXXXXSKLQKLKLKETIQVLDIA--TYNTPLFQSHDSHMANITLS 589
            S   +               KL+ +KLK+    LDI    Y  P F     H+ N+T+S
Sbjct: 447 NSLLSSESSVSIDEEVISIADKLKGIKLKDI--SLDILPRDYPEPEFNFSTDHLPNVTIS 504

Query: 590 IVNPFEAQLMRPPPSNIVSPDQNHENLSYPILPPTLPSIEKFPTRDQTLNQEXXXXXXXX 649
           +    +     P    I   D          + P+   I+   +    L+          
Sbjct: 505 VPTQLDQIPGTPRTQEIYIND----------MSPSFEGIDMMNSSSTMLSGNGTFISNTP 554

Query: 650 XXXXXXXNYQGRSNSNNYNTEAKEVKEQNKGERNEGIFFVEQPTFNTDPTMYPIVRTLED 709
                   Y  +      NT+ +E                    F ++  ++PI  +LE+
Sbjct: 555 MLIPSQSFYMDQ------NTQIQEAP------------------FRSNSFIHPITDSLEN 590

Query: 710 KFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTF 769
           + +TSA+VAS+MG + GNRTIYIGN+NPRSKAED+CNVVRGGILQSIK I SK ICFVTF
Sbjct: 591 QLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTF 650

Query: 770 IEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFA 829
           IEA+AAVQFYAN+FIDP++LHGNTLK+GWGNY  PL KSIALAVTIGASRNVYVSLPEFA
Sbjct: 651 IEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFA 710

Query: 830 FKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIK 889
           FKDK++NDPE+KE+HEK+KLP  +QLR DF+ YGP EQINYLSDSHCCWVNFMNI+SAIK
Sbjct: 711 FKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIK 770

Query: 890 LVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNY 949
           LVE+  N+   + F++KF+ RY+GL+INYGKDRCGN+N+NLI+ KNSR Y K+++ + N+
Sbjct: 771 LVEEATND--FDRFNEKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFY-KIRQ-NHNF 826

Query: 950 KLRQLQEKRR-----------------------VEQEKGKELNGGVNDNKLPSLDALGIG 986
           KL +L+EKRR                       +E +         ND K   LD+LGI 
Sbjct: 827 KLSKLEEKRRDHDRRENGFKHVYNDEETIYNESMETDNQHNEESKENDGKFLQLDSLGIS 886

Query: 987 LQ 988
           L+
Sbjct: 887 LE 888

 Score =  447 bits (1149), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 247/517 (47%), Positives = 323/517 (62%), Gaps = 60/517 (11%)

Query: 689  VEQPTFNTDPTMYPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVV 748
            +++  F ++  ++PI  +LE++ +TSA+VAS+MG + GNRTIYIGN+NPRSKAED+CNVV
Sbjct: 570  IQEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVV 629

Query: 749  RGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKS 808
            RGGILQSIK I SK ICFVTFIEA+AAVQFYAN+FIDP++LHGNTLK+GWGNY  PL KS
Sbjct: 630  RGGILQSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKS 689

Query: 809  IALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQI 868
            IALAVTIGASRNVYVSLPEFAFKDK++NDPE+KE+HEK+KLP  +QLR DF+ YGP EQI
Sbjct: 690  IALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQI 749

Query: 869  NYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNR 928
            NYLSDSHCCWVNFMNI+SAIKLVE+  N+   + F++KF+ RY+GL+INYGKDRCGN+N+
Sbjct: 750  NYLSDSHCCWVNFMNISSAIKLVEEATND--FDRFNEKFDERYNGLVINYGKDRCGNINK 807

Query: 929  NLISNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGLQ 988
            NLI+ KNSR Y K+++ + N+KL +L+EKRR    +        ND              
Sbjct: 808  NLIAGKNSRFY-KIRQ-NHNFKLSKLEEKRRDHDRRENGFKHVYND-------------- 851

Query: 989  RTAPPEEQKVPESNEDDANYDSAVTESDTN--TFNALGFRIQSNTDSHXXXXXXXXXXXX 1046
                 EE    ES E D  ++    E+D      ++LG  ++S  +              
Sbjct: 852  -----EETIYNESMETDNQHNEESKENDGKFLQLDSLGISLESKNEIADDINDALTVDQF 906

Query: 1047 XXXXXIAHADDIS-----SVNSSDVEIIIDCPHN--ESDTSMIQEKKKTIRKNQQKIDRL 1099
                 I   +        S +SSD+E+II+ P++    D  ++  +K     N       
Sbjct: 907  ENEKSITKNNGFENTSFHSDSSSDIELIINSPNSLRTKDNDVLDSEKIINSANTTNRTGN 966

Query: 1100 AKARNAMFPEHRETIPDINNKLFHXXXXXXXXXXXQVQGGIQDQDPHLSSTGKQQRVIPG 1159
            A      + ++R      N+ + +            + G                     
Sbjct: 967  ANGYKNDYTKNR------NDGMRNNRSRNRSRYSRTIPG--------------------- 999

Query: 1160 ADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEED 1196
            +DVMAQYL QLQHSTFMYAANILG S E+  YYDE +
Sbjct: 1000 SDVMAQYLAQLQHSTFMYAANILGASGEEE-YYDEAE 1035

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1153 (37%), Positives = 579/1153 (50%), Gaps = 217/1153 (18%)

Query: 77   SPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQSPAGTPNR 136
            SP+ N  PTPFDTAYGATLLPSHLLMGSP+VSTPN  +P +   +Q             R
Sbjct: 84   SPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPN--LPQTNYTAQ-------------R 128

Query: 137  KSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPNELFQKPFVISYKLLPTGD 196
            K       M N   S          N Y+ +PQ        N LFQ PF ISYK+LP GD
Sbjct: 129  KG--SHTGMANGTGSM---------NYYRTDPQII------NGLFQIPFEISYKILPKGD 171

Query: 197  DAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNTXXXXXXXXXXXXXXRSILL 256
            D YRTRSLL  N+   +DLH+F+  FVQ +S+ES+Y+                     LL
Sbjct: 172  DLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITKEGQQPEKY---------GFLL 222

Query: 257  SFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKTDDGSTAXXXXXXXXXX 316
            SFLS +ICL+FYNNVLQRL EFK  L++ SL L+FV +       +G             
Sbjct: 223  SFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKI----------- 271

Query: 317  XXXXXDVNTNEFDYRNSMNTVNALKFDLI-NPDATRFIMIELKTK---CDKETLLNKHLS 372
                       F   +     N L FD+     ATR I IE   K     ++ LLNK L 
Sbjct: 272  --------YRRFAADDGDGMAN-LHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLK 322

Query: 373  FLIDNKKNIRYILESIDLFXXXXXXXXXXXXXXXXAKNENENSPQGKEKDTMVQKRKRNR 432
            FL  ++ N RYILE I +F                                     K   
Sbjct: 323  FL--SEGNNRYILEHIAVF-------------------------------------KTQH 343

Query: 433  SKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYVQIKHVXXXXXXXXXXXXX 492
              + F  +YA+++F++I MAME+ DYLKLN  +  +T   YVQ+ H              
Sbjct: 344  GTKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPH 403

Query: 493  XXXXDNKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSSPDTTYEGEXXXXXXXXXS 552
                 N  +S  DT+     KD++      F N      +SS  +T   +         +
Sbjct: 404  A----NDTESNRDTSPPNSKKDQEF-----FPNNSMLSLVSSESSTSLADDVDGLV---N 451

Query: 553  KLQKLKLKETIQVLDIATYNTPLFQSHDSHMANITLSIVNPFEAQLMRP----------- 601
            KL+ ++L+E+   L +  Y  PLF+    H   I  S+  P    +  P           
Sbjct: 452  KLKSIELQESTLKLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFG 511

Query: 602  --------PPSNIVSPDQNHENLSYPILPPTLPSIEKFPTRDQTLNQEXXXXXXXXXXXX 653
                    PP++ +  D NH N S P LPP    I   P+   +  Q+            
Sbjct: 512  AFPNDIGSPPASFLPLDLNHSN-SVPNLPPGF--IPATPSGPMSPQQQQLF--------- 559

Query: 654  XXXNYQGRSNSNNYNTEAKEVKEQNKGERNEGIFFVEQPTFNTDPTMYPIVRTLEDKFNT 713
                                +  Q +   + G  F            +PI  +LE +  T
Sbjct: 560  --------------------LNSQRQQRDHAGGKFA-----------HPITDSLESQMKT 588

Query: 714  SAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEAS 773
            S QVA++MG +  NRTIYIGN+NPRS+AED+CNVVRGGILQ+IK I +K ICF+TFIEAS
Sbjct: 589  STQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKHICFITFIEAS 648

Query: 774  AAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDK 833
            AAVQFYAN+FIDP++LHGNTLK+GWG Y  PL K IALAVTIGASRNVY+SLPE AFKDK
Sbjct: 649  AAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYISLPEIAFKDK 708

Query: 834  FLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVED 893
            ++ DP++K +HE +KLP+++ LR DF  YG IEQIN L+DSHCCWVNFMNI+SAI+LVED
Sbjct: 709  YIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMNISSAIRLVED 768

Query: 894  VNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQ 953
             +   K + F++ F+HRY+GL+INYGKDRCGN+NRNL++ K S++++KVKK + + +L Q
Sbjct: 769  AST--KQDHFNQLFDHRYEGLVINYGKDRCGNINRNLVAGKTSKYHKKVKKHTRDVRLSQ 826

Query: 954  LQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGLQRTAPPEEQKVPESNEDDA---NYDS 1010
            L+EKRR +  + +E+  G                          +PE N  DA   N  S
Sbjct: 827  LEEKRRNQDAERREMVNGT-------------------------IPEENPFDAFAINTGS 861

Query: 1011 AVTESDTNTFNALGFRIQ----SNTDSHXXXXXXXXXXXXXXXXXIAHADDI-SSVNSSD 1065
            A  + D  + ++LG  I     ++  S                  IA  +   +S +SSD
Sbjct: 862  A-EKKDELSLDSLGISIMEVESASPISPVMGDLEDHTNGSYTDAGIAPLNYTNNSGSSSD 920

Query: 1066 VEIIIDCPHNESDTSMIQEKKKTIR---KNQQKIDRLAKARNAMFPEHRETIPDINNKLF 1122
            +E+II+ P++ + +  + E   +      +++K+  L +  +   P   +TI     +  
Sbjct: 921  IELIINPPNDPNRSVGVLEGDPSTLSPPSDKRKLVALHEVSSPPPPLAPDTISRQYAEAS 980

Query: 1123 HXXXXXXXXXXXQVQGGIQDQDPHLSSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANIL 1182
            +               G  +   H     +  R IPG+DVMAQYL QLQHSTFMYAAN+L
Sbjct: 981  YHNELVTGNDHPDTGYGKAENGRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVL 1040

Query: 1183 GVSAEDNTYYDEE 1195
            G S E    YD++
Sbjct: 1041 GASNEGTEQYDDQ 1053

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/966 (37%), Positives = 514/966 (53%), Gaps = 145/966 (15%)

Query: 66  FATTQQAYYIPSPLPNAPPTP--FDTAYGATLLPSHLLMGSPYVSTPN------------ 111
           +A  Q AYY  +  P   P P  FDTAYG TLLPSHLL+GSP+VS+P+            
Sbjct: 64  YAPPQPAYYAAAGPPLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDLFQSQQQSQHHH 123

Query: 112 ---------GIVPSSQQQSQMFLYSQSPAGTPNRKSF---------SQLNSMLNQPSSRS 153
                    G+V S+     +    +  A   N+ S+         +  +S L++ S   
Sbjct: 124 HHQNHQHQIGMVNSNASHQSLNQRHRRSANQRNKGSYNNNSDTNISTNGHSRLSEASYPV 183

Query: 154 NFFTDSYNNRYQNNPQTRIPEVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSI 213
                +     +N  + R      +++F++PFV++Y++LP GDD YRTRSLLF NV  S+
Sbjct: 184 PPPLKNPPVVARNRHRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSV 243

Query: 214 DLHSFIYDFVQYSSIESIYLISNTXXXXXXXXXXXXXXRSILLSFLSREICLSFYNNVLQ 273
           DL+SF+  + +Y  +ESIY+  +                S+LLSFLSR+ICL  YN+VLQ
Sbjct: 244 DLYSFVSKYSRYGPVESIYMFKD---------RNDKTKHSVLLSFLSRKICLDSYNSVLQ 294

Query: 274 RLNEFKTNLQSKSLTLNFVILNYLEKTD-------DGSTAXXXXXXXXXXXXXXXDVNTN 326
           RL EFKT L+SKSLT++FV L Y +  D       D S++                  +N
Sbjct: 295 RLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSN 354

Query: 327 EFDYRNSMNTVNALKFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILE 386
             D   ++  V +L++D++N  ATR + +EL  + DK  LL++ L FL     N RY+LE
Sbjct: 355 VQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYDKTKLLDQELDFL-SPANNQRYVLE 413

Query: 387 SIDLFXXXXXXXXXXXXXXXXAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSF 446
           SI L                     N   P                  + FP +YA+L+F
Sbjct: 414 SIYLI--------------------NAKEP-----------------FKHFPKNYAILTF 436

Query: 447 INIYMAMELRDYLKLN-GLKHGITNASYVQIKHVXXXXXXXXXXXXXXXXX--DNKDKSE 503
           +NI MA+E+ DY++ N   +       +V +                       +   + 
Sbjct: 437 LNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSAG 496

Query: 504 VDTNESVEGKDKKSEEAKSFNNKLSSITMSSPDTTYEGEXXXXXXXXXSKLQKLKLKETI 563
           + TN  + G   K+    S N+  S I++                        LK   TI
Sbjct: 497 IATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLS--------------SSLKGSHTI 542

Query: 564 QVLDIATYNTPLFQSHDSHMANITLSIVNPFEAQLMRPPPSNIVSPDQNHENLSYPILPP 623
            V  +  Y  P F     H++N ++   +  + Q+  P P  ++ P Q+      P++  
Sbjct: 543 TVA-VDEYPKPFFAEFSDHLSNASVLEASALDTQISSPHPQEVIVPSQDS-----PLVGG 596

Query: 624 TLPSIEKFPTRDQTLNQEXXXXXXXXXXXXXXXNYQGRSNSNNYNTEAKEVKEQNKGERN 683
             P     P     L+ +                                +  Q     N
Sbjct: 597 APPLDAVHPAATPALSSQV-------------------------------LPLQPHMAMN 625

Query: 684 EGIFFVEQPTFNTDPTMY-PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAE 742
            GI+   +P    + TM  PI ++L+ +F TSA+VA+SMG  +GNRT+YIGN++PRSK E
Sbjct: 626 SGIYM--EPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPE 683

Query: 743 DVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYY 802
           D+CNVVRGGILQSI+ +  K ICFVTFIEAS AVQFY N+FIDP++LHGN LK+GWG++ 
Sbjct: 684 DICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHS 743

Query: 803 EPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKY 862
            PL KS++LAVT+GASRNVYVSLP+FAFKDK++NDP+Y+ + ++YKLP+E+QLR DFN++
Sbjct: 744 GPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQF 803

Query: 863 GPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDR 922
           G IEQIN+LSD HCCWVNFMNI+SAIKLVE++  N  +  F K F++RY GLII YGKDR
Sbjct: 804 GDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGE-AFHKSFDNRYRGLIIGYGKDR 862

Query: 923 CGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDA 982
           CGNVN+NLIS KNSR Y+KVKK S N +L +++E+R+  +E  +  N   ND K+    +
Sbjct: 863 CGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQN-NDEKMLQFGS 921

Query: 983 LGIGLQ 988
           LGI L+
Sbjct: 922 LGIHLE 927

 Score = 68.6 bits (166), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 37/46 (80%)

Query: 1152 KQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEEDT 1197
            +  + IPG+DVMAQYL QLQHSTFMYAANILG +AE +  Y E++T
Sbjct: 1212 RNAKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDNT 1257

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  432 bits (1112), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 240/497 (48%), Positives = 314/497 (63%), Gaps = 59/497 (11%)

Query: 702  PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761
            P+ +TL+ +F TSA++AS MG  +GNRTI+IGN+NPRSK ED+CNV RGGI+Q +K I  
Sbjct: 594  PLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIRE 653

Query: 762  KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821
            K ICFV FI+  AA QFYANSFIDP+ILH NTLKIGWG++  PL K+I LAVT GASRNV
Sbjct: 654  KNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNV 713

Query: 822  YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881
            YVSLPEFAFKDK++NDP YKE+H KY LPSEQQLR DF+K+G +EQIN+L D HCCW+NF
Sbjct: 714  YVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINF 773

Query: 882  MNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRK 941
             NI SAIKLVE V N   +N F +++ +RY GLII YGKDRCGNVN++L+SNKNSR++RK
Sbjct: 774  TNIRSAIKLVELVKNE-DNNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRK 832

Query: 942  VKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGLQRTAPPEEQKVPES 1001
            VKK S N +L+QL+E+R+   E  K++     DNK  +LD+LGI    T+P   Q + E 
Sbjct: 833  VKKPSYNIRLQQLEEERKRNDEI-KQI-----DNKRINLDSLGIT---TSP--NQNIQE- 880

Query: 1002 NEDDANYDSAVTESDTNTFNALGFRIQSNTDSHXXXXXXXXXXXXXXXXXIAHADDISSV 1061
                   D  ++ +     +  GF+   N                      +  DD +S 
Sbjct: 881  -------DETLSLAKLKLTSDTGFKNSENE---------------------SDIDDSASN 912

Query: 1062 NSSDVEIIIDCPHNESDTSMIQEKKKTIRKNQQKIDRLAKARNAMFPEHRETIPDINNKL 1121
            +S+DVE+II+ P N         + +  + N   +    K    +F       P   NKL
Sbjct: 913  SSTDVELIINSPGN----GFKSHRNRKPKPNNLDLGERPKVDAIVFKADGPMAP---NKL 965

Query: 1122 FHXXXXXXXXXXXQVQGGIQDQDPHLSSTGKQ--QRVIPGADVMAQYLTQLQHSTFMYAA 1179
             H                 +  +P    T K+  +++IPG+DVM+QYL Q+QHSTFMYAA
Sbjct: 966  SHDYHRTH---------NTRVDNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAA 1016

Query: 1180 NILGVSAEDNTYYDEED 1196
            N+L  S E+  +YDE D
Sbjct: 1017 NVLNASIEEPEFYDEND 1033

 Score =  183 bits (464), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 156/521 (29%), Positives = 237/521 (45%), Gaps = 114/521 (21%)

Query: 87  FDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQSPAGTPNRKSFSQLNSML 146
           FD AYG TLLPSH+LM SP+VSTPN    S       F  S S   + NR++ +Q+    
Sbjct: 112 FDYAYGTTLLPSHILMNSPFVSTPNKSYLS-------FQASPSRGISYNRRNSNQM-VFP 163

Query: 147 NQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPN----ELFQK----PFVISYKLLPTGDDA 198
           N P   S       + R +++   ++  +D      E+F++     + ISY++LP GDD 
Sbjct: 164 NPPIITSPHLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDT 223

Query: 199 YRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNTXXXXXXXXXXXXXXRSILLSF 258
           Y TRSLLF N+  SIDLH+FI  FV Y  IES+Y++ +               +SILLSF
Sbjct: 224 YHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPS-------YETHQNSVKSILLSF 276

Query: 259 LSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKTDDGSTAXXXXXXXXXXXX 318
            SR ICL FYN+VLQ+L+E+KT L S++L L+FV L YL+   +                
Sbjct: 277 TSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNG-----------K 325

Query: 319 XXXDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIELKTKCDK-ETLLNKHLSFLIDN 377
              +   NE D+       + +++ + N  ATR + IE   + DK +  +  +L FL  N
Sbjct: 326 ISVESQKNETDFE----LTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLSSN 381

Query: 378 KKNIRYILESIDLFXXXXXXXXXXXXXXXXAKNENENSPQGKEKDTMVQKRKRNRSKRTF 437
             N RYI+ES+ +                   N N     GK+ +              F
Sbjct: 382 -ANKRYIIESLYIV------------------NNN-----GKDNE--------------F 403

Query: 438 PNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYVQIKHVXXXXXXXXXXXXXXXXXD 497
           P HY +LSF+NI M +E+  Y++   L   I N  YV                       
Sbjct: 404 PAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDR------------------- 444

Query: 498 NKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSSPDTTYEGEXXX---------XXX 548
                   T  +V   +++S   K  ++ L++ T+ SP   +  E               
Sbjct: 445 --------TKHAVSNSNRQSLSKKGTSDTLNTYTLESP-INHNTEVDMNDIPSIYDENEI 495

Query: 549 XXXSKLQKLKLKETIQVLDIATYNTPLFQSHDSHMANITLS 589
              +KL +L+++     LDI+ Y+ P  +    H+ N+++S
Sbjct: 496 EIANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSIS 536

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score =  431 bits (1107), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 237/512 (46%), Positives = 326/512 (63%), Gaps = 57/512 (11%)

Query: 700  MYPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLI 759
            ++ ++R  + +F TSA++A++MG   GNRT+YIGN+NPRSKAED+CNVVRGG LQ IK  
Sbjct: 553  LHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFF 612

Query: 760  ASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASR 819
              K ICFVTFIEA++A QFYANSFIDP+ILH NTL++GWG++  PL KSI+LAVT+GASR
Sbjct: 613  KEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASR 672

Query: 820  NVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWV 879
            NVYVSLPE+AFKDKF+NDPEYKE+H KY LP+E++LR DF+ +G +EQ+N+L+D HCCW+
Sbjct: 673  NVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWI 732

Query: 880  NFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHY 939
            NFMNI SAIKLVE VN++    TF +++ +RY GLII YGKDRCGNVN++LIS KNS+ Y
Sbjct: 733  NFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFY 792

Query: 940  RKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGLQRTAPPEEQKVP 999
            RKVKK S N +L+QL+E+R+ ++EK K  N  +N      L++ GI ++          P
Sbjct: 793  RKVKKPSYNIRLQQLEEERK-QEEKNKISNKSIN------LNSFGIQVE---------TP 836

Query: 1000 ESNEDDANYDSAVTESDTNTFNALGFRI-QSNTDSHXXXXXXXXXXXXXXXXXIAHADDI 1058
              NE +        E    + + LG  + + N+++H                 +   DD 
Sbjct: 837  SQNESE-------QEEPKISLDGLGMSLSKPNSENH----------------DLKETDDS 873

Query: 1059 SSVNSSDVEIIIDCPHNESDTSMIQEKKKTIRKNQQ----KIDRLAKARNAMFPEHRETI 1114
             S  S+D+E+IID P  E +T   + KK+  RKN                 +        
Sbjct: 874  DSDISTDIELIIDPPVRE-NTKGNKNKKQNHRKNDMNNNLNFGNPPPVSKTLLESSPPLA 932

Query: 1115 PDINNKLFHXXXXXXXXXXXQV----QGGIQDQDPHLSS--------TGKQQRVIPGADV 1162
            P   ++ F             +    Q  + + D + SS        + K ++++PG+DV
Sbjct: 933  PATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDV 992

Query: 1163 MAQYLTQLQHSTFMYAANILGVSAEDNTYYDE 1194
            M+QYL QLQHSTFMYAANILG S+++  +YDE
Sbjct: 993  MSQYLAQLQHSTFMYAANILGASSDEPEFYDE 1024

 Score =  195 bits (496), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 152/457 (33%), Positives = 214/457 (46%), Gaps = 124/457 (27%)

Query: 72  AYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQSPA 131
            YY    +PNAPPTPFD+AYGA+LLPSHLLMGSP+VSTP       Q  SQ F     P+
Sbjct: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPT----MGQSYSQQF---ARPS 163

Query: 132 GTPNRKSFSQLNSMLNQ-------PSSRSNFFTDSY-----------------------N 161
            +    S  +L+S           PSSR++  +++                        +
Sbjct: 164 PSKGGNSMGRLSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNS 223

Query: 162 NRYQNNPQTRIPEVDPNELFQK----PFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHS 217
           +R  NN   R  + +  + FQ+     F ISYK+LP G+D Y+TRSLLF NV  S+DLH 
Sbjct: 224 HRNTNNNGGRFTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHC 283

Query: 218 FIYDFVQYSSIESIYLISN-----------------TXXXXXXXXXXXXXXRSILLSFLS 260
           FI  FV +  IES+YLI++                                +SILLSFLS
Sbjct: 284 FIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLS 343

Query: 261 REICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNY--LEKTDDGSTAXXXXXXXXXXXX 318
           R ICL FYN+VLQRL+EFKT L S  LTL+FV+L Y   ++ DD                
Sbjct: 344 RPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDD---------------- 387

Query: 319 XXXDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIEL-KTKCDKETLLNKHLSFLIDN 377
                   E D+  ++    +L++D+I   ATR I +E  +    KE  +N  LSFL+ +
Sbjct: 388 -------EESDFSPALPL--SLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLL-S 437

Query: 378 KKNIRYILESIDLFXXXXXXXXXXXXXXXXAKNENENSPQGKEKDTMVQKRKRNRSKRTF 437
            +N RYI+ES+D+                             E+D               
Sbjct: 438 PENKRYIIESVDII-------------------------NAAERDA------------NL 460

Query: 438 PNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYV 474
           P +  +L+F+NI M +++ D ++L     GI+   +V
Sbjct: 461 PKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFV 497

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa]
           {ON} some similarities with uniprot|Q03735 Saccharomyces
           cerevisiae YML117w
          Length = 1050

 Score =  410 bits (1053), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 244/308 (79%), Gaps = 20/308 (6%)

Query: 689 VEQPTFNTDPTMYPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVV 748
           +  P FN   T   I +++ED+ NTSA++A++MG +  NRT+YIGN+NPRSK ED+CNVV
Sbjct: 567 ISGPPFNH--TNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVV 624

Query: 749 RGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKS 808
           RGGILQ++K I  KRICFVTFIEASAA QF ANSFIDP++LHGNTL++GWGN   PL KS
Sbjct: 625 RGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKS 684

Query: 809 IALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQI 868
           IALAVT+GA+RNVYVSLPE+AFKDKF+NDP+YKE+HE+YKLPS++QLR DF  YG IEQI
Sbjct: 685 IALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQI 744

Query: 869 NYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNR 928
           NYL DSHCCWVNF+NI SAI+LVED+N+N     F KKFN+RY+GLIINYGKDRCGN+N+
Sbjct: 745 NYLKDSHCCWVNFINIASAIRLVEDINHN-NGEEFHKKFNNRYEGLIINYGKDRCGNINK 803

Query: 929 NLISNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLP------SLDA 982
           NLI+ K S+ Y+KVKK S + ++++++EKR++++           DN L        LD+
Sbjct: 804 NLIAGKGSKFYKKVKKPSYDIRIKKMEEKRKMQE-----------DNLLSQKKNSIQLDS 852

Query: 983 LGIGLQRT 990
           LGI + RT
Sbjct: 853 LGISVDRT 860

 Score =  174 bits (442), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 141/426 (33%), Positives = 203/426 (47%), Gaps = 82/426 (19%)

Query: 77  SPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVP-----------------SSQQ 119
           SP  N PPTPFDTAYGA+LLPSHLLMGSP +ST N  +P                 S Q 
Sbjct: 44  SPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTN--LPRDNNADLLAGGYNRNNRSFQF 101

Query: 120 QSQMFLYSQSPAGTP----NRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQ--TRIP 173
           +       QS   TP     R S SQ  + ++Q  +  N    S  +  +   Q   R P
Sbjct: 102 RRNSGFVLQSNGNTPYMSSKRSSLSQ--APMSQKRAEKNSTDSSVGSHGKKKLQHKKRTP 159

Query: 174 EVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHS-FIYDFVQYSSIESIY 232
            +D  +    P  I+Y++LP+GDD Y+TRSLLF NV  + ++ S F+   + YS +ES+Y
Sbjct: 160 -IDVTKKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVY 218

Query: 233 LISNTXXXXXXXXXXXXXXRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFV 292
           +   T                + LSFLSR+  L FYNN LQRL +FK  L S  L+++FV
Sbjct: 219 VFQQTDTPSKDKESDKDTC-CLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFV 277

Query: 293 ILNYLEKTDDGSTAXXXXXXXXXXXXXXXDVNTNEFDYRNSMNTVN--ALKFDLINPDAT 350
             +Y+  TD+                    +NT + + + S   +   AL  ++ + DAT
Sbjct: 278 SFSYV--TDEDKDKDKDKDKD---------INTEKRNIKRSQELLKEPALGEEIFSHDAT 326

Query: 351 RFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFXXXXXXXXXXXXXXXXAKN 410
           R I IE  ++ +++ L  K L FL D+K N RYILE++D+                    
Sbjct: 327 RSIAIEFYSQVEQDALFEK-LPFL-DDKDNKRYILEAVDII------------------- 365

Query: 411 ENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITN 470
               S +    D              FP +Y +L+FINI MA+E+ DYLK N + + +  
Sbjct: 366 ----SAEDAADD--------------FPANYVILTFINIKMAIEVLDYLKANLMTYSVNE 407

Query: 471 ASYVQI 476
             +V +
Sbjct: 408 CFFVSL 413

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/33 (84%), Positives = 29/33 (87%)

Query: 1155 RVIPGADVMAQYLTQLQHSTFMYAANILGVSAE 1187
            R IPG+DVMAQYL QLQHSTFMYAANILG S E
Sbjct: 1010 RPIPGSDVMAQYLAQLQHSTFMYAANILGASVE 1042

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  405 bits (1040), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 189/296 (63%), Positives = 238/296 (80%), Gaps = 15/296 (5%)

Query: 702 PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761
           PI ++LE  FN SA+VASSMG ++GNRTIYIGN+NPRS+AED+CNVVRGGILQ+IK IA 
Sbjct: 618 PITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAE 677

Query: 762 KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821
           KRICFVTFIEA++AVQFYANSFIDP++LHGN L++GWG+Y  PL KSI+LAVTIGASRNV
Sbjct: 678 KRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNV 737

Query: 822 YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881
           YVSLPEFAFK+KF++DP+YK+ HE   LP  +QLR DF+ YG IEQINYLSDSHCCW+NF
Sbjct: 738 YVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINF 797

Query: 882 MNITSAIKLVEDVNNNPKDNTFS----------KKFNHRYDGLIINYGKDRCGNVNRNLI 931
           MNI+SAI LVE++N  P  +  S          +KF+ RY GL+INYGKDRCGN+N+NL+
Sbjct: 798 MNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLV 857

Query: 932 SNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGL 987
           + KNSR Y+KVK+ S N +L +L+E+RR  +   KE     + +K+ +L++LGI L
Sbjct: 858 AGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKE-----SFDKVLNLESLGISL 908

 Score =  246 bits (627), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 183/501 (36%), Positives = 237/501 (47%), Gaps = 127/501 (25%)

Query: 37  SRKPS----------YISLNHSVHNPNMVYQHD-PNGS-QYFATTQQAYYIPSPLPNAPP 84
           SRKPS          +  +N  V NP + +  D  NG+ QY  +   AYY  SPLPN PP
Sbjct: 6   SRKPSANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYGPSQHPAYYTNSPLPNVPP 65

Query: 85  TPFDTAYGATLLPSHLLMGSPYVSTPNG-------------------------------- 112
           TPFDTAYGA+LLPSHLLMGSP+VS+PN                                 
Sbjct: 66  TPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPISSQNSYNANHN 125

Query: 113 ------------IVPSSQQQSQMFLYSQSPAGTPN-----RKSFSQLNSMLNQPSSRSNF 155
                       + PSS  ++   L+S+      N      K +   NS   + SSR N 
Sbjct: 126 NNNNNSNSNNGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYETRNSSGRRTSSRINI 185

Query: 156 FTDSYNNRYQNNPQTRIPEVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDL 215
           F                 E+DP  L QKPF I+YK+LP GDDAYRTRSLL  NV  S DL
Sbjct: 186 FD----------------EIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADL 229

Query: 216 HSFIYDFVQYSSIESIYLISNTXXXXXXXXXXXXXXRSILLSFLSREICLSFYNNVLQRL 275
           HS + +FV+ +++ES Y++ +                SIL+SFL+R  CL+FYNN+LQRL
Sbjct: 230 HSLVKNFVKSNALESAYIVGSKETDNLEKEETKNL--SILISFLTRGDCLNFYNNILQRL 287

Query: 276 NEFKTNLQSKSLTLNFVILNYLEKTDDGSTAXXXXXXXXXXXXXXXDVNTNEFDYRNSMN 335
           +EFKT L+SKSL L FV LNY  K+                            D  ++M 
Sbjct: 288 SEFKTFLKSKSLNLKFVCLNYDSKSLPTPVEDEELSRSEEQAAT---------DDASTMI 338

Query: 336 TVNALKFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFXXXX 395
           +  +L  D+ N DATR I+IE K+  +K  L  + L FL D  KN RYILESID+     
Sbjct: 339 SA-SLHHDVENKDATRSIIIEFKSPLEKAELFKEKLQFL-DRSKNKRYILESIDIV---- 392

Query: 396 XXXXXXXXXXXXAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMEL 455
                                     DT V   +       FP +Y VL+F+NI+MA+E+
Sbjct: 393 --------------------------DTDVPSNQ-------FPENYVVLTFLNIFMAIEV 419

Query: 456 RDYLKLNGLKHGITNASYVQI 476
            DYLK    K GI+   YV +
Sbjct: 420 LDYLKKYSKKLGISKCFYVSL 440

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  399 bits (1024), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 188/296 (63%), Positives = 234/296 (79%), Gaps = 14/296 (4%)

Query: 702 PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761
           PI ++LE  FN SA+VASSMG ++GNRTIYIGN+NPRS+AED+CNVVRGGILQSIK +  
Sbjct: 625 PITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPE 684

Query: 762 KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821
           KRICFVTFIEA +AVQFYANSFIDP++LHGN L++GWG+Y  PL KSI+LAVTIGASRNV
Sbjct: 685 KRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNV 744

Query: 822 YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881
           YVSLPEFAFK+KF++DP+YK+ HE   LP  +QLR DF+ YG IEQINYLSDSHCCW+NF
Sbjct: 745 YVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINF 804

Query: 882 MNITSAIKLVEDVNNNP----KDNTFS------KKFNHRYDGLIINYGKDRCGNVNRNLI 931
           MNI+SAI LVE++N       +D   +      KKF  RY+GL+INYGKDRCGN+N+NL+
Sbjct: 805 MNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLV 864

Query: 932 SNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGL 987
           + KNSR Y+KVK+ S N +L +L+E+RR  +   KE       +K  +L++LGI L
Sbjct: 865 AGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKERAF----DKALNLESLGISL 916

 Score =  250 bits (638), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 184/475 (38%), Positives = 242/475 (50%), Gaps = 98/475 (20%)

Query: 42  YISLNHSVHNPNMVYQHD-PNGS-QYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSH 99
           Y  +N  V NP + +  D  NG+ QY  +   AYY  SPLPN PPTPFDTAYGA+LLPSH
Sbjct: 21  YNGMNAMVGNPIIYHPVDFINGAGQYGPSQHPAYYSNSPLPNIPPTPFDTAYGASLLPSH 80

Query: 100 LLMGSPYVSTPN---GIVPSSQQQSQMFLYSQSPAG--------------------TPN- 135
           LLMGSP+VS+PN   G  P+     +   YS+  +                     TP+ 
Sbjct: 81  LLMGSPFVSSPNMQGGYSPARSSNFKRKAYSRPVSNHNNYNGNNNSNQNNNNNGMVTPSN 140

Query: 136 -----RKSFSQLNSMLNQPSSRSNFFTDSYNN--RYQNNPQTRIPEVDPNELFQKPFVIS 188
                R SFS+ N+   + S+ +N   D+ N+  R  +       ++    L Q+PF I+
Sbjct: 141 YYRIERNSFSR-NNNSTRNSTHNNKGCDNRNSSGRRTSTRNNIFDDISSELLLQRPFRIN 199

Query: 189 YKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNTXXXXXXXXXXX 248
           YK+LPTGDDAYRTRSLL  NV  S DLHS + +FV+ +++ES Y+I N            
Sbjct: 200 YKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNEKSDDLKDEQTS 259

Query: 249 XXXRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKT------DD 302
               SIL+SFL+R  CL+FYNN+LQRL+EFKT L+S+SL L FV LNY  K       DD
Sbjct: 260 NL--SILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCLSTFIEDD 317

Query: 303 GSTAXXXXXXXXXXXXXXXDVNTNEFDYRNSMNTVNA-LKFDLINPDATRFIMIELKTKC 361
             T                  N  + D  N  + ++A L  DL N DATR I++E K+  
Sbjct: 318 ALTE-----------------NVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPL 360

Query: 362 DKETLLNKHLSFLIDNKKNIRYILESIDLFXXXXXXXXXXXXXXXXAKNENENSPQGKEK 421
               L NK L FL D   N RYILESID+                     N + P  +  
Sbjct: 361 KSTELFNKKLQFL-DRSNNKRYILESIDIV--------------------NTDVPSNQ-- 397

Query: 422 DTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYVQI 476
                          FP +YAVL+F+NI+MA+E+ DYLK    K GI+   YV +
Sbjct: 398 ---------------FPENYAVLTFLNIFMAIEVLDYLKKYSKKLGISKCFYVSL 437

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score =  396 bits (1018), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 198/345 (57%), Positives = 248/345 (71%), Gaps = 23/345 (6%)

Query: 702  PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761
            PI ++LE  FN SA+VASSMG ++GNRTIYIGN+NPRSKAED+CNVVRGGILQSIK I  
Sbjct: 627  PITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPE 686

Query: 762  KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821
            K+ICFVTFIEA +AVQFYANSFIDP++LHGN L++GWG+Y  PL K I+LAVTIGASRNV
Sbjct: 687  KKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNV 746

Query: 822  YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881
            YVSLPEFAFK+KF++DP+YK+ HE   LP  +QLR DF+ YG IEQINYLSDSHCCW+NF
Sbjct: 747  YVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINF 806

Query: 882  MNITSAIKLVEDVN------NNPKDNTFSK----KFNHRYDGLIINYGKDRCGNVNRNLI 931
            MNI+SAI LVE++N      N   + T  +    KF  RY GL+INYGKDRCGN+N+NLI
Sbjct: 807  MNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLI 866

Query: 932  SNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQ--EKGKELNGGVNDNKLPSLDALGIGLQR 989
            + KNSR Y+KVK+ S N +L +L+EKRR  +  EK K  +  +N      L++LGI L  
Sbjct: 867  AGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDEKEKAFDKPLN------LESLGISLDA 920

Query: 990  TAPPEEQKVPESNEDDANYDSAVTE-----SDTNTFNALGFRIQS 1029
                   +   +N      +S +       ++T +F  LG  + S
Sbjct: 921  HKDNGGGETGTANNTGHENESELEAENENGNETGSFGGLGLAVAS 965

 Score =  248 bits (634), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 181/469 (38%), Positives = 234/469 (49%), Gaps = 85/469 (18%)

Query: 42  YISLNHSVHNPNMVYQHD-PNGS-QYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSH 99
           Y  +N  V NP M +  D  NG+ QY  +   AYY  SPLPN PPTPFDTAYGA+L PSH
Sbjct: 21  YNGMNAMVGNPMMYHPVDFVNGAGQYGPSQHPAYYTNSPLPNIPPTPFDTAYGASLFPSH 80

Query: 100 LLMGSPYVSTPN---GIVPSSQQQSQMFLYSQSPAG--------------------TPN- 135
           LLMGSP+VS+PN   G   +     +   YS+  +                     TP+ 
Sbjct: 81  LLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVSNHNGYNGNSNSNQNNTNNGMVTPSN 140

Query: 136 -----RKSFSQLNSMLNQPSSRSNFFTDSYNN--RYQNNPQTRIPEVDPNELFQKPFVIS 188
                R SFS+ N+     +  +N   D+ NN  R          ++ P  L Q+PF I+
Sbjct: 141 YYRMGRNSFSRNNNSTRNVTHNNNKGCDTRNNSGRRTFARNNIFDDILPEMLLQRPFCIN 200

Query: 189 YKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNTXXXXXXXXXXX 248
           YK+LPTGDDAYRTRSLL  NV  SIDLHS + +FV+ +++ES YLI              
Sbjct: 201 YKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEGGKSDDSKDVETK 260

Query: 249 XXXRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKTDDGSTAXX 308
               SIL+SFL++  CL+FYNN+LQRL+EFKT L+S++L L FV LNY  K         
Sbjct: 261 NL--SILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKC-------- 310

Query: 309 XXXXXXXXXXXXXDVNTNEFDYRNSMNTVNA-LKFDLINPDATRFIMIELKTKCDKETLL 367
                          N  E D  N    ++A L  ++ N DATR I+IE K+  +K  L 
Sbjct: 311 ---LPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSPVEKSDLF 367

Query: 368 NKHLSFLIDNKKNIRYILESIDLFXXXXXXXXXXXXXXXXAKNENENSPQGKEKDTMVQK 427
            K L FL D  KN RYILESIDL                     N + P  +        
Sbjct: 368 KKKLQFL-DRSKNKRYILESIDLV--------------------NTDVPSNQ-------- 398

Query: 428 RKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYVQI 476
                    FP +YAVL+F+NI MA+E+ DYLK      GI+   YV +
Sbjct: 399 ---------FPENYAVLTFLNISMAIEVLDYLKKYSKNLGISKCFYVSL 438

 Score = 75.1 bits (183), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 33/42 (78%), Positives = 37/42 (88%)

Query: 1153 QQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDE 1194
            + R IPG+DVMAQYL Q+QHSTFMYAANILG SAEDNT+ DE
Sbjct: 1093 RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score =  394 bits (1011), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 240/310 (77%), Gaps = 3/310 (0%)

Query: 702  PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761
            PI ++L+ ++ TSA+VASSMG  +GNRT+YIGN++PRS+ ED+CNVVRGGILQ++K +A 
Sbjct: 566  PITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAE 625

Query: 762  KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821
            KRICFVTF+EASAAVQFY N+FIDP++LHGN LK+GWG++  PL KSIALAVT+GASRNV
Sbjct: 626  KRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNV 685

Query: 822  YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881
            YVSLPEFAFKDK++ DP+Y+E+++K++LP E+QLR DF+ YG IEQINYL+D HCCWVNF
Sbjct: 686  YVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNF 745

Query: 882  MNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRK 941
             NI++AIKLVE+V      N F K    RYDGL+I YGKDRCGNVN+N I+ KNSR Y+K
Sbjct: 746  TNISAAIKLVEEVKYEGGGN-FYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKK 804

Query: 942  VKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGLQRTAPPEEQKVPES 1001
            VKK S N +L +++E+RR  +E  +      N  K     +LGI +      + +KV + 
Sbjct: 805  VKKPSFNIRLSKMEEERRQHEETLRRQQEN-NSEKFLQFGSLGITIDSNGKEDPEKVDDV 863

Query: 1002 N-EDDANYDS 1010
            + ED+  +DS
Sbjct: 864  DFEDEVKFDS 873

 Score =  266 bits (680), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 186/571 (32%), Positives = 276/571 (48%), Gaps = 106/571 (18%)

Query: 50  HNPNMVYQHDPNGSQYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVST 109
           +N   +YQH       F  +Q  YY   P+ NAPPTPFDTAYG TLLPSHLLMGSP+VS+
Sbjct: 27  YNSPGIYQH---MVPQFMNSQPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSS 83

Query: 110 PN---GIVPSSQQQSQMFLYSQSPAGTPNRKSFSQLNSM------LNQPSSRSNFFTDSY 160
           PN             ++  YS + + + + +SF +L +       LN P +  N   +  
Sbjct: 84  PNLFQQPHHHQHAHQRLQQYSHNQSKSSSGRSFGKLATAYPVPPSLNSPPASRNALHNRG 143

Query: 161 NNRYQNNPQTRIPEVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIY 220
             R   +    I   D ++ F+ PF+++Y++LP G+D +RTRSLLF NV  SIDLHSF+ 
Sbjct: 144 PRR--GSHYKSIQSSDASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVT 201

Query: 221 DFVQYSSIESIYLISNTXXXXXXXXXXXXXXRSILLSFLSREICLSFYNNVLQRLNEFKT 280
           +F  Y  +ES+YL  +                SILLSF S+ ICL FYN+VLQRL+E+K+
Sbjct: 202 NFTNYGPVESVYLFKSEGDHV-----------SILLSFFSKAICLDFYNSVLQRLSEYKS 250

Query: 281 NLQSKSLTLNFVILNYLEKTDDGSTAXXXXXXXXXXXXXXXDVNTNEFDYRNSMNTVNA- 339
           +L SK+LTL+FV L Y  K  D S                 D++  +    ++ N   A 
Sbjct: 251 DLDSKALTLSFVSLEY--KVSDTS---------------EEDIDKEDDSKPDAFNITAAG 293

Query: 340 -LKFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFXXXXXXX 398
            L++D+IN  ATR IMI  KT C K+ L++K L FL   + N RY+LESIDL        
Sbjct: 294 SLRYDVINRGATRSIMITFKTPCSKDELIDKKLEFL-KKENNTRYVLESIDLVTA----- 347

Query: 399 XXXXXXXXXAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDY 458
                                           +   + FP +YAVL+F+NI+MA+E+ DY
Sbjct: 348 --------------------------------DEPSKHFPQNYAVLTFLNIFMAVEILDY 375

Query: 459 LKLNGLKHGITNASYVQIKHVXXXXXXXXXXXXXXXXXDNKDKSEVDTNESVEGKDKKSE 518
           ++L+  K  I+   ++ I+                      D   +  + +  G+  +S 
Sbjct: 376 IRLHSQKLDISKCFFISIQPQI------------------PDGKRLSVSSASNGRSMESI 417

Query: 519 EA--KSFNNKLSSITMSSPDTTYEGEXXXXXXXXXSKLQKLKLKETIQVLDIATYNTPLF 576
               +S N  ++S+  S    + + E          KLQ +  K+ I  +    Y  P F
Sbjct: 418 SGNYRSKNASVTSLESSGSIISLDQEIDEMTY----KLQSVNSKKNILEVTTNNYKDPSF 473

Query: 577 QSHDSHMANITLSIVNPFEAQLMRPPPSNIV 607
           + H  H+ N+T+S     ++QL  P P  + 
Sbjct: 474 EGHTDHLTNVTVSEAASLDSQLTMPSPQEVT 504

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 1/41 (2%)

Query: 1155 RVIPGADVMAQYLTQLQHSTFMYAANILGVSAE-DNTYYDE 1194
            + IPG+DVMAQYL QLQHSTF+YAANILG S + DN Y DE
Sbjct: 1071 KSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  391 bits (1005), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/295 (62%), Positives = 232/295 (78%), Gaps = 15/295 (5%)

Query: 703 IVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASK 762
           I ++LE  FN SA+VASSMG ++GNRTIYIGN+NPRS+AED+CNVVRGGILQSIK I  K
Sbjct: 625 ITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEK 684

Query: 763 RICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVY 822
           RI FVTFIEA +AVQFYANSFIDP++LHGN L++GWG+Y  PL KSI+LAVTIGASRNVY
Sbjct: 685 RISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVY 744

Query: 823 VSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFM 882
           VSLPEFAFK+KF++DP+YK+ HE   LP  +QLR DF+ YG IEQINYLSDSHCCW+NFM
Sbjct: 745 VSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFM 804

Query: 883 NITSAIKLVEDVNNNPKDN----------TFSKKFNHRYDGLIINYGKDRCGNVNRNLIS 932
           NI+SAI LVE++N     +             +KF+ RY GL+INYGKDRCGN+N+NL++
Sbjct: 805 NISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVA 864

Query: 933 NKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGL 987
            KNSR Y+KVK+ S N +L +L+E+RR  +   KE     + +K+ +L++LGI L
Sbjct: 865 GKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKE-----SFDKVLNLESLGISL 914

 Score =  246 bits (627), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 181/486 (37%), Positives = 240/486 (49%), Gaps = 91/486 (18%)

Query: 24  GSSYYMNVQQDQRSRKPSYISLNHSVHNPNMVYQHD-PNG-SQYFATTQQAYYIPSPLPN 81
           G++Y    Q D       Y  +N  V N  M +  D  NG  QY ++   AYY  SPLPN
Sbjct: 10  GANYAYRQQHD-------YNGMNAMVGNQMMYHPVDFINGVGQYGSSQHPAYYTNSPLPN 62

Query: 82  APPTPFDTAYGATLLPSHLLMGSPYVSTPN---GIVPSSQQQSQMFLYSQSPAGTPN--R 136
            PPTPFDTAYGA+LLPSHLLMGSP+VS+PN   G  P+     +   YS+ P    N   
Sbjct: 63  VPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSR-PVSNQNGYN 121

Query: 137 KSFSQLNSMLNQPSSRSNFFTD---------------SYNNRYQNNPQTR---------- 171
            + S  N   N   + SN++ +               S+NN    + +            
Sbjct: 122 GNSSNHNHSGNGMMTPSNYYRNGRNSSSRNNNSTRNVSHNNNKGCDTRNSSGRRASSRSN 181

Query: 172 -IPEVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIES 230
              E++P  L Q+PF I+YK+LPTGDDAYRTRSLL  NV  S DLHS + +FV+++++ES
Sbjct: 182 IFDEINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLES 241

Query: 231 IYLISNTXXXXXXXXXXXXXXRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLN 290
            Y + N                S+L+SFL+R  CL+FYNN+LQRL+EFK  L+SKSL L 
Sbjct: 242 AYFVDNDKNDDLEDGETENL--SVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLK 299

Query: 291 FVILNYLEKTDDGSTAXXXXXXXXXXXXXXXDVNTNEFDYRNSMNTVNALKFDLINPDAT 350
           FV LNY  +                      +V+       +SM    +L  D+ N DAT
Sbjct: 300 FVCLNYESEC----------LSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDAT 349

Query: 351 RFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFXXXXXXXXXXXXXXXXAKN 410
           R I+IE K+  +K  L  K L FL D  KN RYILESIDL                    
Sbjct: 350 RSIIIEFKSALEKTELFRKRLQFL-DESKNKRYILESIDLV------------------- 389

Query: 411 ENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITN 470
            N + P  +                 FP +YAVL+F+NI+MA+E+ DYLK       I+ 
Sbjct: 390 -NTDVPSNQ-----------------FPENYAVLTFLNIFMAVEVLDYLKKFSKSLEISK 431

Query: 471 ASYVQI 476
             YV +
Sbjct: 432 CFYVSL 437

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (85%)

Query: 1153 QQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDE 1194
            + R IPG+DVMAQYL Q+QHSTFMYAANILG SAEDN Y +E
Sbjct: 1087 RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  379 bits (973), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 182/303 (60%), Positives = 237/303 (78%), Gaps = 7/303 (2%)

Query: 702  PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761
            P+ +TL+ ++  +AQVA++MG   GNRT+YIGN++PRSK ED+CNVVRGGILQS+K I +
Sbjct: 412  PLGQTLQQQYTATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEA 471

Query: 762  KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821
            K ICFVTFIEA++AVQF+ANS I+P++LHG+ LK+GWG++   L +SI+LAVTIGASRNV
Sbjct: 472  KHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNV 531

Query: 822  YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881
            YVSLPE+AFKDKF+ DPEY+ F EK+KLPS+QQL  DF+ +G IE IN+L D HCCW+NF
Sbjct: 532  YVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINF 591

Query: 882  MNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRK 941
            MNI++AIKLVED NN+  + +F +KF +RY GL I YGKDRCGNVN+NL+SNKNS++++K
Sbjct: 592  MNISNAIKLVEDANNS-NNESFHEKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKK 650

Query: 942  VKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGI--GLQRTA--PPEEQK 997
            VKK S N +LR+ Q+K  +E +  K   G  N  K   +DA GI  G Q  A    EEQK
Sbjct: 651  VKKASYNIRLRR-QQKSDIEAQ-AKSGKGDENSEKKLQVDAFGISVGSQPDARYSDEEQK 708

Query: 998  VPE 1000
            + E
Sbjct: 709  IEE 711

 Score =  114 bits (285), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 106/413 (25%), Positives = 171/413 (41%), Gaps = 130/413 (31%)

Query: 182 QKPFVISYKLLP---TGD-DAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNT 237
           Q P+ +++ +LP    GD D +RTRSL FSN+   + LH F+  F ++  IES+Y++   
Sbjct: 60  QIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDR- 118

Query: 238 XXXXXXXXXXXXXXRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYL 297
                         +S+L+SFL++E CL FYN +LQ+L+EFK  L+SK L+L+F     +
Sbjct: 119 ------------EQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKV 166

Query: 298 EKTDDGSTAXXXXXXXXXXXXXXXDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIEL 357
           E                                  S  T+  +KF+++   ATR + +E 
Sbjct: 167 E----------------------------------SGPTLQEIKFEVLRAGATRSLGLEF 192

Query: 358 KTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFXXXXXXXXXXXXXXXXAKNENENSPQ 417
           K + D  +LL K   F   +    RY++ESI+                      N + P 
Sbjct: 193 KDEIDFASLLKK---FDFFDNSGPRYVIESIETV--------------------NTDKPS 229

Query: 418 GKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKH-GITNASYVQI 476
                            + F ++YA++ FI+I MA+E  +YLK+   +  G+T  SYV  
Sbjct: 230 -----------------KYFGSNYAIVHFISIAMAVETMEYLKVQTPESFGLTKVSYVNS 272

Query: 477 KHVXXXXXXXXXXXXXXXXXDNKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSSPD 536
                                   KSE  T  + E  D+   E +   +    IT+S   
Sbjct: 273 TFTS-------------------GKSEFQTFSNSELSDQNDVEVQDSISSFEDITLSEGS 313

Query: 537 TTYEGEXXXXXXXXXSKLQKLKLKETIQVLDIATYNTPLFQSHDSHMANITLS 589
            + E E                  +   VL  + Y  P+ + H+ H ++IT+S
Sbjct: 314 MSVENE------------------KAFTVLP-SQYGPPVVEEHNQHCSHITIS 347

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/33 (72%), Positives = 29/33 (87%)

Query: 1152 KQQRVIPGADVMAQYLTQLQHSTFMYAANILGV 1184
            +  + IPG++VMAQYL QLQHSTFMYAA+ILGV
Sbjct: 873  RNAQAIPGSNVMAQYLAQLQHSTFMYAADILGV 905

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  376 bits (965), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 173/293 (59%), Positives = 234/293 (79%), Gaps = 6/293 (2%)

Query: 703  IVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASK 762
            + +TLE+ FNTS ++++ +G   GNRT+YIGN+NPRSK ED+CNVVRGGILQ I  +  K
Sbjct: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860

Query: 763  RICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVY 822
             ICFVTFIEA+ A QF+AN++IDP++LHGN LK+GWGN+  PL KSI+LAVTIGA+RNVY
Sbjct: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920

Query: 823  VSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFM 882
            VSLPEFAFKDKF+N+P+Y+++HE YKLP+E QLR DF++YG IEQINYL+D HCCW+NFM
Sbjct: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980

Query: 883  NITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKV 942
            NI SAI LVE+VN +     F  KF+ RY+GLII YGKDRCGNVN+NL++ KNS+ ++KV
Sbjct: 981  NINSAITLVEEVNED-DGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFKKV 1039

Query: 943  KKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDN---KLPS--LDALGIGLQRT 990
            KK +   KL++++E+RR+++E     N  +++N   + P+  L++LGI  + +
Sbjct: 1040 KKPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQIRKPAVNLESLGITFESS 1092

 Score =  152 bits (385), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 153/311 (49%), Gaps = 51/311 (16%)

Query: 175 VDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLI 234
           +D N+L + P V+SYK+LP G D +RTRSLL  N+  SID  + + +F+ +  IES+YLI
Sbjct: 251 IDINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLI 310

Query: 235 SNTXXXXXXXXXXXXXXRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVIL 294
                             SILLSF+SREICL FYNNVLQRL EFKT L SKSLTL+FVIL
Sbjct: 311 K---------LNPGSKYNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVIL 361

Query: 295 NY----------LEKTDDGSTAXXXXXXXXXXXXXXXDVNTNEF--------DYRNSMNT 336
            Y             +D+G  +               + +  E         D RN +N 
Sbjct: 362 KYEFTDYNHPINEHASDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIEDIRNDLNK 421

Query: 337 VN-------ALKFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESID 389
            N       AL+ DL+   ATR ++++      K+ L+N+ L+  I+N  N RYILESI 
Sbjct: 422 ENFPLTFASALQSDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILESIS 481

Query: 390 LFXXXXXXXXXXXXXXXXAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINI 449
           L                  +++ E++P  K                 F N+Y +L+F NI
Sbjct: 482 LVNIENNTKNNKNTIGDDNEDQIEDTPISK-----------------FGNNYCLLTFSNI 524

Query: 450 YMAMELRDYLK 460
            MA+E  DY K
Sbjct: 525 LMAIEAFDYFK 535

 Score = 79.3 bits (194), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/71 (60%), Positives = 49/71 (69%), Gaps = 12/71 (16%)

Query: 72  AYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQ-SP 130
            YY  SP+P+APPTPFD +YGATLLPSHLLMGSP+VSTPN            F YS  S 
Sbjct: 96  TYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPN---------IHSFPYSATSI 144

Query: 131 AGTPNRKSFSQ 141
           + TP RKSFS+
Sbjct: 145 SSTPTRKSFSR 155

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 39/43 (90%), Gaps = 2/43 (4%)

Query: 1154 QRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDN--TYYDE 1194
            ++ IPG+DVM+QYLTQLQHSTFMYAANILGVSAEDN  TY D+
Sbjct: 1315 RKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDD 1357

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  364 bits (935), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 238/325 (73%), Gaps = 25/325 (7%)

Query: 717  VASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAV 776
            VA++MG  +GNRT+YIGN++PRSK ED+CNVVRGGILQS+K I +K ICFVTFIEA++AV
Sbjct: 504  VATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAV 563

Query: 777  QFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLN 836
            QF+ANS I+P++LHGN LK+GWG++   L +SI+LAVTIGASRNVYVSLPE AFKDKF+ 
Sbjct: 564  QFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIK 623

Query: 837  DPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNN 896
            DPEY+EF EK++LPS++QL  DF+ +G IE +N+L D HCCW+NFMNI++AIKLVED  N
Sbjct: 624  DPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDA-N 682

Query: 897  NPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQE 956
            NP +++F +KF +RY GL I YGKDRCGNVN+NL++NKNS++++KVKK S N +LR+ Q+
Sbjct: 683  NPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYFKKVKKASYNIRLRKQQK 742

Query: 957  KRRVE----QEKGKELNGGVNDNKLPSLDALGIGLQRTA-----PPEEQKVPESNEDDAN 1007
                     +++ KEL+  +        DA GI +  T        EEQK+ E       
Sbjct: 743  GASDAPTEVKDEAKELDKPIK------ADAFGISVGDTQNLVRDSDEEQKLEE------- 789

Query: 1008 YDSAVTESD-TNTFNALGFRIQSNT 1031
             D  +  SD  NT   LG  + S+T
Sbjct: 790  -DELLRLSDLNNTGGGLGISLASST 813

 Score =  177 bits (450), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 148/535 (27%), Positives = 233/535 (43%), Gaps = 146/535 (27%)

Query: 60  PNGSQYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPN-GIVPSSQ 118
           P GS+ ++     YY  + +P AP TPFDT+YG +LLPSHLLM SP+++TP  G     +
Sbjct: 30  PEGSREYS----GYYHGNRVPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGMGSASPHR 85

Query: 119 QQSQMFLYSQSPAGTPNRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPN 178
                  ++QS   TPN   F      +  P+ + NF    + + Y++N   +       
Sbjct: 86  AGGSRSSHAQSSYHTPN---FGSTQLRMPPPTEKRNF---KHGSSYRHNSSVQ------- 132

Query: 179 ELFQKPFVISYKLLP----TGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLI 234
              Q+ + + + +LP     G D Y TRSLLFSN+     LH F+  F ++  +ES+YL+
Sbjct: 133 ---QRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLV 189

Query: 235 SNTXXXXXXXXXXXXXXRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVIL 294
            +               +S+L+SFL++E CL FYN VLQ+L+EFK  L+SK LTLNF  L
Sbjct: 190 DS-------------QQQSVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASL 236

Query: 295 NYLEKTDDGSTAXXXXXXXXXXXXXXXDVNTNEFDYRNSMNTVNALKFDLINPDATRFIM 354
                                      DV T          T+  +K +++   ATR ++
Sbjct: 237 R--------------------------DVKTGP--------TLQEIKIEVLRAGATRSLI 262

Query: 355 IELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFXXXXXXXXXXXXXXXXAKNENEN 414
           +E + K D   LL+K L F+++  +  RY++E+I++                        
Sbjct: 263 LEFQDKVDL-ALLSKSLGFIVN--EGPRYVVEAIEIVNA--------------------- 298

Query: 415 SPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYV 474
                            RS + F  HYA++ FI+I MA+E  +YLK    K     A  +
Sbjct: 299 ----------------GRSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKL----AGLI 338

Query: 475 QIKHVXXXXXXXXXXXXXXXXXDNKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSS 534
           + ++V                     KSE  T  S +  ++             +++ +S
Sbjct: 339 KFRYVNTTSA--------------SGKSEFQTLSSSQLNER-------------ALSNTS 371

Query: 535 PDTTYEGEXXXXXXXXXSKLQKLKLKETIQVLDIATYNTPLFQSHDSHMANITLS 589
                 GE         SKLQ+  L E   V+D   Y  PL +    H+ ++T+S
Sbjct: 372 DSDISGGE---SVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTIS 423

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 39/58 (67%)

Query: 1141 QDQDPHLSSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEEDTT 1198
            QD    L    ++ + IPG+DVMAQYL QLQHSTFMYAANILGV   +  +YDE   T
Sbjct: 935  QDSKKPLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDENGPT 992

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  363 bits (931), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/311 (58%), Positives = 232/311 (74%), Gaps = 15/311 (4%)

Query: 702  PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761
            PI +TL+ +  T+AQVAS+MG  +GNRT+Y+GN+NPRSK ED+CNVVRGGILQ IK    
Sbjct: 546  PIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEH 605

Query: 762  KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821
            K +CFVTFIEA+AAVQF+AN+ I+P++LHGN LK+GWG++   L++SIALAVTIGASRNV
Sbjct: 606  KHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNV 665

Query: 822  YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881
            YVSLPE+AFKDKF+ DPE++EF EKY+LPS++QLR DF+ +G IEQINYL D HCCWVNF
Sbjct: 666  YVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNF 725

Query: 882  MNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRK 941
            MNITSAIKLVED  N   +  F   +  RY GLII YGKDRCGNVN+NL++NK SR ++K
Sbjct: 726  MNITSAIKLVEDA-NGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANKKSRFFKK 784

Query: 942  VKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGLQ-RTAPPEEQK--- 997
            VKK S  YK+R + ++ +     G+E      DN      A GI +  R    EE +   
Sbjct: 785  VKKAS--YKIR-MHKQNKAGGSNGQEPISSFQDN------AFGICISPRGIESEEVEALP 835

Query: 998  -VPESNEDDAN 1007
             VP++ E++ N
Sbjct: 836  DVPQNIEEEKN 846

 Score =  183 bits (465), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 138/434 (31%), Positives = 197/434 (45%), Gaps = 111/434 (25%)

Query: 69  TQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGI---------VPSSQQ 119
           +QQ YY  SP+P+AP TPFDT+YGATLLPSHLLMGSP++STP            + SSQQ
Sbjct: 53  SQQGYYAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQ 112

Query: 120 QSQMFLYS-------QSPAGTPNRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRI 172
           Q   + YS        S     ++K     + M+ + S       ++    ++   +T +
Sbjct: 113 QFYHYTYSNNGKNKGSSKKNNRDKKKVENGHVMMTRYSYPPPPQLNAPPMTHKR--KTHL 170

Query: 173 PEVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIY 232
                ++   +P+VI++K+LP GDD Y TRSLL SNV +SI LH FI  FV++  IES+Y
Sbjct: 171 RHETNSQPSSEPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVY 230

Query: 233 LI------------SNTXXXXXXXXXXXXXXRSILLSFLSREICLSFYNNVLQRLNEFKT 280
           ++                             +SILLSFL++  CL FYNNVLQ+L++FK 
Sbjct: 231 VVPEEEEEEEEEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKI 290

Query: 281 NLQSKSLTLNFVILNYLEKTDDGSTAXXXXXXXXXXXXXXXDVNTNEFDYRNSMNTVNAL 340
           +L SKSLTLNFV L                                         T   +
Sbjct: 291 DLNSKSLTLNFVSL-----------------------------------------TSEDI 309

Query: 341 KFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFXXXXXXXXX 400
           + D++   ATR I +E K     + L +     ++ N  N R+++E ID+          
Sbjct: 310 RDDVLRKGATRSIALEFKNSFTTKQLESIE---ILSNASNSRFVVEKIDIV--------- 357

Query: 401 XXXXXXXAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLK 460
                      N  SP                  + F  HYA++ FI+I MA+E   YL 
Sbjct: 358 -----------NTESPN-----------------KNFNTHYAIIHFISISMAVEASSYLL 389

Query: 461 LNGLKHGITNASYV 474
               K GI+   +V
Sbjct: 390 NWDEKLGISRLFFV 403

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 3/46 (6%)

Query: 1152 KQQRVIPGADVMAQYLTQLQHSTFMYAANILGVS---AEDNTYYDE 1194
            ++ + IPG+ VMAQYL QLQHSTFMYAANILGV+    ED+T YDE
Sbjct: 1029 RKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDE 1074

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  349 bits (895), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 163/271 (60%), Positives = 212/271 (78%), Gaps = 9/271 (3%)

Query: 692 PTFNTDPTM-YPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRG 750
           P++  DP +  PI +TL+ ++   A  A+ +     NRT+YIGN++PRSK ED+CNVVRG
Sbjct: 523 PSYFMDPMVGAPIGQTLQRQYLAGASQANGIN----NRTVYIGNIHPRSKPEDICNVVRG 578

Query: 751 GILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIA 810
           GILQ+IK I+SKRICFVTFIE +AAVQFYAN+ ++P++LHGN L++GWG     L K+IA
Sbjct: 579 GILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIA 638

Query: 811 LAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINY 870
           LAVTIGASRNVYVSLPE++FK+K++N+PE+K +H KYKLP+E+QLR DF KYG +EQINY
Sbjct: 639 LAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINY 698

Query: 871 LSDSHCCWVNFMNITSAIKLVEDVNNNPKDN--TFSKKFNHRYDGLIINYGKDRCGNVNR 928
           L D HCCWVNFMNI  AI+LVED N+  + N   F  +F+ RY  LII YGKDRCGNVN+
Sbjct: 699 LEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNK 758

Query: 929 NLISNKNSRHYRKVKKFSDNYKLRQLQEKRR 959
           NL +NKNSR Y+K+KK S  Y ++Q ++ R+
Sbjct: 759 NLAANKNSRFYKKIKKQS--YSMKQGKQPRK 787

 Score =  141 bits (355), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 111/402 (27%), Positives = 177/402 (44%), Gaps = 113/402 (28%)

Query: 63  SQYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQ 122
           +++F   +        +P  P TPFD  YGA+LLPSH+LMGSP++STP         + Q
Sbjct: 40  ARFFPGAEGMSLAAGSMPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP--------LRPQ 91

Query: 123 MFLYSQSPAGTPNRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPNELFQ 182
              +  +P  + +    +Q        S+RS+F         +  P  R   V  N    
Sbjct: 92  AHFHPSTPGHSSHSLHHAQ--------SARSSFLYYPQPPMLKPIPPRRKKSVTLNH--S 141

Query: 183 KPFVISYKLLPTGDDAYRTRSLLFSNVA--SSIDLHSFIYDFVQYSSIESIYLISNTXXX 240
           +P+ I++K+LP G D Y TRSLL +N+     +D+H+F+  FV++  +ESIYL+ +    
Sbjct: 142 EPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDDN--- 198

Query: 241 XXXXXXXXXXXRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKT 300
                       SILLSFL++  CL FYNN+LQR +EFKT L S  L+++FV  +     
Sbjct: 199 -----------HSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVCQD----- 242

Query: 301 DDGSTAXXXXXXXXXXXXXXXDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIELKTK 360
                                   ++ F Y         L+ +++   ATR + +E +  
Sbjct: 243 -----------------------ESSWFKY---------LQMNVVTRGATRSLTVEFEDS 270

Query: 361 CDK--ETLLNKHLSFLIDNKKNIRYILESIDLFXXXXXXXXXXXXXXXXAKNENENSPQG 418
             +  E  +     +L  ++   R++LE IDL                 A   N++    
Sbjct: 271 VKELNEDFVRLKFPWLFCSQ---RFVLERIDLI---------------NATTVNQH---- 308

Query: 419 KEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLK 460
                             F   Y +L FI+I MA+E+ D+L+
Sbjct: 309 ------------------FGTRYMILHFISISMALEVDDFLQ 332

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 1152 KQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAED---NTYYD 1193
            K  + I G DVM+QYL QL HSTF+YA NILG +        YYD
Sbjct: 992  KFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYD 1036

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  346 bits (888), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 211/272 (77%), Gaps = 9/272 (3%)

Query: 692 PTFNTDP-TMYPIVRTLEDKFNT-SAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVR 749
           P++  DP +  PI + L+ ++ T + QV  S      NRT+YIGN++PRSK ED+CNVVR
Sbjct: 536 PSYFMDPMSGAPINQALQRQYLTGTGQVGGS-----NNRTVYIGNIHPRSKPEDICNVVR 590

Query: 750 GGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSI 809
           GGILQ+IK I SKRICFVTFIEA+AA+QFYAN+ ++P++LHGN L++GWG     L K+I
Sbjct: 591 GGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNI 650

Query: 810 ALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQIN 869
           ALAVTIGASRNVYVSLPE++FK+K++N+PE+KE+H KYKLPSE+QLR DF KYG +EQIN
Sbjct: 651 ALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQIN 710

Query: 870 YLSDSHCCWVNFMNITSAIKLVEDVNNNPKDN--TFSKKFNHRYDGLIINYGKDRCGNVN 927
           YL D HCCWVNFMNI  AI+LVED N+  + N   F  +F+ RY  LII YGKDRCGNVN
Sbjct: 711 YLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVN 770

Query: 928 RNLISNKNSRHYRKVKKFSDNYKLRQLQEKRR 959
           +NL +NKNSR ++K+KK +   K  + Q+ +R
Sbjct: 771 KNLTANKNSRFFKKIKKLNCTTKPNKRQQSKR 802

 Score =  145 bits (366), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 139/531 (26%), Positives = 219/531 (41%), Gaps = 181/531 (34%)

Query: 79  LPNAPPTPFDTAYGATLLPSHLLMGSPYVSTP-------NGIVPSSQQQSQMFL-YSQSP 130
           +P  P TPFD  YGA+LLPSH+LMGSP+VSTP       +    S    S+ FL Y Q P
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGHFHPSASSHSNHSRSFLYYPQPP 138

Query: 131 AGTP----NRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPNELFQKPFV 186
              P     RKSFS     LN                                   +P+ 
Sbjct: 139 ILKPIPPRRRKSFS-----LNH---------------------------------SEPYQ 160

Query: 187 ISYKLLPTGDDAYRTRSLLFSNVA--SSIDLHSFIYDFVQYSSIESIYLISNTXXXXXXX 244
           +++K+LP G D Y TRSLLFSN+    + D+H+F+ +F+++  IESIYL+ ++       
Sbjct: 161 VNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDDS------- 213

Query: 245 XXXXXXXRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKTDDGS 304
                   SILLSFL++  CL FYNN+LQR +EFK+ L S  L+++FV            
Sbjct: 214 -------HSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC----------- 255

Query: 305 TAXXXXXXXXXXXXXXXDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIELKTKCDKE 364
                                     ++  N    L+ +++    TR + IE + +  + 
Sbjct: 256 --------------------------QDETNWFRLLQMNVVTRGVTRSLCIEFEDQSMEL 289

Query: 365 T--LLNKHLSFLIDNKKNIRYILESIDLFXXXXXXXXXXXXXXXXAKNENENSPQGKEKD 422
           T  L+++ + +L  +    R+++E IDL                  KN+N          
Sbjct: 290 TSDLIHEKIPWLFFSH---RFVIERIDLV------------NAAAPKNQN---------- 324

Query: 423 TMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKH--GITNASYVQIKHVX 480
                         F N Y ++ FI I MA+E+ +YL+    K   GI+   +V +    
Sbjct: 325 --------------FNNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVNV---- 366

Query: 481 XXXXXXXXXXXXXXXXDNKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSSPDTTYE 540
                            N   S++   ++V   +    E+++ +    S+ +S+     E
Sbjct: 367 -----------------NGHSSDLSDEDAVAAANGLQRESRTSSVSSISLPISNSSDLVE 409

Query: 541 GEXXXXXXXXXSKLQKLKLKETIQVLDI--ATYNTPLFQSHDSHMANITLS 589
                           L L   I  L +  + Y  PL +SHD H+ ++T+S
Sbjct: 410 ------------LFHSLDLALGIISLQVIPSEYPVPLIESHDDHLHSVTIS 448

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%)

Query: 1151 GKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVS 1185
             K  + I G DVM+QYL QL HSTF+Y+ NILG +
Sbjct: 1017 AKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGAT 1051

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  332 bits (850), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 197/242 (81%), Gaps = 5/242 (2%)

Query: 697 DPTMYP-IVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQS 755
           +P M P I +T++++++ S Q A + G+E  +RT+YIGN+NPRSKAED+CNVVRGGILQ 
Sbjct: 617 EPLMPPQITQTIQNQYSKSIQ-AVNAGME--HRTVYIGNINPRSKAEDICNVVRGGILQH 673

Query: 756 IKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTI 815
           IK ++ KRICFVTFIE +AAVQFYAN+ ++P+ILHGN LK+GWG    PL K+IALAVT+
Sbjct: 674 IKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTV 733

Query: 816 GASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSH 875
           GASRNVYVSLP+ AFKDKF+NDP++KE+  +YK+P+  QL+ DF  YG +EQ+N+ SD H
Sbjct: 734 GASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGH 793

Query: 876 CCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKN 935
           CCW+NFMNI+SAIKLVE+ ++  KDN F KK   RY GLII YGKDRCGN+NRNL+ NKN
Sbjct: 794 CCWINFMNISSAIKLVEEYSDT-KDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKN 852

Query: 936 SR 937
            +
Sbjct: 853 GK 854

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 35/61 (57%), Gaps = 7/61 (11%)

Query: 64  QYFATTQQAYYIPSPLPNA-------PPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPS 116
           QY   T +   +P  +P +       P TPFD  YG TLLPSHLL+GSP+V+TP    P 
Sbjct: 43  QYIYYTHRGGSMPGSIPGSIPGTVSIPQTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPM 102

Query: 117 S 117
           S
Sbjct: 103 S 103

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 39/59 (66%), Gaps = 5/59 (8%)

Query: 1139 GIQDQDPHLSSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEEDT 1197
            G  + +P  SS     + I G+DVM +YL QL H+TF+YAANILG + +D  +YDE++ 
Sbjct: 1098 GANNGNPRKSS----MKPIAGSDVMTRYLEQLHHNTFVYAANILGAT-QDPVFYDEDNA 1151

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (69%)

Query: 189 YKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLI 234
           Y +LP G+D YR+RSLLF+NV S +D+  F+    +   IESIYLI
Sbjct: 219 YSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLI 264

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 29/41 (70%)

Query: 252 RSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFV 292
           +S LLSF ++E CL FYNN+LQR  E K  ++S  L +NFV
Sbjct: 325 QSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFV 365

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  183 bits (465), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 93/204 (45%), Positives = 132/204 (64%), Gaps = 22/204 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRTIY+GNL    K E++CNVVRGG+LQSIKL+  + +CFVTFI+ +AA Q YA + +
Sbjct: 383 LGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASL 442

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             L +H    KIGWG +   LS ++ALAV+ GASRN+Y+   +F    K  ++ E+  F 
Sbjct: 443 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDF----KADSETEHPIF- 497

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
                 +EQ LR  F ++G +EQIN+L + +CC+VNF NI++AI  ++ + NNP+     
Sbjct: 498 ------TEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKNNPQ----- 546

Query: 905 KKFNHRYDGLIINYGKDRCGNVNR 928
                 +  L IN+GKDRCGNV R
Sbjct: 547 ------FSDLKINFGKDRCGNVPR 564

 Score =  102 bits (255), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 112/205 (54%), Gaps = 21/205 (10%)

Query: 727 NRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDP 786
           +RT+Y+GN+ P  +A  + + VR G+++ I+++  K   F++F++ S+A+ F++++ +  
Sbjct: 145 SRTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKR 204

Query: 787 LILHGNTLKIGWGNYYEPLSKSIALAVT-IGASRNVYVSL--PEFAFKDKFLNDPEYKEF 843
           L + G  +KIGWG    P+   +  AV   GA+RNVY+     + +F  +   DP     
Sbjct: 205 LNIDGRDIKIGWGK-PTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADP----- 258

Query: 844 HEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTF 903
             + ++ +EQ+LR D + YG IE +  +++    +V+F +I SAIK+V  +         
Sbjct: 259 --RDEVVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSL--------- 307

Query: 904 SKKFNHRYDGLIINYGKDRCGNVNR 928
               N  Y    I YGKDRC  + +
Sbjct: 308 -AAVNPYYANKKIFYGKDRCAFITK 331

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  182 bits (461), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 88/202 (43%), Positives = 130/202 (64%), Gaps = 22/202 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+GNL    K E++CNVVRGG+LQS+KL++ + +CFVTFI+ +AA QFYA S +
Sbjct: 445 LGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSSL 504

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             L +     K+GWG +  PL  ++ALAV+ GASRNVY+      F+   + DP      
Sbjct: 505 HGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDP------ 556

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
              ++ +E  LR  F +YG +EQIN+L + +CC++NF NI++AI  ++ + +NP      
Sbjct: 557 ---RIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKIKSNP------ 607

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 ++ L IN+GKDRCGNV
Sbjct: 608 -----HFEDLKINFGKDRCGNV 624

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 108/205 (52%), Gaps = 29/205 (14%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           RT+Y+GN+      +++ + VR G+++ +K+I  K   F++F++ S+A+ F++++ +  L
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 788 ILHGNTLKIGWGNYYEPLSKSIALAVTI---GASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
            + G  +KIGWG   +P +    ++  I    A+RNV++        +K  ND   KE  
Sbjct: 274 NIGGKDIKIGWG---KPTTVDPMISARIINDDATRNVFI-----GHLNKTDNDSCTKE-- 323

Query: 845 EKYKLP-SEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTF 903
                P +E +LR D   +G IE +  + +    +V+F +ITSAIK V ++         
Sbjct: 324 -----PITEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNL--------- 369

Query: 904 SKKFNHRYDGLIINYGKDRCGNVNR 928
            +  N  Y+   I YGKDRC  + +
Sbjct: 370 -RSMNPYYENKKIAYGKDRCAFITK 393

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  178 bits (451), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 127/204 (62%), Gaps = 22/204 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRTIY+GNL    K E++CN VRGG+LQ IKL++ + +CFVTFI+ +AA QFYA S +
Sbjct: 339 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSL 398

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             L +H    KIGWG +  PL   +ALAV+ GASRN+Y+   +FA   K           
Sbjct: 399 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFAADKK----------- 447

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
            ++ + +E  LR  F ++G +EQIN+L + +CC++NF NI+SAI  ++ + + P      
Sbjct: 448 SQHPIFTEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT----- 502

Query: 905 KKFNHRYDGLIINYGKDRCGNVNR 928
                 +  L IN+GKDRCGNV R
Sbjct: 503 ------FKDLKINFGKDRCGNVPR 520

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 120/230 (52%), Gaps = 35/230 (15%)

Query: 715 AQVASSMGVEMG------------NRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASK 762
           AQV+  M ++ G            +RT+Y+GN+ P    +++ + VR G+++ +K++  K
Sbjct: 78  AQVSHPMTLQSGQMNNPRDFTSAPSRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEK 137

Query: 763 RICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVT-IGASRNV 821
              F++F+E ++A+ F++++ +  L +    +KIGWG   + +   +A  +T  GA+RNV
Sbjct: 138 MCAFISFVEENSALLFHSDAILKRLNIDDRDIKIGWGKPTQ-IDPIVAAGITNDGATRNV 196

Query: 822 YVSLPEFAFKD---KFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCW 878
           Y+       KD   ++  DP         ++ +E++LR D + +G +E +  + +    +
Sbjct: 197 YIGKLN-TNKDICAQWGVDP-------NEEVITEEKLRNDLSDFGEVENVKIVPEKGIAF 248

Query: 879 VNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNR 928
           V+F +I +AIK+V ++ N           N  Y    I YGKDRC  + +
Sbjct: 249 VHFSSIFAAIKVVANLAN----------INPYYAQKKIFYGKDRCAFITK 288

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  180 bits (456), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 88/202 (43%), Positives = 131/202 (64%), Gaps = 22/202 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRTIY+GNL    + E++CNVVRGG+LQS+KL+  + +CFVTFI+ +AA QF+A S +
Sbjct: 496 LGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSL 555

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             L +     K+GWG +  PLS ++ALAV+ GASRN+Y+   +FA  DK  ++P +    
Sbjct: 556 HGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIF---- 610

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
                 +E  LR  F+ YG +EQIN+L + +CC++NF NI++AI  ++ + +NP      
Sbjct: 611 ------TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSNPV----- 659

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 +  L IN+GKDRCGN+
Sbjct: 660 ------FKDLKINFGKDRCGNI 675

 Score = 84.3 bits (207), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 127/283 (44%), Gaps = 56/283 (19%)

Query: 692 PTFNTDPTMYPIVRTLEDKFNTSA-----QVASSMGVEMGN---------RTIYIGNLNP 737
           P  +  P+M P V  +      +      ++ S+MG  + +         RT+Y+GN+  
Sbjct: 172 PMLSNMPSMVPTVENMVTATAAAVANANTRMQSTMGSRLNDPLDFTTAPSRTVYLGNIPS 231

Query: 738 RSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIG 797
               +++ + VR G+++ +K+I  K   F++F++ ++A+ F++++ +  L ++G  +KIG
Sbjct: 232 DLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAILKRLNINGKDIKIG 291

Query: 798 WGNYYEPLSKSIALAVTIGASRNVYVS-LPEFAF---KDKFLNDPEYK----------EF 843
           WG             +  GA+RNV++  L   +F   K K    P  +          E 
Sbjct: 292 WGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPSRNHDINATISNEN 351

Query: 844 HEK-----------------YKLP-SEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNIT 885
            EK                  + P S+ +LR D   +G I+ I  + D    +++F +IT
Sbjct: 352 DEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVEDKGIAFIHFASIT 411

Query: 886 SAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNR 928
           SAIK V ++N+           N  Y    I YGKDRC  + +
Sbjct: 412 SAIKCVHNLNS----------MNDYYSTKKIFYGKDRCAFITK 444

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  178 bits (451), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 128/204 (62%), Gaps = 22/204 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+GNL    K E++CN VRGG+LQS+KL++ + +CFVTFI+ +AA QFYA S +
Sbjct: 398 LGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 457

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             L +H    KIGWG +   L  ++ALAV+ GASRN+YV   +F   D      E  E  
Sbjct: 458 HGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAID------ETGE-- 509

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
               + +EQ LR  F ++G +EQIN+L + +CC++NF NI++AI  ++ +  NP      
Sbjct: 510 ---TIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKIKCNP------ 560

Query: 905 KKFNHRYDGLIINYGKDRCGNVNR 928
                 +  L +N+GKDRCGNV R
Sbjct: 561 -----YFKNLKVNFGKDRCGNVPR 579

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 113/207 (54%), Gaps = 25/207 (12%)

Query: 727 NRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDP 786
           +RT+Y+GN+ P   A+ + + VR G+++ +K++  +   F++F++ S+A+ F++++ +  
Sbjct: 160 SRTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKR 219

Query: 787 LILHGNTLKIGWGNYYEPLSKSIALAV-TIGASRNVYVSL----PEFAFKDKFLNDPEYK 841
           L + G  +K+GWG    P+   +A  + + GA+RNVY+      P+ A   +F  DP   
Sbjct: 220 LNIEGRDIKVGWGK-PTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDP--- 273

Query: 842 EFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDN 901
                 ++ SE++LR D N +G IE I  + D    +V+F +I SAIK+V ++       
Sbjct: 274 ----NEEIVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNL------- 322

Query: 902 TFSKKFNHRYDGLIINYGKDRCGNVNR 928
                 N  Y    I YGKDRC  + +
Sbjct: 323 ---ASVNPYYTNKKIFYGKDRCAFITK 346

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  177 bits (449), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 128/202 (63%), Gaps = 26/202 (12%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRTIY+GNL    K E++CNVVRGG+LQ+IKL++ +  CF+TFI+ +AA QFYA S +
Sbjct: 353 LGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSL 412

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             L +  N  K+GWG +  PLS ++ALA++ GASRN+Y+   +F  K+++ N        
Sbjct: 413 HGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFN-------- 464

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
                  E+ LR  F ++G +EQIN+L +  CC+VNF NI  AI  ++ + + P+     
Sbjct: 465 -------EEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKSLPE----- 512

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 ++ L IN+GKDRCGN+
Sbjct: 513 ------FEDLKINFGKDRCGNI 528

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 107/201 (53%), Gaps = 27/201 (13%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           RT+Y+GN+      +++ + VR G+++S+K++ +K   F++FI+   A+ F++++ +  L
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 788 ILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKY 847
            + G  +KIGWG      S   A     GA+RNVY+         +  +DP         
Sbjct: 188 NIRGKDIKIGWGKSNHIDSIVAARITNDGATRNVYIG--------QLNDDP--------- 230

Query: 848 KLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKF 907
            + +EQ+L  D  K+G I+ I +LS+    +V+F +I+ AI +V++++          K 
Sbjct: 231 TITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLS----------KL 280

Query: 908 NHRYDGLIINYGKDRCGNVNR 928
           N +Y    I YGKDRC  + +
Sbjct: 281 NEKYKNKRIFYGKDRCAFITK 301

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  180 bits (456), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 123/202 (60%), Gaps = 21/202 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+GNL    K +++CN VRGG+LQ IKL+  + +CFVTFI+ +AA QFYA S +
Sbjct: 525 LGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMSSL 584

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             L +     K+GWG +  PL   IALAV+ GASRNVY+   +F    K  N P + E  
Sbjct: 585 HGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIFTEL- 643

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
                     LR  F +YG +EQIN+L + +CC++NF NI++AI  +E + NNP      
Sbjct: 644 ---------SLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKIKNNPD----- 689

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 +  L IN+GKDRCGN+
Sbjct: 690 ------FKDLKINFGKDRCGNI 705

 Score = 94.0 bits (232), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 112/218 (51%), Gaps = 29/218 (13%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           RT+Y+GN+      +D+ + VR G++++IK++  K   F++F++ S+A+ F++++ +  L
Sbjct: 268 RTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDAILKRL 327

Query: 788 ILHGNTLKIGWGNYYEPLSKSIALA-VTIGASRNVYVS----------------LPEFAF 830
            + G  +KIGWG    P+   +A + VT GA+RNVY+                     + 
Sbjct: 328 NIGGRDIKIGWGK-PTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTSPSSP 386

Query: 831 KDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKL 890
            +   +D E K+  +   L +E++LR D   YG I+ +  + D    +V+  +I SAIK+
Sbjct: 387 SNNTSDDLEKKKNIDDSPL-TEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSAIKV 445

Query: 891 VEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNR 928
           V ++           + N  Y    I YGKDRC  + +
Sbjct: 446 VNNL----------AQTNPYYQNKRIFYGKDRCAFITK 473

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  177 bits (448), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 127/204 (62%), Gaps = 22/204 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRTIY+GNL    K E++CN VRGG+LQSIKL+  + +CFVTFI+ +AA Q YA + +
Sbjct: 385 LGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSL 444

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             L +H    KIGWG +   LS ++ALAV+ GASRN+Y+   +F   D   + P +    
Sbjct: 445 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSERDVPVF---- 499

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
                 +EQ LR  F +YG +EQIN+L +  CC+VNF NI++AI  ++ +          
Sbjct: 500 ------TEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKI---------- 543

Query: 905 KKFNHRYDGLIINYGKDRCGNVNR 928
            K N ++  L IN+GKDRCGNV R
Sbjct: 544 -KSNEQFKDLKINFGKDRCGNVPR 566

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 110/205 (53%), Gaps = 21/205 (10%)

Query: 727 NRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDP 786
           +RT+Y+GN+ P  +  ++ + VR G+++ ++++  K   F++F++ S+A+ F++++ +  
Sbjct: 147 SRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKR 206

Query: 787 LILHGNTLKIGWGNYYEPLSKSIALAVT-IGASRNVYVSL--PEFAFKDKFLNDPEYKEF 843
           L + G  +K+GWG    P+   +  AV+  GA+RNVY+     +     +F  DP     
Sbjct: 207 LNIGGRDIKVGWGK-PTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP----- 260

Query: 844 HEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTF 903
             +  + +E++LR D + YG IE +  + +    +V+F +I SAIK+V  +         
Sbjct: 261 --RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL--------- 309

Query: 904 SKKFNHRYDGLIINYGKDRCGNVNR 928
               N  Y    I YGKDRC  V +
Sbjct: 310 -ATVNPYYSNKKIFYGKDRCAFVTK 333

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  177 bits (448), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 126/207 (60%), Gaps = 22/207 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRTIY+GNL    K E++CN VRGG+LQ IKL+  + +CFVTFI+ +AA QFYA S +
Sbjct: 392 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 451

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             L +H    KIGWG +  PL   +ALAV+ GASRN+Y+   +F   D+ L  P +    
Sbjct: 452 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIF---- 506

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
                 +E  LR  F ++G +EQIN+L + +CC++NF NI+SAI  ++ + + P      
Sbjct: 507 ------TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT----- 555

Query: 905 KKFNHRYDGLIINYGKDRCGNVNRNLI 931
                 +  L IN+GKDRCGNV R   
Sbjct: 556 ------FKDLKINFGKDRCGNVPRQFC 576

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 109/209 (52%), Gaps = 29/209 (13%)

Query: 727 NRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDP 786
           +RT+Y+GN+ P     ++ + VR G+++ +K++  K   F++F++ ++A+ F++++ +  
Sbjct: 155 SRTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKR 214

Query: 787 LILHGNTLKIGWGNYYEPLSKSIALAVTI---GASRNVYVSL----PEFAFKDKFLNDPE 839
           L +    +KIGWG   +P      +A  I   GA+RNVY+      P+     ++  DP 
Sbjct: 215 LNIDDRDIKIGWG---KPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADPN 269

Query: 840 YKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPK 899
            +         +E++LR D   +G +E +  +++    +V+F +I SAIK+V ++ N   
Sbjct: 270 EETI-------TEEKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLAN--- 319

Query: 900 DNTFSKKFNHRYDGLIINYGKDRCGNVNR 928
                   N  Y    I YGKDRC  + +
Sbjct: 320 -------VNPYYAQKKIFYGKDRCAFITK 341

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  178 bits (451), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 128/204 (62%), Gaps = 22/204 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+GNL    K E++CN +RGG+LQ+IKL+  + +CFVTFI+ +AA QFYA S +
Sbjct: 469 LGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 528

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             L +H    KIGWG +  PL   IALAV+ GASRN+Y+          F  D + +E  
Sbjct: 529 HGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLG------NINFEEDAKQEE-- 580

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
               + +E  LR  F ++G +EQIN+L + +CC++NF NI++AI  ++ + +NP      
Sbjct: 581 ---SVFAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKSNP------ 631

Query: 905 KKFNHRYDGLIINYGKDRCGNVNR 928
                 ++ L IN+GKDRCGNV R
Sbjct: 632 -----HFNNLKINFGKDRCGNVPR 650

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 110/205 (53%), Gaps = 23/205 (11%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           RT+Y+GN+      + + + VR G+++ +K+++ K   FV+F++ + A+ F++++ +  L
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 788 ILHGNTLKIGWGNYYEPLSKSIALAVT-IGASRNVYVSLPEFAFKD---KFLNDPEYKEF 843
            + G  +KIGWG   +P+   +   +   GA+RNVY+       KD   K+  DP     
Sbjct: 293 NIDGRDIKIGWGK-PQPIDPIVRAGIANDGATRNVYIGKLN-TNKDSCEKWGADP----- 345

Query: 844 HEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTF 903
             K  L ++++L  D +++G IE I  + D    +V+F +I +AIK V ++ +   D  +
Sbjct: 346 --KEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANIGS--IDPYY 401

Query: 904 SKKFNHRYDGLIINYGKDRCGNVNR 928
           S K         + YGKDRC  + +
Sbjct: 402 SNK--------KVFYGKDRCAFITK 418

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  174 bits (440), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 125/206 (60%), Gaps = 22/206 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+GNL    K E++CN VR G+LQS+KL++ + +CFVTFI+ +AA QFYA S +
Sbjct: 406 LGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 465

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             LIL     K+GWG +  PL   IALAV+ GASRNVY+   +F    K           
Sbjct: 466 HGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFEEDSK----------- 514

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
              ++ +E  LR  F +YG +EQIN+L   +CC++N+ NI++AI  ++ + +NP      
Sbjct: 515 RNERVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIKSNP------ 568

Query: 905 KKFNHRYDGLIINYGKDRCGNVNRNL 930
                 +  L IN+GKDRCGN+   L
Sbjct: 569 -----YFKDLKINFGKDRCGNIPHQL 589

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 110/205 (53%), Gaps = 23/205 (11%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           RT+Y+GN+      +++ + VR G+++ +K++  K   F++F++ S+A+ F++++ +  L
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 788 ILHGNTLKIGWG--NYYEPLSKSIALAVTI-GASRNVYVS-LPEFAFKDKFLNDPEYKEF 843
            + G  +KIGWG     +P+   +A  +T  GA+RNVY+  L   A   + LN P+  E 
Sbjct: 229 NIEGRDIKIGWGKPTKIDPI---VANGITTDGATRNVYIGQLYTDAEVAESLNIPKESE- 284

Query: 844 HEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTF 903
                + +E++L  D   YG I+ +  + +    +++F +I SAIK+V ++         
Sbjct: 285 -----IVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNL--------- 330

Query: 904 SKKFNHRYDGLIINYGKDRCGNVNR 928
               N  Y    I YGKDRC  + +
Sbjct: 331 -AASNRYYQNRKIFYGKDRCAFITK 354

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  170 bits (431), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 119/202 (58%), Gaps = 24/202 (11%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRTIY+GNL+ R + E+VCNVVRGG+LQS+K +  + +CFVTF + +AA QFYA + +
Sbjct: 262 LGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMASL 321

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             L +     KIGWG +  PL   +A A++ GASRNVY       F +    DP   EF 
Sbjct: 322 HGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEFF 374

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
           E      E+ LR   + +G +EQ+N + +  C +VNF N+ SAI  VE V   P+     
Sbjct: 375 E------ERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQVKKWPQ----- 423

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 +  L +NYGKDRCGNV
Sbjct: 424 ------FQQLKVNYGKDRCGNV 439

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 100/207 (48%), Gaps = 40/207 (19%)

Query: 727 NRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDP 786
           +RT+Y+GN+ P     ++ + V+ G+++  +L  +K   FV+F++ ++A+ F++++ ++ 
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 787 LILHGNTLKIGW--GNYYEPLSKSIALAVTI---GASRNVYVSLPEFAFKDKFLNDPEYK 841
           L +    +KIGW      +PL     +A  I   GA+RNVY+            N P+  
Sbjct: 98  LRIGDRDVKIGWATATLMDPL-----VATRIQSEGATRNVYLG-----------NLPDGV 141

Query: 842 EFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDN 901
             +E  K         D + YG I+ +  LS     +V+  +I  AI  V ++    +DN
Sbjct: 142 SRYELTK---------DLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQ---RDN 189

Query: 902 TFSKKFNHRYDGLIINYGKDRCGNVNR 928
                    Y    +++GKDRC  V +
Sbjct: 190 KI-------YSDRRVSFGKDRCAYVTK 209

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  173 bits (439), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 123/202 (60%), Gaps = 22/202 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+GNL    K E++CN VRGG+LQSIKL+  + +CFVTFI+ +AA QFYA S +
Sbjct: 455 LGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSL 514

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
               +     K+GWG +  PL  ++ALAV+ GASRNVY+   +F    K           
Sbjct: 515 YGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSK----------- 563

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
           ++  + +E  LR  F +YG +EQIN+L +  CC++NF NI +AI  ++ + +NP      
Sbjct: 564 KEQPIFNETALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIKSNP------ 617

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 +  L IN+GKDRCGNV
Sbjct: 618 -----HFKSLKINFGKDRCGNV 634

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 110/204 (53%), Gaps = 27/204 (13%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           RT+Y+GN+ P    +++ + VR G+++  K++  K   F++F+E S+A+ F++++ +  L
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 788 ILHGNTLKIGWGNYYEP--LSKSIA-LAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
            +    +K+GWG   +P  L  SIA   +  GA+RNVY+            ND   KE  
Sbjct: 284 NIDNRDIKVGWG---KPTVLDPSIASRIINDGATRNVYIGQGN--------NDRSSKENK 332

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
           E     +E++LR D  +YG I+ I  + +    +V+F +I +AIK+V         +T +
Sbjct: 333 EPL---TEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVV---------STLA 380

Query: 905 KKFNHRYDGLIINYGKDRCGNVNR 928
           +K N  Y    I YGKDRC  + +
Sbjct: 381 QK-NPFYQEKKIFYGKDRCAFITK 403

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  171 bits (434), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 88/202 (43%), Positives = 127/202 (62%), Gaps = 22/202 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+G+L    K E++CN VRGG+LQSIKL+  + +CFVTFI+ +AA QFYA S +
Sbjct: 412 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 471

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
               +     K+GWG +  PL  ++ALAV+ GASRNVYV   +FA     LND       
Sbjct: 472 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA--SDSLNDE------ 523

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
              ++ +E  LR  F +YG +EQIN+L + +CC++N+ NI++AI  ++ + +NP      
Sbjct: 524 ---RIFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP------ 574

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 +  L IN+GKDRCGNV
Sbjct: 575 -----YFKDLKINFGKDRCGNV 591

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 103/201 (51%), Gaps = 25/201 (12%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           RT+Y+GN+ P    +++ + VR G+++ +K+I  K   F++F++ SAA+ F++++ +  L
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 788 ILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKY 847
            +    +KIGWG          A   T GA+RNVY+       ++  L            
Sbjct: 245 NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHL------------ 292

Query: 848 KLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKF 907
              SE+QLR D  +YG I+ I  + +    +++F +I +AIK+V ++   P  N +    
Sbjct: 293 ---SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNL---PIRNPY---- 342

Query: 908 NHRYDGLIINYGKDRCGNVNR 928
              Y    I YGKDRC  + +
Sbjct: 343 ---YQNKRIFYGKDRCAFITK 360

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  171 bits (433), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 126/202 (62%), Gaps = 22/202 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+G+L    K E++CN VRGG+LQSIKL+  + +CFVTFI+ +AA QFYA S +
Sbjct: 441 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 500

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
               +     K+GWG +  PL  ++ALAV+ GASRNVYV          F++D    E  
Sbjct: 501 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSDSLRDE-- 552

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
              ++ +E  LR  F +YG +EQIN+L + +CC+VN+ NI++AI  ++ + +NP      
Sbjct: 553 ---RIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIKSNP------ 603

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 +  L IN+GKDRCGNV
Sbjct: 604 -----YFKDLKINFGKDRCGNV 620

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 103/201 (51%), Gaps = 25/201 (12%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           RT+Y+GN+ P    +++ + VR G+++ +K+I+ K   F++F++ SAA+ F++++ +  L
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 788 ILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKY 847
            +    +KIGWG          A   T GA+RNVY+       ++  L            
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIDGEESHL------------ 321

Query: 848 KLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKF 907
              SE+QLR D  +YG I+ I  + +    +++F +I +AIK+   V N P  N +    
Sbjct: 322 ---SEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKV---VTNLPIRNPY---- 371

Query: 908 NHRYDGLIINYGKDRCGNVNR 928
              Y    I YGKDRC  + +
Sbjct: 372 ---YQNKRIFYGKDRCAFITK 389

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  170 bits (430), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 125/202 (61%), Gaps = 22/202 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+G+L    K E++CN VRGG+LQSIKL+  + +CFVTFI+ +AA QFYA S +
Sbjct: 428 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 487

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
               +     K+GWG +  PL  ++ALAV+ GASRNVYV          F+ D    E  
Sbjct: 488 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVGDSLRDE-- 539

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
              ++ +E  LR  F +YG +EQIN+L + +CC++N+ NI++AI  ++ + +NP      
Sbjct: 540 ---RVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP------ 590

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 +  L IN+GKDRCGNV
Sbjct: 591 -----YFKDLKINFGKDRCGNV 607

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 102/201 (50%), Gaps = 25/201 (12%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           RT+Y+GN+ P    +++ + VR G+++ +K+I  K   FV+FI+ SAA+ F++++ +  L
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 788 ILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKY 847
            +    +KIGWG          A   T GA+RNVY+       ++  L            
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 308

Query: 848 KLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKF 907
              SE+QLR D  +YG I+ I  + +    +++F +I +AIK+   V N P  N +    
Sbjct: 309 ---SEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKV---VTNLPIRNPY---- 358

Query: 908 NHRYDGLIINYGKDRCGNVNR 928
              Y    I YGKDRC  + +
Sbjct: 359 ---YQNKRIFYGKDRCAFITK 376

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  168 bits (426), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 123/202 (60%), Gaps = 22/202 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+GNL    + ED+CN +R G+LQ+IKL++ + +CFVTFI+  +A QFYA S I
Sbjct: 412 LGNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSI 471

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
              +L     K+GWG +  PLS  + LAV+ GASRNVY+   +F             +  
Sbjct: 472 YGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFT-----------ADGT 520

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
           ++ +  ++  LR  F++YG +EQIN+L   +CC+VN+ NI +AI  ++ + NNP      
Sbjct: 521 KRERYFTDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKNNPT----- 575

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 +  L IN+GKDRCGN+
Sbjct: 576 ------FKNLKINFGKDRCGNI 591

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 118/205 (57%), Gaps = 16/205 (7%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           RT+Y+GN+ P   A D+ + VR G+++ +K++  K   F++F++ ++++ F++++ +  L
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 788 ILHGNTLKIGWGNYYEPLSKSIALAV-TIGASRNVYVS-LPEFAFKDKFLNDPEYKEFHE 845
            + G  +KIGWG    PLS  IA +V T GA+RN+++  L       +  ND       +
Sbjct: 228 NIDGKDIKIGWGK-PSPLSPIIATSVATDGATRNIFIGQLNTTDHNKQKDNDATIYHGSD 286

Query: 846 KYK-LPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDV-NNNPKDNTF 903
            ++ + +E++LR D  +YG I+ I    +    +V+F +I SAIK+V ++ N+NP    +
Sbjct: 287 DFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSNP---YY 343

Query: 904 SKKFNHRYDGLIINYGKDRCGNVNR 928
           SKK         I YGKDRC  + +
Sbjct: 344 SKK--------KIYYGKDRCAFITK 360

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  169 bits (427), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 126/202 (62%), Gaps = 22/202 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+GNL    K E++CNVVRGG+LQ++K+++ + +CFVTFI+ +AA QFYA S +
Sbjct: 448 LGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSL 507

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             + +     ++GWG +   L  ++ALAV+ GASRNVYV    F  +D    DP +    
Sbjct: 508 HGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFD-EDSKREDPIF---- 562

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
                 +E  LR  F ++G +EQINYL + +CC+VN+ NI++AI  ++ +  +P      
Sbjct: 563 ------TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKGHPV----- 611

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 +  L IN+GKDRCGNV
Sbjct: 612 ------FKDLKINFGKDRCGNV 627

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 106/203 (52%), Gaps = 16/203 (7%)

Query: 727 NRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDP 786
           ++T+Y+GN       +++ + VR G+++ ++++  K   FV+F++ SAA+ F++++ +  
Sbjct: 209 SKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKR 268

Query: 787 LILHGNTLKIGWGNYYEPLSKSIALAVT-IGASRNVYVSLPEFAFKDKFLNDPEYKEFHE 845
           L + G  +KIGWG    P+   +A AV    A+RNVY+   +     K  +     +  E
Sbjct: 269 LHIDGRDIKIGWGK-PTPIDPVVATAVANDNATRNVYIG--QLNTGPKLSSQVSPVDVTE 325

Query: 846 KYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSK 905
              + +E +LR D  ++G I+ I  + +    +V+F +I +AIK V ++ N         
Sbjct: 326 --PVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLAN--------- 374

Query: 906 KFNHRYDGLIINYGKDRCGNVNR 928
             N  Y    I YGKDRC  + +
Sbjct: 375 -INPYYRNKKIFYGKDRCAFITK 396

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  168 bits (426), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 127/202 (62%), Gaps = 22/202 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+G+L    K E++CN VRGG+LQSIKL+  + +CFVTFI+ +AA QFYA S +
Sbjct: 430 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 489

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
               +     K+GWG +  PL  ++ALAV+ GASRNVYV          +++D    E  
Sbjct: 490 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDYVSDSVRDE-- 541

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
              ++ +E +LR  F +YG +EQIN+L + +CC++N+ NI++AI  ++ + +NP      
Sbjct: 542 ---RIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP------ 592

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 +  L IN+GKDRCGNV
Sbjct: 593 -----YFKDLKINFGKDRCGNV 609

 Score = 95.1 bits (235), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 101/201 (50%), Gaps = 25/201 (12%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           RT+Y+GN+ P    +++ + VR G+++ +K+I  K   F++F++ SAA+ F++++ +  L
Sbjct: 203 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 262

Query: 788 ILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKY 847
            +    +KIGWG          A   T GA+RNVY+       ++  L            
Sbjct: 263 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 310

Query: 848 KLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKF 907
              S +QLR D  +YG I+ I  + +    +++F +I +AIK+   V N P  N +    
Sbjct: 311 ---SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKV---VTNLPIRNLY---- 360

Query: 908 NHRYDGLIINYGKDRCGNVNR 928
              Y    I YGKDRC  + +
Sbjct: 361 ---YQNKRIFYGKDRCAFITK 378

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  166 bits (420), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 126/202 (62%), Gaps = 22/202 (10%)

Query: 725 MGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFI 784
           +GNRT+Y+GNL    K E++CNVVRGGILQ+IK+++ + +CFVTFI+  AA QFYA S +
Sbjct: 400 LGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSL 459

Query: 785 DPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFH 844
             + +     ++GWG +  PL  +IALAV+ GASRNVY+   +F ++D    +P +    
Sbjct: 460 HGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIF---- 514

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
                 +   LR  F +YG +EQ+N+L + +C +VN+ NI++AI  ++ + +NP      
Sbjct: 515 ------TADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSNP------ 562

Query: 905 KKFNHRYDGLIINYGKDRCGNV 926
                 +  L IN+GKDRCG +
Sbjct: 563 -----LFKNLKINFGKDRCGTI 579

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 117/223 (52%), Gaps = 23/223 (10%)

Query: 728 RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787
           +T+Y+GN+ P     ++ + VR G+++ +K++  K   F+TF++ SAA+ F++++ +  L
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 788 ILHGNTLKIGWGNYYEPLSKSIALAV-TIGASRNVYVSL--PEFAFKDKFLNDPEYKEFH 844
            + G  +KIGWG    P+   +  A+ + GA+RNVY+ L   +     +   DP  ++  
Sbjct: 223 HIDGRDIKIGWGK-ATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEKI- 280

Query: 845 EKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFS 904
                 +E++LR D  ++G I+ +  + +    +++F +I SA+K+V ++          
Sbjct: 281 ------TEEKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANL---------- 324

Query: 905 KKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSD 947
              N  Y+   I YGKDRC  + +      N+  Y  ++  +D
Sbjct: 325 AGINPYYENKKIYYGKDRCAFITKT--QQHNAAQYLGIQPGTD 365

>KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON}
           Anc_8.466 YDL209C
          Length = 330

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 6/74 (8%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNN----PKDNTFSKKF 907
           E +LRF FNK GPI++I Y+++ +C +V F N  +A    E + N     P D+ +  + 
Sbjct: 149 ESRLRFMFNKLGPIDKIRYVANKNCAFVKFRNARNAEFAKEAMTNQTMLLPNDDEWENRT 208

Query: 908 NHRYDGLIINYGKD 921
                GL++ +  D
Sbjct: 209 ES--TGLLVKWAND 220

>KLTH0E10868g Chr5 (975831..976856) [1026 bp, 341 aa] {ON} similar
           to uniprot|Q12046 Saccharomyces cerevisiae YDL209C
          Length = 341

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRY 911
           E +LRF F K GP+E+I Y+ + +C ++ + +  SA    E ++N        K++ +R 
Sbjct: 160 ENRLRFSFGKLGPLERIRYVENKNCAFIKYKHQASAEFAKETMSNQTLLTPSDKEWVNRR 219

Query: 912 D--GLIINYGKD 921
           +  GL++ +  D
Sbjct: 220 EGTGLLVKWAND 231

>Kwal_27.11730 s27 (922606..923715) [1110 bp, 369 aa] {ON} YDL209C
           (CWC2) - Protein required for cell viability [contig 27]
           FULL
          Length = 369

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNN----PKDNTFSKKF 907
           E +LRF F K GP+E+I Y+ + +C +V +    SA    E ++N     P D  +  + 
Sbjct: 190 ENRLRFTFGKLGPLERIRYVENKNCAFVKYKYQVSAEFAKETMSNQTLLIPSDKDWGDR- 248

Query: 908 NHRYDGLIINYGKD 921
                GL++ +  D
Sbjct: 249 -REGTGLLVKWAND 261

>TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.466
           YDL209C
          Length = 322

 Score = 39.3 bits (90), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRY 911
           E +LRF F++ G IE I Y+   +C +V +    +A    E ++N        KK++ R 
Sbjct: 155 EGRLRFAFSRLGEIETIRYIEAKNCAFVTYRFQANAEFAKEAMSNQTLLTPSDKKWDERK 214

Query: 912 D--GLIINYGKDRCGNVNRNLISNKNSRHYRKV 942
           D  GL++ +  D    + R     + +R   K+
Sbjct: 215 DGTGLLVKWANDDPDPIARERRDKEETRETLKI 247

>TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.104
           YBR212W
          Length = 608

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 51/102 (50%), Gaps = 11/102 (10%)

Query: 703 IVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVR--GGILQSIKLIA 760
            + T  +    SAQ    + ++  N T++IG L+  +   ++  +    G IL S+K+  
Sbjct: 317 FIPTSNNSLQQSAQNIDHVNLDNSNTTVFIGGLSTSTNEYELQVLFEPFGNIL-SVKIPI 375

Query: 761 SKRICFVTF---IEASAAVQFYANSFIDPLILHGNTLKIGWG 799
            K   FV F   IEA+AA++      +   I++GN +++ WG
Sbjct: 376 GKNCGFVKFKRKIEANAAIK-----GMQGFIINGNPIRLSWG 412

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 51/101 (50%), Gaps = 16/101 (15%)

Query: 708 EDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCN--VVRGGILQSIKLIASKR-- 763
           +DK +     A+  G E  +R +Y+GNL+ +S  ED+       GG +Q++K+I   +  
Sbjct: 38  DDKPSVVPASATKGGRETSDRVLYVGNLD-KSITEDLLKQYFQAGGPIQNVKIIEDMKNE 96

Query: 764 ---ICFVTFI---EASAAVQFYANSFIDPLILHGNTLKIGW 798
                FV +I   +A+ A+Q      ++ + L   TLKI W
Sbjct: 97  YVNYAFVEYIRSHDANVALQ-----TLNGVQLENKTLKINW 132

>Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON}
           YDL209C (REAL)
          Length = 348

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRY 911
           E ++RF F++ G I++I Y+ D  C +V F +  SA    E ++N        K+++ R 
Sbjct: 157 ESRVRFVFSRLGDIDRIRYVEDKSCAFVKFKHQASAEFAKEAMSNQTLLLHSDKEWDDRK 216

Query: 912 D--GLIINY 918
           +  GL++ +
Sbjct: 217 EGTGLLVKW 225

>TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON}
           Anc_1.102
          Length = 337

 Score = 35.8 bits (81), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 11/99 (11%)

Query: 693 TFNTDPT---MYPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVV- 748
           TF+ DP    ++  +R  E        V   +G++   R ++I  LNP +KA+D+  +  
Sbjct: 215 TFHLDPEKQEIHSYIRRKELSLEIMGDVPG-VGIKPSERVLFICRLNPSTKAKDIATIFH 273

Query: 749 RGGILQSIKLIASKR----IC--FVTFIEASAAVQFYAN 781
           R G + S++++  K     +C  F+ F +  A    Y N
Sbjct: 274 RFGEVHSVEIVRDKESGRSLCYGFIEFNDRKACESAYKN 312

>KLLA0E07107g Chr5 complement(647517..648884) [1368 bp, 455 aa] {ON}
           similar to uniprot|Q75AV3 Ashbya gossypii ADL183C
           ADL183Cp and weakly similar to YOL136C uniprot|Q12471
           Saccharomyces cerevisiae YOL136C PFK27
           6-phosphofructo-2- kinase has negligible fructose-2
           6-bisphosphatase activity inhibited by
           phosphoenolpyruvate and sn-glycerol 3- phosphate
           expression induced by glucose and sucrose
           transcriptional regulation involves protein kinase A
          Length = 455

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 6/82 (7%)

Query: 2   KSYQQQQQENPYPRYNKSFSRRGSSYYMNVQQDQRSRKPSYIS----LNHSVHNPN--MV 55
           K++ Q   + PY    K F++R   Y+    Q  RS    Y      +N   HNPN  + 
Sbjct: 292 KTFNQDYYDKPYEFAVKDFAKRLQQYHSQFVQFSRSEFDHYCKENARVNEGSHNPNFGLF 351

Query: 56  YQHDPNGSQYFATTQQAYYIPS 77
           + H  N  Q+ A     YY PS
Sbjct: 352 FFHIMNAGQFSADDSNMYYFPS 373

>NCAS0I00990 Chr9 complement(178176..179043,179119..179153) [903 bp,
           300 aa] {ON} Anc_3.379 YBR119W
          Length = 300

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 6/78 (7%)

Query: 735 LNPRSKAEDVCNVVRGGILQSIKLIASKRI---CFVTFIEASAAVQFYANSFIDPLILHG 791
           ++P S+++++ +  + GIL SI L    ++   CF+TF + S A++F  N +   L ++G
Sbjct: 55  ISPTSESDEILDE-KNGIL-SISLSCKAKLSNQCFITFNDHSHAMEF-MNEYNSKLKVNG 111

Query: 792 NTLKIGWGNYYEPLSKSI 809
           N ++I W      LS S+
Sbjct: 112 NVVEIQWAKKESLLSLSL 129

>KNAG0A02400 Chr1 complement(236366..237271) [906 bp, 301 aa] {ON}
           Anc_8.466 YDL209C
          Length = 301

 Score = 35.0 bits (79), Expect = 1.00,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 43/97 (44%), Gaps = 11/97 (11%)

Query: 817 ASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHC 876
           A+R +Y+     A  DK L             L  E +LR+ FNK G +++I Y+   +C
Sbjct: 134 ANRTLYIGGIAGALNDKPLK-----------PLQIESRLRYLFNKLGALDRIRYVEAKNC 182

Query: 877 CWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDG 913
            +V F +  +A    E + N        K++  R +G
Sbjct: 183 AFVTFKSTANAEFAKEAMTNQTLLVPTDKEYPQRLEG 219

>Kpol_1031.63 s1031 (159123..160157) [1035 bp, 344 aa] {ON}
           (159123..160157) [1035 nt, 345 aa]
          Length = 344

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 10/76 (13%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNN----PKDNTFSKKF 907
           E +LRF F + G IE+I Y+   +C +V+F    +A    E ++N     P D    K++
Sbjct: 162 ESRLRFMFGRLGEIERIRYVESKNCAFVSFRFQCNAEFAKEAMSNQTLLIPSD----KEW 217

Query: 908 NHRYD--GLIINYGKD 921
           + R +  GL++ +  D
Sbjct: 218 DARKEGTGLLVKWAND 233

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 70/158 (44%), Gaps = 13/158 (8%)

Query: 717 VASSMGVEMGNRTIYIGNLNPRSKAEDVCN--VVRGGILQSIKLIASK--RIC---FVTF 769
           +A+  G E  ++ +Y+GNL P+S  +D+       GG + S+K+I  K  + C   FV +
Sbjct: 86  LATQGGREKSDKILYVGNL-PKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEY 144

Query: 770 IEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFA 829
            E   A   Y    ++   + G  LKI W    + ++      + +G   ++ V + +  
Sbjct: 145 FEPHDANVAYQT--LNGKEVEGKVLKINWAFQSQQVNSDETFNLFVG---DLNVDVDDAT 199

Query: 830 FKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQ 867
               F   P + + H  + + S +   + F  +G  +Q
Sbjct: 200 LAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQ 237

>SAKL0H12012g Chr8 complement(1027110..1028144) [1035 bp, 344 aa]
           {ON} similar to uniprot|Q12046 Saccharomyces cerevisiae
           YDL209C
          Length = 344

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNN----PKDNTFSKKF 907
           E ++RF F K+G I+++ ++   +C +V F +  +A    E ++N     P D  + +K 
Sbjct: 163 ESRIRFTFGKFGSIDRVRFVESKNCGFVTFKHSVNAEFAKEAMSNQTLLIPSDKEWDQK- 221

Query: 908 NHRYDGLIINYGKD 921
                G+++ +  D
Sbjct: 222 -REGTGVLVKWAND 234

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 727 NRTIYIGNLNPRSKAEDVCNVVRG-GILQSIKLIASKRICFVTF---IEASAAVQFYANS 782
           N T+++GNLN +   +++  V    G ++ +K+   K+  FV F   I+A A++      
Sbjct: 321 NTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGLQGY 380

Query: 783 FIDPLILHGNTLKIGW 798
           F+      G+ ++I W
Sbjct: 381 FV-----AGSPIRISW 391

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 87/221 (39%), Gaps = 39/221 (17%)

Query: 723 VEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKL-IASKRI-----CFVTFIEASAAV 776
           ++   R I I N+   +    V + V GG L++I    A K I       ++F+ A AA 
Sbjct: 162 LDTSKRNIVIKNIPSGTGLASVMSQVCGGPLENISFQTAEKSINILENVRLSFLTADAAD 221

Query: 777 QFYANSFIDPLILHGNTLKIGWG--------NYYEPLSKSIALAVTIGASRNVYVSLPEF 828
            F   S      ++G  L   W         N Y  L K  A       S N+  SL   
Sbjct: 222 AFMNYSKTRLFKVNGFNLITEWAPLKQQPINNIYSGLEKQQA-----QFSTNICRSLIMK 276

Query: 829 AFKDKFLNDPEYKEFHEKYKLPSEQQLRFD-------FNKYGPIEQIN-YLSDSHCCWVN 880
            +       P+ KE  +  K        FD       F ++G I+++   +S   C  VN
Sbjct: 277 KY-------PQKKEIKKYCKWMENTMDDFDPSIIVEDFGQFGRIQEVTPIISRKLCVAVN 329

Query: 881 FMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKD 921
           + NI SA+K +E   +   ++   +K+   Y    I +GKD
Sbjct: 330 YYNILSALKAIESYED--PNSELHRKY---YKSWAIWFGKD 365

>Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON}
           (37962..39248) [1287 nt, 429 aa]
          Length = 428

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 905 KKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQEK 957
           K     Y  L+   G+ + GN    LIS  NS  Y K+KK    Y+L  LQE+
Sbjct: 17  KPLMKSYGSLLAQLGQQQSGN---GLISGNNSDVYLKLKKLEKEYELLTLQEE 66

>KAFR0A06940 Chr1 complement(1399604..1401007) [1404 bp, 467 aa]
           {ON} Anc_2.368 YDL089W
          Length = 467

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 12/94 (12%)

Query: 782 SFIDPLILHGNTLKIGWGNYYEPL---SKSIALAVTIGASRNVYVSLPEFAFKDKFLNDP 838
           S+ID +++  + L +    Y+E +   SK+++LA  +G        +  F  +D F+ + 
Sbjct: 36  SWIDRILVSPSDLHLSMNEYFESIDWDSKAVSLAEPLGNILTFCFYVIRFI-QDNFIRNN 94

Query: 839 EYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLS 872
           +Y        + S  Q  FDF+K G + Q NYLS
Sbjct: 95  DY--------VKSSIQDSFDFSKSGKLNQYNYLS 120

>NCAS0C02560 Chr3 complement(481562..482515) [954 bp, 317 aa] {ON}
           Anc_8.466 YDL209C
          Length = 317

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881
           E ++RF F K G +E + Y++D +C +V +
Sbjct: 159 ESRIRFTFGKLGDVESVRYIADKNCAFVKY 188

>Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON}
           YDL209C (REAL)
          Length = 343

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRY 911
           E ++RF F++ G I++I Y+ D +C +V F    +A    E ++N        K+++ R 
Sbjct: 157 ESRIRFVFSRLGDIDRIRYVEDKNCAFVKFKYQANAEFAKESMSNQTLLLPSDKEWDGRR 216

Query: 912 D--GLIINY 918
           +  GL++ +
Sbjct: 217 EGTGLLVKW 225

>Smik_4.31 Chr4 complement(64414..65439) [1026 bp, 341 aa] {ON}
           YDL209C (REAL)
          Length = 341

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 21/30 (70%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881
           E ++RF F++ G I++I Y+ D +C +V F
Sbjct: 157 ESRIRFVFSRLGAIDRIRYVEDKNCAFVKF 186

>TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON}
           Anc_8.466 YDL209C
          Length = 306

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNN-----PKDNTFSKK 906
           E +LR+ F++ G ++++ YL + +C ++ F N  +A +  ++V +N     P D  + ++
Sbjct: 161 ESRLRYMFSRLGLLDRLRYLENKNCAFIKFKNQCNA-EFAKEVMSNQTLLIPSDKEWDER 219

Query: 907 FNHRYDGLIINYGKD 921
             +   GL++ +  D
Sbjct: 220 --NEGTGLLVKWAND 232

>TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {ON}
           Anc_8.229 YER165W
          Length = 579

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 76/183 (41%), Gaps = 37/183 (20%)

Query: 726 GNRTIYIGNLNPR--SKAEDVCNVVRGGILQSIKLIA-----SKRICFVTFIEASAAVQF 778
           G   I+I NL+P   +KA      V G IL S K+       SK   FV F E +AAV+ 
Sbjct: 136 GAGNIFIKNLHPDIDNKALHDTFSVFGNIL-SCKIATDETGKSKGFGFVHFEEDNAAVE- 193

Query: 779 YANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDP 838
            A   I+ ++L+G  + +    +     +   L        NVYV       K+  ++ P
Sbjct: 194 -AVDAINGMMLNGREVYVA--QHVSKKDRESKLEEVKANFTNVYV-------KNVDVDTP 243

Query: 839 EYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHC-----CWVNFMNITSAIKLVED 893
           E              +    F+KYGPI  I    DS        ++NF N   A K VE+
Sbjct: 244 E-------------DEFTALFSKYGPITSIAMEKDSEGKFRGFGFINFENHDDAAKAVEE 290

Query: 894 VNN 896
           +N+
Sbjct: 291 LND 293

>ZYRO0A02970g Chr1 complement(242160..243149) [990 bp, 329 aa] {ON}
           similar to uniprot|Q12046 Saccharomyces cerevisiae
           YDL209C CWC2 Protein involved in pre-mRNA splicing
          Length = 329

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 852 EQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNN----PKDNTFSKKF 907
           E ++RF F++ G I++++YL   +C ++ F    +A    E V N     P D  + ++ 
Sbjct: 158 ENRIRFLFSELGEIDKLHYLESKNCAFIKFKRQCNAEFAKEVVANQSLLIPSDREWEERL 217

Query: 908 NHRYDGLIINYGKD 921
             +  GL + +  D
Sbjct: 218 --QLTGLQVKWAHD 229

>ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 32.7 bits (73), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/96 (20%), Positives = 47/96 (48%), Gaps = 9/96 (9%)

Query: 721 MGVEMGNRTIYIGNLNPRSKAEDVCNVV-RGGILQSIKLIASKRI------CFVTFIEAS 773
           MG++   R ++I  LNP ++A+D+  +  R G + S++++  K         F+ F +  
Sbjct: 235 MGIKPSPRVLFICKLNPLTRAKDIATIFQRFGAIASVEIVRDKSTGHSLGYGFIQFTDRK 294

Query: 774 AAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSI 809
           +  Q Y    ++ +I+    + + +    +  +K+I
Sbjct: 295 SCEQAYKK--MEGVIIDDRRIHVDFSQSVKAATKAI 328

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 42/84 (50%), Gaps = 9/84 (10%)

Query: 720 SMGVEMGNRTIYIGNLNPRSKAEDVCNVVRG-GILQSIKLIASKRICFVTF---IEASAA 775
           +M   + + T+++G LNP      +  + +  G +  +K+   K+  FV +   +EA AA
Sbjct: 437 AMNAGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAA 496

Query: 776 VQFYANSFIDPLILHGNTLKIGWG 799
           +     + +   I+ G+ +++ WG
Sbjct: 497 I-----NGLQGFIIMGSPIRLSWG 515

>KLTH0F02992g Chr6 complement(256926..258650) [1725 bp, 574 aa] {ON}
           similar to uniprot|P53617 Saccharomyces cerevisiae
           YNL251C NRD1 RNA-binding protein that interacts with the
           C- terminal domain of the RNA polymerase II large
           subunit (Rpo21p) required for transcription termination
           and 3' end maturation of nonpolyadenylated RNAs
          Length = 574

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 723 VEMGNRTIYIGNLNPRSKAEDVCNVVRG-GILQSIKLIASKRICFV 767
           +++ +RT+++G + P  K  D+ +V+R  G +QS+ L +S++  FV
Sbjct: 322 IKVFSRTLFVGGVPPSMKEYDIAHVLRPYGEVQSVILNSSRKHAFV 367

>Smik_6.440 Chr6 complement(719661..721076) [1416 bp, 471 aa] {ON}
           YPL235W (REAL)
          Length = 471

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%)

Query: 665 NNYNTEAKEVKEQNKGERNEGIFFVEQPTFNTDPTMYPIVRTLEDKFNTSAQVASSMGVE 724
           +  NT+  E KE+ K E   G+ F+++           I R LED+F     +A++ GV 
Sbjct: 271 DQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVS 330

Query: 725 MGNRTIY 731
               T Y
Sbjct: 331 KTRGTTY 337

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 128,477,904
Number of extensions: 5961552
Number of successful extensions: 20528
Number of sequences better than 10.0: 199
Number of HSP's gapped: 21107
Number of HSP's successfully gapped: 281
Length of query: 1198
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1077
Effective length of database: 39,606,813
Effective search space: 42656537601
Effective search space used: 42656537601
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)