Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E002608.850ON49849822520.0
ZYRO0C14872g8.850ON49644712301e-165
NCAS0B002708.850ON47646812221e-164
YMR285C (NGL2)8.850ON51544912101e-162
TDEL0B001908.850ON49244712071e-162
Suva_13.4758.850ON51544911991e-160
SAKL0D01166g8.850ON50544811981e-160
TBLA0B029008.850ON52044911951e-159
Smik_13.5018.850ON51545011841e-158
Skud_13.4588.850ON51445011781e-157
TPHA0I003208.850ON52945111771e-157
CAGL0I02684g8.850ON49344911691e-156
NCAS0C003108.850ON55645111581e-153
KLTH0C03608g8.850ON49544711451e-152
Kpol_237.18.850ON50344911401e-151
KAFR0L019608.850ON51147611341e-150
NDAI0K003708.850ON56844511321e-149
KNAG0K006508.850ON48245311201e-149
Kwal_27.102048.850ON49444611171e-148
KLLA0C06248g8.850ON51647910801e-142
ABL118W8.850ON50444010791e-142
Ecym_46198.850ON48744610651e-140
TBLA0D033008.850ON48045910271e-135
Suva_13.258.850ON5024469481e-122
Smik_13.168.850ON5024519311e-120
KAFR0A028608.850ON4784439111e-117
YML118W (NGL3)8.850ON5054518931e-114
CAGL0B02387g8.850ON4714438851e-113
Skud_13.238.850ON4984508841e-113
KNAG0G034708.850ON4664508641e-110
KLLA0F15884g7.78ON7902351689e-12
ACR288W7.78ON7362171689e-12
Skud_1.407.78ON8692381671e-11
YAL021C (CCR4)7.78ON8372361634e-11
ZYRO0D05302g7.78ON8572201625e-11
Suva_1.457.78ON8312361572e-10
KAFR0K006707.78ON7952301544e-10
Kwal_26.71127.78ON7422311545e-10
Ecym_73547.78ON7852211545e-10
KNAG0D048407.78ON7792271536e-10
Smik_1.457.78ON8392361528e-10
SAKL0B10032g7.78ON7312311501e-09
TDEL0H037307.78ON7972371492e-09
KLTH0D02310g7.78ON7392321464e-09
NDAI0H025207.78ON8982351456e-09
TPHA0H026807.78ON8722451421e-08
Kpol_1040.147.78ON7842231402e-08
NCAS0F016407.78ON8552201295e-07
TBLA0A046607.78ON8962251261e-06
CAGL0H06149g7.78ON8732341242e-06
ZYRO0D05588g7.90ON3562601081e-04
TDEL0H036007.90ON3662381062e-04
KAFR0D012507.90ON356225990.001
KNAG0L005507.90ON381247980.002
NCAS0I005007.90ON389231940.006
CAGL0F01001g7.90ON359234930.008
SAKL0B09768g7.90ON368246910.012
KLLA0F07733g7.90ON371233910.013
YOL042W (NGL1)7.90ON363235890.021
Smik_15.1257.90ON363235890.027
Suva_15.1277.90ON363235880.032
KLTH0D02574g7.90ON368255850.069
TBLA0E022607.90ON388230850.072
Kpol_1044.67.90ON372236820.17
Skud_15.1157.90ON363235800.31
NDAI0A085307.90ON365227741.4
Ecym_26367.90ON36780732.2
Kwal_26.71707.90ON372117732.3
ADR400W7.21ON79667723.1
Suva_16.1978.601ON40048723.2
ACR277C7.90ON378118687.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E00260
         (498 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   872   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   478   e-165
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      475   e-164
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   470   e-162
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   469   e-162
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   466   e-160
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   466   e-160
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   464   e-159
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   460   e-158
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   458   e-157
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   457   e-157
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   454   e-156
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      450   e-153
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   445   e-152
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   443   e-151
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   441   e-150
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   440   e-149
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   436   e-149
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   434   e-148
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   420   e-142
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   420   e-142
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   414   e-140
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   400   e-135
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   369   e-122
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   363   e-120
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   355   e-117
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   348   e-114
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   345   e-113
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   345   e-113
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   337   e-110
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    69   9e-12
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    69   9e-12
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    69   1e-11
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    67   4e-11
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    67   5e-11
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    65   2e-10
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    64   4e-10
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    64   5e-10
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    64   5e-10
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    64   6e-10
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    63   8e-10
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    62   1e-09
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    62   2e-09
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    61   4e-09
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      60   6e-09
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    59   1e-08
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    59   2e-08
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      54   5e-07
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    53   1e-06
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    52   2e-06
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    46   1e-04
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    45   2e-04
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    43   0.001
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    42   0.002
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    41   0.006
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    40   0.008
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    40   0.012
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    40   0.013
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    39   0.021
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    39   0.027
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    39   0.032
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    37   0.069
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    37   0.072
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    36   0.17 
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    35   0.31 
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    33   1.4  
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    33   2.2  
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    33   2.3  
ADR400W Chr4 (1423238..1425628) [2391 bp, 796 aa] {ON} Syntenic ...    32   3.1  
Suva_16.197 Chr16 complement(346987..348189) [1203 bp, 400 aa] {...    32   3.2  
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    31   7.4  

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/498 (85%), Positives = 425/498 (85%)

Query: 1   MISDSANDNAEPHQTXXXXXXXXXXXXXXXXXXLNTEYITXXXXXXXXXXXXXXXXXXXH 60
           MISDSANDNAEPHQT                  LNTEYIT                   H
Sbjct: 1   MISDSANDNAEPHQTQQNNQKKRNQKMNKKRMMLNTEYITKIRAEREKKRELEREYRMKH 60

Query: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120
           GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR
Sbjct: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120

Query: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180
           RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR
Sbjct: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180

Query: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFW 240
           NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFW
Sbjct: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFW 240

Query: 241 HLFGTFERTRQCYVMMDQMDKFMKKLGGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQ 300
           HLFGTFERTRQCYVMMDQMDKFMKKLGGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQ
Sbjct: 241 HLFGTFERTRQCYVMMDQMDKFMKKLGGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQ 300

Query: 301 NETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXPNQPSN 360
           NETKIVIECSAAYKYS                QH                    PNQPSN
Sbjct: 301 NETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQHEIDSSDSSDAETDEEKEEIIPNQPSN 360

Query: 361 ARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINNDRGEPELSEW 420
           ARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINNDRGEPELSEW
Sbjct: 361 ARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINNDRGEPELSEW 420

Query: 421 ARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAIPYK 480
           ARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAIPYK
Sbjct: 421 ARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAIPYK 480

Query: 481 GEYPSDHLCMMIQLELLE 498
           GEYPSDHLCMMIQLELLE
Sbjct: 481 GEYPSDHLCMMIQLELLE 498

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  478 bits (1230), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 227/447 (50%), Positives = 304/447 (68%), Gaps = 27/447 (6%)

Query: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120
           G +PD P ELQFIKRP+L LH  + V+G   K+MTYNCLAQ+LI+R LFP SG ALKW R
Sbjct: 66  GIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALKWYR 125

Query: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180
           RSKVLLNE KYY++D++ LQEID++Q++ +WK  LAKLGYD +F+++  K HGV I WKR
Sbjct: 126 RSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKR 185

Query: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK--DKSAIKKKGVIIGTTHL 238
             F     + IDFD   SG I PRT T N GL+++L+F +K   +  +KK G+I+GTTHL
Sbjct: 186 EYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHL 245

Query: 239 FWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDAPYV 290
           FWH FGTFERTRQCYV+++++ +F  ++        G    WYPFF GDFNSQP D+PY+
Sbjct: 246 FWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYL 305

Query: 291 SITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXX 350
           S+T KP+ +    K VIECS +Y +S                                  
Sbjct: 306 SMTRKPIEYSKRAKTVIECSTSYTFSKMRDGEEDDAEEEEGGN----------------I 349

Query: 351 XXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINN 410
                +QP +  P H+     + ELV Q+ +LHNSL++RA+SLYSV YRKV PENA ++N
Sbjct: 350 EKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDN 409

Query: 411 DRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSK 470
           +RGEPE+S WA  W GLLDY+FF++HWD  ++ +++DSL++FEREN++K+RGLL++P  K
Sbjct: 410 ERGEPEISNWAHTWRGLLDYLFFIRHWDF-SDCKEIDSLESFERENSLKIRGLLRVPPGK 468

Query: 471 EMCEHAIPYKGEYPSDHLCMMIQLELL 497
           EM EH  P+ GEYPSDHLCM+ +LEL+
Sbjct: 469 EMTEHGQPHTGEYPSDHLCMLCELELV 495

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  475 bits (1222), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 231/468 (49%), Positives = 306/468 (65%), Gaps = 22/468 (4%)

Query: 37  EYITXXXXXXXXXXXXXXXXXXXHGFEPDIPSELQFIKRPLLTLHDDDPVKGTM---LKI 93
           EYI+                    G +PDIP ELQF +RP LTLHD++P  G       I
Sbjct: 21  EYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSI 80

Query: 94  MTYNCLAQSLIQRDLFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKI 153
           +TYNCLAQ LI RD+FP SG ALKW RRSK ++NELKYY+ D++ LQEIDF   K++W +
Sbjct: 81  LTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSV 140

Query: 154 VLAKLGYDCEFYKKNGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLV 213
               LGY  +F+KK  KIHGV+IAW+ ++F       +DFDE L+G I PRT+T+N+GL+
Sbjct: 141 QFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLI 200

Query: 214 IALEFL--NKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL---GG 268
           +AL+FL  N +  + +  G+++ TTHLFWH FGTFERTRQCY+M+ +M+KF+  L    G
Sbjct: 201 VALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLNEHSG 260

Query: 269 IEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXX 328
           I  WYPF TGDFNSQPKDAPY+S+T+KP+ + +E + VIECS +Y YS            
Sbjct: 261 ITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYS------------ 308

Query: 329 XXXXQHXXXXXXXXXXXXXXXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNL 388
               ++                      QP++ RP  F PT+EQA LV+ +  LHNSL  
Sbjct: 309 --KKRNGDMDVNEKEQSDSEEDEEFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPF 366

Query: 389 RAISLYSVGYRKVDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDS 448
           RAISLYSVGYR V PEN++INN RGEPE S W   WSGLLDYIF+++ W+ K  ++ V++
Sbjct: 367 RAISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVET 426

Query: 449 LKTFERENNVKLRGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496
           L+TFE+ N +K+ G LK+P  KEM  H+ PY+GEYPSDHL +M +L+L
Sbjct: 427 LETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  470 bits (1210), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 227/449 (50%), Positives = 298/449 (66%), Gaps = 30/449 (6%)

Query: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120
           G +PD P EL FI+RP L+LH+ +PV G   K+MTYNCLAQ+LI+R LFP SG ALKW R
Sbjct: 82  GVDPDCPPELHFIRRPFLSLHEAEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWYR 141

Query: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180
           RSKVLLNE KYY+SD++ LQEID +QF+ +WK   +KLGYD ++Y+   K HGV I W+R
Sbjct: 142 RSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEFSKLGYDGQYYRNATKNHGVAIMWRR 201

Query: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK-----DKSAIKKKGVIIGT 235
            LF +V  + ID+D+  S +I  RT T NVGLV+AL+F  K      K + KK G++IGT
Sbjct: 202 ELFHQVDKMLIDYDKESSESISTRTTTNNVGLVLALKFSEKVLSNLGKKSSKKCGILIGT 261

Query: 236 THLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDA 287
           THLFWH FGT+ERTRQCY+++ +M +FM ++        G +  W+PFF GDFNSQP D 
Sbjct: 262 THLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDT 321

Query: 288 PYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXX 347
           PY+S+TSKPV ++N  K VI CS +YK+S                               
Sbjct: 322 PYLSMTSKPVHYRNRAKTVIGCSTSYKFSK-----------------VRDGEEGADDEEG 364

Query: 348 XXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAY 407
                   +QP +  P  F    EQ+ELV ++A LHNSL++RAISLYSVGY+ V PENA 
Sbjct: 365 GNIEKYGKDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYKNVHPENAG 424

Query: 408 INNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMP 467
           ++NDRGEPE+S WA  W GLLDY+F+++ WD ++N ++V++L  FE+EN VK RG L+MP
Sbjct: 425 LDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVKCRGFLRMP 484

Query: 468 QSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496
              EM +H  P+ GEY SDHL M+  LEL
Sbjct: 485 PGNEMTKHGQPHVGEYASDHLSMVCDLEL 513

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  469 bits (1207), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 227/447 (50%), Positives = 302/447 (67%), Gaps = 29/447 (6%)

Query: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120
           G +PD P ELQFIKRPLLTLH+D+P++G   K++TYNCLAQ+LI+R LFP SG +LKW R
Sbjct: 62  GMDPDHPPELQFIKRPLLTLHEDEPIEGLSFKLLTYNCLAQALIRRKLFPDSGDSLKWFR 121

Query: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180
           RSKVL  E K+Y++D+L LQEID++Q++Q+WK  L KLGYD +FYK+  K HGV IAWKR
Sbjct: 122 RSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKDELDKLGYDTQFYKQPCKNHGVSIAWKR 181

Query: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSA---IKKKGVIIGTTH 237
           +LF     + ID+D+  SG I+ RT T N GL++AL+F +  K +   I+K G+++GT+H
Sbjct: 182 HLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLILALKFTDAAKQSCPHIRKSGILVGTSH 241

Query: 238 LFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDAPY 289
           LFWH FGT+ERTRQCYV++ +M +FMK++        G +  W PFF GDFNSQP D PY
Sbjct: 242 LFWHPFGTYERTRQCYVVLKKMKEFMKRVNVLQNNNDGNLSHWVPFFCGDFNSQPFDTPY 301

Query: 290 VSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXX 349
           +S+TSKPV +    K V+ECS +Y +S                                 
Sbjct: 302 LSMTSKPVEYTGRAKTVVECSTSYTFSK-----------------LRNGEEDAEDEEGGN 344

Query: 350 XXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYIN 409
                 +QP    P  F  T EQ +LV ++  LHNS+++RAISLY+VGY +V PEN+ I+
Sbjct: 345 IEKFGKDQPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVGYGEVHPENSGID 404

Query: 410 NDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQS 469
           NDRGEPE+S WA  W GLLDYI  +  WD  ++ +KVDSL+TFE+EN++KLRGLL+MP +
Sbjct: 405 NDRGEPEMSNWANTWRGLLDYILLITQWDS-SDRKKVDSLETFEKENSLKLRGLLRMPPA 463

Query: 470 KEMCEHAIPYKGEYPSDHLCMMIQLEL 496
            EM  H  P++GEY SDHL MM  +EL
Sbjct: 464 SEMSHHGQPHEGEYASDHLSMMCTIEL 490

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  466 bits (1199), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 217/449 (48%), Positives = 301/449 (67%), Gaps = 30/449 (6%)

Query: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120
           G +PD P EL FIKRP L+LH+++PV G   K+MTYNCLAQ+LI+R LFP SG ALKW R
Sbjct: 82  GIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWYR 141

Query: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180
           RS+VLLNE ++Y++D++ LQEID +QF+ +WK   +KLGY+ ++++ + K HGV I W+R
Sbjct: 142 RSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRR 201

Query: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK-----DKSAIKKKGVIIGT 235
           ++F +V  + IDFD+ +SG I  RT T NVGLV+AL+F  K      K++ KK G++IGT
Sbjct: 202 DMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGT 261

Query: 236 THLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDA 287
           +HLFWH FGT+ERTRQCY+++ +M++FM ++        G +  W+PFF GDFNSQP D 
Sbjct: 262 SHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDT 321

Query: 288 PYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXX 347
           PY+S+T KPV ++   K VIECS ++K+S                               
Sbjct: 322 PYLSMTCKPVHYEKRAKTVIECSTSFKFSK-----------------VRDGEEGADEEEG 364

Query: 348 XXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAY 407
                   +QP +  P  F    EQ ELV ++A LHNSL++RA+SLYSV Y+ V PENA 
Sbjct: 365 GNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHPENAG 424

Query: 408 INNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMP 467
           ++NDRGEPE+S WA  W GLLDY+F+++ WD ++N ++VDSL  FE++N +K RG L+MP
Sbjct: 425 LDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGFLRMP 484

Query: 468 QSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496
              EM +H  P+ GEY SDHL M+  +EL
Sbjct: 485 PGSEMTKHGQPHVGEYASDHLSMVCDIEL 513

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  466 bits (1198), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 222/448 (49%), Positives = 300/448 (66%), Gaps = 30/448 (6%)

Query: 60  HGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWV 119
           HG +P++P +LQFIKRPLL LH+++PVKG   KIMTYN LAQ+LI+R LFP SG A+KW 
Sbjct: 75  HGLDPNVPPDLQFIKRPLLCLHEEEPVKGFKFKIMTYNALAQALIRRKLFPSSGNAVKWF 134

Query: 120 RRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWK 179
           +RSKVLLNE K+YD+D+  LQEID +Q++ +WK    KLGY  +F++   K HGV I W+
Sbjct: 135 KRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKEEFQKLGYASQFHRIGTKNHGVAIVWR 194

Query: 180 RNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK---DKSAIKKKGVIIGTT 236
            +LF  V ++ +D+D+  SG I PRT TKN GL++AL+F +K        KK G++IGTT
Sbjct: 195 CSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLILALKFTDKVLNQFPGTKKSGILIGTT 254

Query: 237 HLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEK--------WYPFFTGDFNSQPKDAP 288
           HLFWH FGTFERTRQCYV++++M + + ++  ++         WYPF  GDFNSQP D P
Sbjct: 255 HLFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSHWYPFICGDFNSQPFDTP 314

Query: 289 YVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXX 348
           Y+S+TSKPV+++   K VIECS ++ +S                +               
Sbjct: 315 YLSMTSKPVTYRGRAKTVIECSTSFTFSKLRDGEEGEDEEGGNIEKFGK----------- 363

Query: 349 XXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYI 408
                   QP +  P  F  T EQ  LV Q+ +LHNSL++RAISLY+VGY+ V PENA +
Sbjct: 364 -------GQPEHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGYKHVHPENAGL 416

Query: 409 NNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQ 468
           +ND GEPE+S WA  W GLLDYIFF+++W+G T+   VD +  FEREN +K+RGLL+MP 
Sbjct: 417 DNDSGEPEISNWAETWRGLLDYIFFVKNWNG-TDRSSVDKIDVFERENGIKIRGLLRMPP 475

Query: 469 SKEMCEHAIPYKGEYPSDHLCMMIQLEL 496
            +EM +H  P++GEYPSDHL MM ++EL
Sbjct: 476 GEEMTKHGQPHEGEYPSDHLSMMCEIEL 503

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  464 bits (1195), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/449 (48%), Positives = 303/449 (67%), Gaps = 31/449 (6%)

Query: 60  HGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWV 119
            G +PD P ELQFIKRP+L +H+++PVKG    +MTYNCLAQ+LI+R LFP  G ALKW 
Sbjct: 89  QGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDALKWH 148

Query: 120 RRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWK 179
           RRSKVLLNE K+Y+ D++ LQEID VQ++ +WK   +KLGY+C+FYKK  K HGV + WK
Sbjct: 149 RRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWK 208

Query: 180 RNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSA----IKKKGVIIGT 235
           + LF     + +D+D+ LSG I+PRT T N+ L+++L+F  K        I K G++IGT
Sbjct: 209 KELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGT 268

Query: 236 THLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEK--------WYPFFTGDFNSQPKDA 287
           THLFWH FGT+ERTRQCY+++++M +F+ ++  ++         WYPFF GDFNSQP D+
Sbjct: 269 THLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDS 328

Query: 288 PYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXX 347
           PY+S+TSKP+ +   +K VIECS ++K+S                +              
Sbjct: 329 PYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRDGEEGDDEEGGNIEKFGK---------- 378

Query: 348 XXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAY 407
                   +QP +  P  +    EQ  LV+++  LHNSL++RAISLYS GY KV PEN+ 
Sbjct: 379 --------DQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSG 430

Query: 408 INNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMP 467
           I+N+R EPE+S WA +W GLLDY+F+++ WD   N E +DSL+ FEREN++K+RG L+MP
Sbjct: 431 IDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKE-IDSLEDFERENDIKIRGYLRMP 489

Query: 468 QSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496
            +KE+  H  P++GEYPSDHLCM+ ++EL
Sbjct: 490 PAKELPSHGQPFEGEYPSDHLCMLCEVEL 518

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  460 bits (1184), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 224/450 (49%), Positives = 295/450 (65%), Gaps = 30/450 (6%)

Query: 60  HGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWV 119
            G +PD P EL FIKRP L LH+ +PV G   K+MTYNCLAQ+LI+R LFP SG ALKW 
Sbjct: 81  QGVDPDCPPELHFIKRPFLVLHEKEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWY 140

Query: 120 RRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWK 179
           RRS+VLLNE KYY +D++ LQEID +QF+ +WK    KLGYD ++Y+ + K HGV I W+
Sbjct: 141 RRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKDEFNKLGYDGQYYRNSTKNHGVAIMWR 200

Query: 180 RNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKK-----GVIIG 234
           R +F +V  + ID+D+  S  I  RT T NVGLV+AL+F  K  S + K      G++IG
Sbjct: 201 REMFQQVDKMLIDYDKETSENISTRTTTNNVGLVLALKFSEKVLSNLSKSSSKKCGILIG 260

Query: 235 TTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKD 286
           TTHLFWH FGT+ERTRQCYV++ +M +FM ++        G +  W+PFF GDFNSQP D
Sbjct: 261 TTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFD 320

Query: 287 APYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXX 346
            PY+S+TSKPV ++N  K VIECS ++K+S                              
Sbjct: 321 TPYLSMTSKPVHYKNRAKTVIECSTSFKFSK-----------------ARDGDESADDEE 363

Query: 347 XXXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENA 406
                    +QP +  P ++    EQ ELV ++A LHNSL++RAISLYSVGYR V PENA
Sbjct: 364 GGNIEKYGKDQPESPVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSVGYRNVHPENA 423

Query: 407 YINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKM 466
            ++NDRGEPE+S WA  W GLLDY+F+++ WD ++N ++V++L  FE+ N +K RG L+M
Sbjct: 424 GLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVNEMKCRGFLRM 483

Query: 467 PQSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496
           P  KEM +H  P+ GEY SDHL M+  LEL
Sbjct: 484 PPGKEMTKHGQPHVGEYASDHLSMVCDLEL 513

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  458 bits (1178), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 221/450 (49%), Positives = 301/450 (66%), Gaps = 30/450 (6%)

Query: 60  HGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWV 119
           HG +PD P EL FI+RPLL+L + +PV G   K+MTYNCLAQ+LI+R LFP SG ALKW 
Sbjct: 80  HGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWF 139

Query: 120 RRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWK 179
           RRSKVLLNE KYY++D++ LQE+D +QF+ +WK    K+GYD ++++   K HGV I W+
Sbjct: 140 RRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWR 199

Query: 180 RNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK-----DKSAIKKKGVIIG 234
           R++F KV  + ID+D+  SG+I  RT T NVGLV+AL+F  +      K + KK G++IG
Sbjct: 200 RSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVLSKLGKKSSKKCGILIG 259

Query: 235 TTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKD 286
           TTHLFWH FGT+ERTRQCYV++ +M +FM ++        G +  W+PFF GDFNSQP D
Sbjct: 260 TTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFD 319

Query: 287 APYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXX 346
            PY+S+TSKPV +++  K VIECS ++K+S                              
Sbjct: 320 TPYLSMTSKPVHYKSRAKTVIECSTSFKFSK-----------------VRDGEEGADDEE 362

Query: 347 XXXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENA 406
                    +QP +  P +F    EQ E+V  +  LHNSL++RAISLYSVGY+ V PENA
Sbjct: 363 GGNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENA 422

Query: 407 YINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKM 466
            ++NDRGEPE+S WA  W GLLDY+F+++ WD ++N ++V++L  FE++N +K RG L+M
Sbjct: 423 GLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRM 482

Query: 467 PQSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496
           P + EM +H  P+ GEYPSDHL M+  LEL
Sbjct: 483 PPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  457 bits (1177), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 220/451 (48%), Positives = 303/451 (67%), Gaps = 31/451 (6%)

Query: 60  HGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWV 119
           +G +PD P ELQFI+RPLLTLHDD+P K     +MTYNCLAQ+LI+R LFP SG+A+KW 
Sbjct: 94  NGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWY 153

Query: 120 RRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWK 179
           RRS+VLLNE KYY+ DL+ LQEID +QF+ +W+    K+GY  +F++ + K HGV I WK
Sbjct: 154 RRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWK 213

Query: 180 RNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK------DKSAIKKKGVII 233
            NLF     + IDFD+ LSG I PRT+T N GL+++L++ +       +     K G+II
Sbjct: 214 NNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIII 273

Query: 234 GTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPK 285
           GTTHLFWH FGT+ERTRQC+V+++++ +F K++        G ++ W  FF GDFNSQP 
Sbjct: 274 GTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPF 333

Query: 286 DAPYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXX 345
           D PY+SITSKPV ++   KIVIECS +Y YS                             
Sbjct: 334 DTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGN------------ 381

Query: 346 XXXXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPEN 405
                     +QP    P  +TPT EQA+LVS++ +LHNSLN++A SLY+VGY+KV PEN
Sbjct: 382 ----IEKFGKDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPEN 437

Query: 406 AYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLK 465
           + ++N +GEPE+S WA  W GLLDYIF++ HWD  ++ ++V+  + FE++N++KLRG L+
Sbjct: 438 SGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDF-SDCKEVEDFEKFEKKNHMKLRGYLR 496

Query: 466 MPQSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496
           MP + EM ++  P++GEYPSDHL MM ++EL
Sbjct: 497 MPPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  454 bits (1169), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 217/449 (48%), Positives = 293/449 (65%), Gaps = 31/449 (6%)

Query: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120
           G +PD P ELQFI+R +L LH+++PV+G  +KIM+YNCLAQ+LI+R LFP SG+ALKW R
Sbjct: 62  GVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALKWYR 121

Query: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180
           RS+VLLNE K+YD D+L LQEID++Q++ +WK    KLGY  +F++K  K HGV I WK 
Sbjct: 122 RSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWKH 181

Query: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIK-----KKGVIIGT 235
             F     + IDFD   SG I+PRT T N  L++AL+F  K K   K     K G+++GT
Sbjct: 182 EKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGT 241

Query: 236 THLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDA 287
           THLFWH FGT+ERTRQCYV++++M +FM ++        G +  WYPFF GDFNSQP D+
Sbjct: 242 THLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDS 301

Query: 288 PYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXX 347
           PY+S+T KP+ + +  K VIECS ++K+S                               
Sbjct: 302 PYLSMTCKPIKYDSRAKTVIECSTSFKFSK-----------------KRESGEDAEDEEG 344

Query: 348 XXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAY 407
                   +QP    P  F    EQ +LVSQ+  LHNSL++RA+SLYSV Y KV PEN+ 
Sbjct: 345 GNIEKFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSG 404

Query: 408 INNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMP 467
           ++N+RGEPE+S WA  W GLLDY+F +++W+     E +D+L+ FE  NN+K+RGLL+MP
Sbjct: 405 LDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTE-IDTLEDFENSNNIKIRGLLRMP 463

Query: 468 QSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496
              EM  H  P+ GEYPSDHLC++ ++EL
Sbjct: 464 PGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  450 bits (1158), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 218/451 (48%), Positives = 295/451 (65%), Gaps = 32/451 (7%)

Query: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120
           G +P+   +LQFI+RP+L LH+++PV G  + IMTYNCLAQ+LI+R LFP SG ALKW +
Sbjct: 124 GLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALKWFK 183

Query: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180
           RSKVL NE K+Y+ D++ LQEID +Q++ +WK    K+GY+ +F++K  K HGV I W++
Sbjct: 184 RSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAIIWRK 243

Query: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEF----LNKDKSAIKKKGVIIGTT 236
            LF     + IDFD+  SG I PRT T N GL ++L+F    L+K  +   + G+I+GTT
Sbjct: 244 ELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTT 303

Query: 237 HLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDAP 288
           HLFWH FGT+ERTRQCYV++++M +FM ++        G    WYPFF GDFNSQP D P
Sbjct: 304 HLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTP 363

Query: 289 YVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXX 348
           Y+S+TSKP+ ++   K VIECS +YK+S                                
Sbjct: 364 YLSMTSKPIHYKGRAKTVIECSTSYKFSK-----------------KRDGEEDADEEEGG 406

Query: 349 XXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYI 408
                  +QP    P HF    EQ +LV  +  LHNSL++RAISLY VGYRKV PENA +
Sbjct: 407 NIEKFGKDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGL 466

Query: 409 NNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQ 468
           +ND GEPE+S WA  W+GLLDYI F++HW G  + + VD+L+ FE+EN++K+RG L+MP 
Sbjct: 467 DNDCGEPEISNWAHTWNGLLDYILFIKHW-GFDDCQHVDTLEKFEKENSIKVRGYLRMPP 525

Query: 469 SKEMCE--HAIPYKGEYPSDHLCMMIQLELL 497
           S EM +  H  P+ GEYPSDHL M+ +LEL+
Sbjct: 526 STEMSKHGHGQPHTGEYPSDHLSMICELELI 556

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  445 bits (1145), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 213/447 (47%), Positives = 292/447 (65%), Gaps = 30/447 (6%)

Query: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120
           G +PD P +LQFI RP+L+L+  +   G + K+MTYNCLAQ+LI+R LFP SG ALKW +
Sbjct: 66  GLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNALKWFK 125

Query: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180
           RS+VLLNE  +Y+SD+L LQE+D++Q++ +WK    KLGY+ +F++   K HG+ I WKR
Sbjct: 126 RSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKR 185

Query: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK---DKSAIKKKGVIIGTTH 237
           ++F  V  + ID+D+  SG ++PRT TKNVGL IAL F  K         K+G+I+GTTH
Sbjct: 186 DMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTH 245

Query: 238 LFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEK--------WYPFFTGDFNSQPKDAPY 289
           LFWH FGTFERTRQCYVM+++M +FM ++  ++         WYPFF GDFNSQP D PY
Sbjct: 246 LFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPY 305

Query: 290 VSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXX 349
           +S++SKPV+++   K VIECS +Y +S                +                
Sbjct: 306 LSVSSKPVTYKGRAKTVIECSTSYTFSKARDGEECDDEEGGNIEKFGD------------ 353

Query: 350 XXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYIN 409
                  QP +  P  F+ T EQ  LV  +A+LHNSL++R IS+YSVGY+ V  ENA ++
Sbjct: 354 ------GQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLD 407

Query: 410 NDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQS 469
           N+  EPE+S WA  W GLLDYIFF++ WD  ++    + L+ F+ EN +K+RGLL+MP +
Sbjct: 408 NNFNEPEISNWAETWRGLLDYIFFIKKWDF-SDKASPEELEAFQDENGIKIRGLLRMPPA 466

Query: 470 KEMCEHAIPYKGEYPSDHLCMMIQLEL 496
           KEM  H  P++GEY SDHL MM +LEL
Sbjct: 467 KEMPNHGQPHEGEYGSDHLSMMCELEL 493

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  443 bits (1140), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 217/449 (48%), Positives = 286/449 (63%), Gaps = 30/449 (6%)

Query: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120
           G +PD P ELQFIKRP+L LH D+PV G    +MTYNCLAQ+LI+R LFP SG+A+KW R
Sbjct: 72  GLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAVKWFR 131

Query: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180
           RSKVLL E ++Y+SD++ LQEID +Q++ +WK+   KLGY+ +F++   K HGV I WKR
Sbjct: 132 RSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAIVWKR 191

Query: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAI----KKKGVIIGTT 236
            +F     + IDFD+  S  I PRTRT N GL+++L+F +K  S +    K  G+IIGTT
Sbjct: 192 EMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNTKTTGIIIGTT 251

Query: 237 HLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDAP 288
           HLFWH FGT+ERTRQCYV++++M +FM ++        G +  W PFF GDFNSQP D+P
Sbjct: 252 HLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSP 311

Query: 289 YVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXX 348
           Y+S+TSKP+ +    K VI+CS +YK+S                                
Sbjct: 312 YLSMTSKPIEYTERAKTVIQCSTSYKFSK-----------------LRNGEEDVDDEEGG 354

Query: 349 XXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYI 408
                  +QP    P  F    EQ  LV ++A +HN L +RA SLYSVGY+ V  ENA I
Sbjct: 355 NIEKFGKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGI 414

Query: 409 NNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQ 468
           +N RGEP +S WA  W GLLDYIF +  WD   N + VDSL+ FE EN+++LRG L+MP 
Sbjct: 415 DNTRGEPIISNWANTWRGLLDYIFHVNTWDFD-NRQAVDSLEKFEIENSIRLRGFLRMPL 473

Query: 469 SKEMCEHAIPYKGEYPSDHLCMMIQLELL 497
             EM +H  P++GEY SDHL M+  +ELL
Sbjct: 474 DSEMPKHGQPHEGEYASDHLSMICNIELL 502

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  441 bits (1134), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 224/476 (47%), Positives = 293/476 (61%), Gaps = 31/476 (6%)

Query: 34  LNTEYITXXXXXXXXXXXXXXXXXXXHGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKI 93
           L+ E+I                     G +PD+P ELQFI+RPLL L   +   G   KI
Sbjct: 52  LDPEHIAKVRAEREAMRKSKQEAMLAQGLDPDLPPELQFIRRPLLALSKAESTAGFEFKI 111

Query: 94  MTYNCLAQSLIQRDLFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKI 153
           MTYNCLAQ+LI+R LFP SG+A+KW RRSKVLLNE KYYDSD++ LQE+D +QF+ +WK 
Sbjct: 112 MTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKE 171

Query: 154 VLAKLGYDCEFYKKNGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLV 213
              KLGYD +F+ K  K HG+ I WKR+LF     + ID+D+ +SG I PRT T NVGLV
Sbjct: 172 EFDKLGYDSQFHAKPSKNHGISILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLV 231

Query: 214 IALEFLNKDKSAI---KKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIE 270
           +AL+F  K        +K G+I+GTTHLFWH FGT+ERTRQCY+++++  +FM ++  ++
Sbjct: 232 LALKFSPKVLERFPNTRKSGIIVGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQ 291

Query: 271 K--------WYPFFTGDFNSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXX 322
                    WY FF GDFNSQP D PY+S+TSKPV + N  K VIECS +Y +S      
Sbjct: 292 NNNDEIKDHWYTFFGGDFNSQPFDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSK----- 346

Query: 323 XXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXPNQPSNARPLHFTPTREQAELVSQLAAL 382
                                            +QP+   P  F  + EQ  LV+ +  L
Sbjct: 347 ------------SRDGEEDAEDEEGGNIEKFGKDQPATPVPSFFDASSEQQSLVANMEKL 394

Query: 383 HNSLNLRAISLYSVGYRKVDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTN 442
           HNSL++RAISLYSVGY  V  ENA ++N RGEPE+S WA  W+GLLDY+F ++ WD  ++
Sbjct: 395 HNSLDMRAISLYSVGYGTVHIENAGLDNTRGEPEISNWAHAWNGLLDYLFVIKSWDF-SD 453

Query: 443 HEKVDSLKTFERENNVKLRGLLKMPQSKEMCE--HAIPYKGEYPSDHLCMMIQLEL 496
             +VDSLK FE EN +K++  LKMP   EM +  H  P+ GEYPSDHL M+ +LEL
Sbjct: 454 KIQVDSLKKFEDENELKVKAFLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICKLEL 509

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  440 bits (1132), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 212/445 (47%), Positives = 285/445 (64%), Gaps = 31/445 (6%)

Query: 66  IPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVRRSKVL 125
           IP ELQFIKRP+L LH+++PV+G    +MTYNCLAQ+LI+R LFP SG ALKW RRSKVL
Sbjct: 142 IPPELQFIKRPILYLHEEEPVQGFKFSMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVL 201

Query: 126 LNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKRNLFAK 185
           LNE  YY  D++ LQE+D +Q++ +WK    KLGY  ++++K  K HGV I W+R+LF  
Sbjct: 202 LNEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTM 261

Query: 186 VKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIK-----KKGVIIGTTHLFW 240
              + I+FD+  SG + PRT T NVGL+++L+F  + K+  K     K G+IIGTTHLFW
Sbjct: 262 TDKMLIEFDKESSGNVPPRTTTNNVGLILSLKFTPEAKAQFKNVETTKTGIIIGTTHLFW 321

Query: 241 HLFGTFERTRQCYVMMDQMDKFMKKLGGIEK--------WYPFFTGDFNSQPKDAPYVSI 292
           H FGT+ERTRQCYV++++M +FM ++  ++         WYPFF GDFNSQP D+PY+S+
Sbjct: 322 HPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSM 381

Query: 293 TSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXX 352
             KPV +    K VIECS +YK+S                                    
Sbjct: 382 VRKPVEYSGRAKTVIECSTSYKFSKKRDGEEDVDDEEGGNIEKFGI-------------- 427

Query: 353 XXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINNDR 412
              +QP    P  F    EQ  LV  +  LHNSLN+RAISLY VGY+ V PENA I+N+ 
Sbjct: 428 ---DQPQTPVPEEFIANGEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNEC 484

Query: 413 GEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSKEM 472
           GEPE+S WA  W+GLLDY+ F++ W   ++  K ++LK FE  N++++RG L+MP + EM
Sbjct: 485 GEPEISNWAHTWNGLLDYLLFVKEWTF-SDCTKTETLKQFEESNSMRIRGFLRMPPANEM 543

Query: 473 CEHAIPYKGEYPSDHLCMMIQLELL 497
            +H  P+ GEYPSDHL M+  +ELL
Sbjct: 544 TKHGQPHVGEYPSDHLSMLCSIELL 568

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  436 bits (1120), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 216/453 (47%), Positives = 292/453 (64%), Gaps = 33/453 (7%)

Query: 61  GFEPDIPSELQFIKRPLLTLHDDDPV--KGTMLKI--MTYNCLAQSLIQRDLFPGSGQAL 116
           G + DIP+EL+FI+RP+L++H D  +  +G  L +  MTYNCLAQ+LI+R LFP SG AL
Sbjct: 44  GAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPAL 103

Query: 117 KWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLI 176
           KW RRS+VLLN+ K+Y+ D+L LQE+D VQ+  +W+    KLGY  +F+KK  K HGV +
Sbjct: 104 KWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAV 163

Query: 177 AWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIK---KKGVII 233
            W+  LF     + IDFD+  SG + PRT T N GLVIAL+F  +  +  +   + G+++
Sbjct: 164 VWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILV 223

Query: 234 GTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPK 285
           GTTHLFWH FGTFERTRQCYV++++M +FM ++        G  + W+PFF GDFNSQP 
Sbjct: 224 GTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPY 283

Query: 286 DAPYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXX 345
           DAPY+S+TSKPVS+    + VIECS +Y +S                Q            
Sbjct: 284 DAPYLSMTSKPVSYSGRARTVIECSTSYTFS---------------KQRDGEDAAADEEE 328

Query: 346 XXXXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPEN 405
                     +QP +  P  F P  EQ  LV Q+  LHNSL++RA+SLYSVGYR V PEN
Sbjct: 329 EGGNIEIFGKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPEN 388

Query: 406 AYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLK 465
           A  +N RGEPE+S WA  W+GLLDY+F++ HWD K +   VD+L+ FE+++ V ++ LL+
Sbjct: 389 AGADNARGEPEISNWAHTWNGLLDYLFYVGHWDFK-DRTGVDTLEEFEQDSGVTVKRLLR 447

Query: 466 MPQSKEMCE--HAIPYKGEYPSDHLCMMIQLEL 496
           MP  +EM +  H  P+ GEYPSDHL M+  LEL
Sbjct: 448 MPSKQEMQQFGHGQPHTGEYPSDHLAMVCDLEL 480

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  434 bits (1117), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 212/446 (47%), Positives = 294/446 (65%), Gaps = 29/446 (6%)

Query: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120
           G +P+ P +LQFI RP+L L  +   +G + KIMTYNCLAQ+LI+R LFP SG ALKW +
Sbjct: 66  GLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALKWFK 125

Query: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180
           RS+VLLNE  +Y +D+  LQEID++Q++ +WK    KLGYD +F++   K HG+ I WKR
Sbjct: 126 RSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKR 185

Query: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK--DK-SAIKKKGVIIGTTH 237
           +LF  V  + +D+D+  SG++KPRT TKNVGLV+AL F  K  DK     K+G+++GTTH
Sbjct: 186 DLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTH 245

Query: 238 LFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIE-------KWYPFFTGDFNSQPKDAPYV 290
           LFWH FGTFERTRQCYV++++M  F+ ++  ++       KWYPFF GDFN+QP D PY+
Sbjct: 246 LFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPFDTPYL 305

Query: 291 SITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXX 350
           S++SKPV +++  K VIECS +Y +S                +                 
Sbjct: 306 SMSSKPVVYKDRAKTVIECSTSYTFSKARDGEECDDEEGGNIEKFGD------------- 352

Query: 351 XXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINN 410
                 QP +  P  +    EQ ELV  +A LHNSL++RAIS+YSV Y+ V PENA  +N
Sbjct: 353 -----GQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDN 407

Query: 411 DRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSK 470
              EPE+S WA  W GLLDYIFF++ W+  T++++ + L+TFE+EN+VK+  LL+MP S+
Sbjct: 408 THNEPEISNWAETWRGLLDYIFFIKQWNF-TDNKRPEELQTFEKENDVKILSLLRMPPSE 466

Query: 471 EMCEHAIPYKGEYPSDHLCMMIQLEL 496
           EM  H  P++GEY SDHL +M ++EL
Sbjct: 467 EMPNHGQPHEGEYGSDHLSLMCEIEL 492

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  420 bits (1080), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 209/479 (43%), Positives = 288/479 (60%), Gaps = 34/479 (7%)

Query: 34  LNTEYITXXXXXXXXXXXXXXXXXXXHGFEPDIPSELQFIKRPLLTLHDDDPVKGTM--- 90
           +  EYI                     G +P +P++L+FIKRP+L +  D   + T    
Sbjct: 56  ITPEYIAEMRAKREAAKIAKKEALIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVC 115

Query: 91  -LKIMTYNCLAQSLIQRDLFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQ 149
            + IMTYNCLAQ+LI+R LFP SG A+KW +RS+VLLNE KYY+ D+L LQEID VQ+K 
Sbjct: 116 PISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKS 175

Query: 150 YWKIVLAKLGYDCEFYKKNGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKN 209
           +WK+   KLGY C+F+    K HGVLIAWK +LF     + ID+D+  +G I+PRT TKN
Sbjct: 176 FWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKN 235

Query: 210 VGLVIALEFLNK---DKSAIKKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL 266
           VG++++L+F  K        K  G+IIGTTHLFWH FGT+ERTRQCY+++ ++ +F  ++
Sbjct: 236 VGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRI 295

Query: 267 --------GGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSXX 318
                   G    W  FF GDFNSQP DAPY+SITSKPV +    K VIECS ++ +S  
Sbjct: 296 NVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKL 355

Query: 319 XXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXPNQPSNARPLHFTPTREQAELVSQ 378
                         +                       QP    P  F+   EQ +L   
Sbjct: 356 RDGDEGEGEEGGNIEKFGK------------------GQPETPVPESFSGNEEQKQLCEN 397

Query: 379 LAALHNSLNLRAISLYSVGYRKVDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWD 438
           +  LHN +++RAISLYS+ Y KV PEN+ ++N R EPE+S WA  W GLLDY++++  WD
Sbjct: 398 MKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWD 457

Query: 439 GKTNHEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLELL 497
           G  +  K+D L TFE+   V++  LL++P +KEM EH  P++GEYPSDHLCM+++L ++
Sbjct: 458 G-CDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGII 515

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  420 bits (1079), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 206/440 (46%), Positives = 281/440 (63%), Gaps = 31/440 (7%)

Query: 69  ELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVRRSKVLLNE 128
           ++ FIKRPLL  + D+  KG + ++MTYNCLAQ+LI+R LFP SG ALKW +RSKVLL+E
Sbjct: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142

Query: 129 LKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKRNLFAKVKS 188
           L+YY+ D++ LQEID  Q+K +W   L   GY  +F++  GK HG+ I W+R+LF KV  
Sbjct: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202

Query: 189 LPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKS---AIKKKGVIIGTTHLFWHLFGT 245
             IDFDE  SG I+ RT TKNVGL++ALE+ ++ K       + G+++GT+HLFWH FGT
Sbjct: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGT 262

Query: 246 FERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDAPYVSITSKPV 297
           +ER RQCY+++ +M  F+K+L        G   +W+PFF GDFNSQP DAPY+S+ SKP+
Sbjct: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322

Query: 298 SFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXPNQ 357
            ++   + VIECS +YK+S                +                       Q
Sbjct: 323 IYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGA------------------GQ 364

Query: 358 PSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINNDRGEPEL 417
           P    P  F  T EQ  LV  + +LHN+L++RAISLYS+ YR V PENA I+N+RGEPE+
Sbjct: 365 PETPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEI 424

Query: 418 SEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAI 477
           S WA  W GLLDYI ++  WD   N E VD +  F++  +V +R LL++P + EM  H  
Sbjct: 425 SNWAHAWRGLLDYIMYVMPWDFSDNTE-VDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQ 483

Query: 478 PYKGEYPSDHLCMMIQLELL 497
           P++GEYPSDHL +M +LELL
Sbjct: 484 PHEGEYPSDHLSLMCELELL 503

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  414 bits (1065), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 209/446 (46%), Positives = 285/446 (63%), Gaps = 35/446 (7%)

Query: 64  PDIPS-ELQFIKRPLLTLHDDDPV-KGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVRR 121
           P+I S  L+FI RP+L L     V KG    +MTYNCLAQSLI+R LFP SG+ALKW +R
Sbjct: 62  PNITSLNLEFIARPMLPLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKR 121

Query: 122 SKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKRN 181
           S VLL E K+Y++D+L LQEID+ Q+  +W   L+ LGY   F++ + K HGV I WK++
Sbjct: 122 SMVLLKEFKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKD 181

Query: 182 LFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIK---KKGVIIGTTHL 238
           LF  +  + I+FD   SG I+PR  T NVG+++AL F +K K +     K G+I+GT+HL
Sbjct: 182 LFIWMDQMLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSFPGTVKSGIIVGTSHL 241

Query: 239 FWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDAPYV 290
           FWH FGT+ERTRQCYV++++M +F+ ++          + KWYPFF GDFNSQP DAPY+
Sbjct: 242 FWHPFGTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYL 301

Query: 291 SITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXX 350
           SITSKPV +    K VIECSAAYK+                                   
Sbjct: 302 SITSKPVLYSGRAKTVIECSAAYKFPDLGAGARGANEDGGTVGE---------------- 345

Query: 351 XXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINN 410
                ++P +  P  F PT E + LV ++  LHNSL++RAISLY+V Y+ V P+NA ++N
Sbjct: 346 -----DRPVDPVPESFQPTAEVSSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDN 400

Query: 411 DRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSK 470
           +RGEPE+S WA  W GLLDYI ++  W    N E VDSL++FE+ +++ ++ +L+MP +K
Sbjct: 401 ERGEPEISNWAYTWRGLLDYIMYITPWQASNNVE-VDSLESFEKLSHITVQEMLRMPPAK 459

Query: 471 EMCEHAIPYKGEYPSDHLCMMIQLEL 496
           EM  H  P+ GEYPSDHL MM +LE+
Sbjct: 460 EMSSHGQPHDGEYPSDHLAMMCKLEV 485

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  400 bits (1027), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 210/459 (45%), Positives = 287/459 (62%), Gaps = 44/459 (9%)

Query: 61  GFEPDIPSELQFIKRPLLTL--HDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKW 118
           G +PD P EL FIKRP+L L  H     KG    +MTYNCLAQ++I+R++F  SG ALKW
Sbjct: 41  GEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALKW 100

Query: 119 VRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVL-AKLGYDCEFYKKNGKIHGVLIA 177
            RRSKVL+NE+ YY+ D+L LQEID  Q++ +WK  L + L  +  +YK+  K HGVLIA
Sbjct: 101 FRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIA 160

Query: 178 WKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIAL----EFLNK---------DKS 224
           WK+++F +V  + +DFD+  +  I  RT T+N+ + +AL    EF+ K         D++
Sbjct: 161 WKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQN 220

Query: 225 AIKKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIE----KWYPFFTGDF 280
            I   G II TTHLFWH FGTFERTRQCY+++++M KF+  L   +     WYPF  GDF
Sbjct: 221 DI---GFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNVKDHLKTHWYPFICGDF 277

Query: 281 NSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXX 340
           NS P+DAPY+S+TSKP+ +    K VIECS AYK+S                +       
Sbjct: 278 NSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEEEKK------- 330

Query: 341 XXXXXXXXXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRK 400
                          NQP +  P  FTPT EQA+LV QL +LHN L LRA SLY + Y+ 
Sbjct: 331 -------------LINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKI 377

Query: 401 VDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWD-GKTNHEKVDSLKTFERENNVK 459
           VDP N  INNDRGEPE + WA+ W G+LDYI ++ +WD  +   E  +SL+ FE+ N + 
Sbjct: 378 VDPSNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLL 437

Query: 460 LRGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLELLE 498
           ++GLLKMP +K+M  H  P++ EYPSDH+ ++ ++E+L+
Sbjct: 438 IKGLLKMPLNKDMPFHTQPFEREYPSDHISILCEMEILD 476

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  369 bits (948), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 194/446 (43%), Positives = 272/446 (60%), Gaps = 30/446 (6%)

Query: 61  GFEPDIPS-ELQFIKRPLLTLHDDDPVKGTM-------LKIMTYNCLAQSLIQRDLFPGS 112
           G +PD P+ +LQFIKRP L LH +     T        +KIMTYN LAQ+LI+R+ FP S
Sbjct: 69  GKDPDFPTPDLQFIKRPFLHLHHEIAQGSTESTPNSLDVKIMTYNTLAQTLIRRNFFPQS 128

Query: 113 GQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIH 172
           G ALKW +RSKVL++ELK Y  D++SLQE+D+ + K +W+    KLG+D  F + +GK H
Sbjct: 129 GSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELK-FWQENFRKLGFDLTFKRHDGKTH 187

Query: 173 GVLIAWKRNLFAKVKSLPIDFDETLSGTIKP-RTRTKNVGLVIALEFLNKDKSAIKKKGV 231
           G+LIAW    F       +D+D  L+G   P RTRTKN+ L+ +L    K+ S     GV
Sbjct: 188 GLLIAWNSGKFQLENEWMLDYDNILAGNAIPARTRTKNIALIASLRL--KNISDPSTDGV 245

Query: 232 IIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEKWYPFFTGDFNSQPKDAPYVS 291
           I+  THLFWH FG FER RQ Y+++ ++ + +K       W+    GDFN++P++ PY++
Sbjct: 246 IVANTHLFWHPFGVFERLRQSYLVLAKIQE-IKACPKYNGWHSVLMGDFNTEPEEPPYLA 304

Query: 292 ITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXX 351
           IT KPV+     +++ ECS AY+YS                +                  
Sbjct: 305 ITRKPVALTGSARVMAECSLAYRYSKKRNGEEGGQDDEECDEQSRGEGRF---------- 354

Query: 352 XXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINND 411
               NQP N +P  FT T EQ  LV QL ALHNSL++R +SLY +GY KV PEN++ +N 
Sbjct: 355 ----NQPQNPKPKSFTATSEQKALVDQLVALHNSLHVRGVSLYGLGYGKVQPENSHESN- 409

Query: 412 RGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSKE 471
            GEPELS WA  W GLLDYIF+++H D  + H++ + +  FE +NN+++ G LKMP++KE
Sbjct: 410 -GEPELSNWANSWCGLLDYIFYIEHSDEHSAHDQ-NPVDDFENKNNLRVMGYLKMPRAKE 467

Query: 472 MCEHAIPYKGEYPSDHLCMMIQLELL 497
           M +H+ P++GEY SDH+ +M QL  L
Sbjct: 468 MPKHSQPFEGEYASDHVSLMCQLRFL 493

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  363 bits (931), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 188/451 (41%), Positives = 271/451 (60%), Gaps = 35/451 (7%)

Query: 61  GFEPDIPS-ELQFIKRPLLTLHDDDP--------VKGTM----LKIMTYNCLAQSLIQRD 107
           G +PD P+ +LQFI+RPLL +  +          ++ T     +KIMTYN LAQ+LI+RD
Sbjct: 67  GKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRD 126

Query: 108 LFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKK 167
            FP SG ALKW +RSKVL++ELK Y  D++SLQE+D+ + K +W+    KLG+D  F + 
Sbjct: 127 FFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLSFRRN 185

Query: 168 NGKIHGVLIAWKRNLFAKVKSLPIDFDETLSG-TIKPRTRTKNVGLVIALEFLNKDKSAI 226
            GK HG+L+AW    F       +D+D+ L+G  I  RTRTKN+ L+++L F  KD    
Sbjct: 186 GGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRF--KDTRNA 243

Query: 227 KKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEKWYPFFTGDFNSQPKD 286
              G+++  THLFWH FG FER RQ Y+++ ++ + +K       W+    GDFN++P++
Sbjct: 244 STNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQE-IKDFPKYHGWHSLLMGDFNTEPEE 302

Query: 287 APYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXX 346
            PY++ITSKP++    T+ ++ECS AY+YS                ++            
Sbjct: 303 PPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDEDYDENSRGERNL----- 357

Query: 347 XXXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENA 406
                    NQP N +P HF  T+E+ +LV+QL  LHNSL+++ ISLY +GY KV PENA
Sbjct: 358 ---------NQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENA 408

Query: 407 YINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKM 466
             N   GEPELS WA  W GLLDYIF+++  D   + ++  SL  FE  N V + G L+M
Sbjct: 409 --NEGHGEPELSNWANTWCGLLDYIFYIES-DDNNSAQQEKSLNVFEENNGVNVIGYLRM 465

Query: 467 PQSKEMCEHAIPYKGEYPSDHLCMMIQLELL 497
           P  +EM +H+ P++GEY SDH+ +M Q+ L 
Sbjct: 466 PCKQEMPKHSQPFEGEYASDHISLMCQIRLF 496

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  355 bits (911), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 192/443 (43%), Positives = 278/443 (62%), Gaps = 29/443 (6%)

Query: 68  SELQFIKRPLLTLHDDDPVKGTM-LKIMTYNCLAQSLIQRDLFPGSGQALKWVRRSKVLL 126
           S+  FIKR +L L + + +  ++ LKIMTYN L+QSLI+R+++P +  A+KW  RSKV+L
Sbjct: 49  SKYDFIKRAILQLPNVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVIL 108

Query: 127 NELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYK--KNGKIHGVLIAWKRNLFA 184
           NE+KYY+ D++  QE+D +Q+ ++W   L+KLGY+ EFYK  +  K+HGV I W+ NLF 
Sbjct: 109 NEIKYYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFE 168

Query: 185 KVKSLPIDFDETLSG-TIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLF 243
           +   + I+FD+ ++G  I   TRT NVGL++AL+F  K  +A  + G++IGTTHLFWH F
Sbjct: 169 QFDVIKINFDDIVAGNAISKTTRTWNVGLIVALKF--KSSNAKFRSGIVIGTTHLFWHPF 226

Query: 244 GTFERTRQCYVMMDQMDKFMKKL----GGI----EKWYPFFTGDFNSQPKDAPYVSITSK 295
           GTFERTRQ  +++ +  K +  L    G I     +W P  TGDFNSQP D PY+SITSK
Sbjct: 227 GTFERTRQLAILLKKFRKLIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSITSK 286

Query: 296 PVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXP 355
           PVS   E K VIECS AYK+S                +                      
Sbjct: 287 PVSASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEE------- 339

Query: 356 NQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINNDRGEP 415
           + P + RP HF  T EQ +L+++L  +HNS+NL+A SL+ + Y+KV   ++   N + EP
Sbjct: 340 SNPIDPRPSHFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKV---HSIGLNCKNEP 396

Query: 416 ELSEWARMWSGLLDYIFFLQHWDGKTNHEKVD--SLKTFERENNVKLRGLLKMPQSKEMC 473
           ELS  +  W+GLLDYIF L+ W+     EK D  SL+ FE+  +++++GLLKMP+ KE+ 
Sbjct: 397 ELSHTSIFWTGLLDYIFILEPWN---EVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELP 453

Query: 474 EHAIPYKGEYPSDHLCMMIQLEL 496
           ++  P++G+YPSDHL M+  L +
Sbjct: 454 KNVQPHQGQYPSDHLSMICDLNV 476

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  348 bits (893), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/451 (41%), Positives = 269/451 (59%), Gaps = 36/451 (7%)

Query: 61  GFEPDIPS-ELQFIKRPLLTLHDDDPVKGTM------------LKIMTYNCLAQSLIQRD 107
           G +PD P+ +LQFI+RP L ++ D+  KG              +KIMTYN LAQ+LI+RD
Sbjct: 67  GKDPDFPTPDLQFIERPFLPINHDNS-KGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRD 125

Query: 108 LFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKK 167
            FP SG ALKW +RSKVL++ELK Y  D++SLQE+D+ +   +W+    KLG+D  F + 
Sbjct: 126 FFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIFKRH 184

Query: 168 NGKIHGVLIAWKRNLFAKVKSLPIDFDETLSG-TIKPRTRTKNVGLVIALEFLNKDKSAI 226
            GK HG+L+AW    F       +D+D  L+G  I  RTRTKN+ L+I+L F     S+ 
Sbjct: 185 EGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKGITDSS- 243

Query: 227 KKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEKWYPFFTGDFNSQPKD 286
             +G+I+  THLFWH FG FER RQ Y+++ ++ + +K       W+    GDFN++P++
Sbjct: 244 -SRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQE-IKACSKYNGWHSLLMGDFNTEPEE 301

Query: 287 APYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXX 346
            PY++IT +P+  +   + ++ECS AY+YS                ++            
Sbjct: 302 PPYLAITKRPLILKGPIRAMVECSLAYRYS--------------KKRNGEESDQDDEECD 347

Query: 347 XXXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENA 406
                    +QP N +P  FT T+E+  LV+QL ALHNSL+++ +SLY +GY KV PENA
Sbjct: 348 EKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENA 407

Query: 407 YINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKM 466
             N   GEP LS WA  W GLLDYIF+++  D   +  + + L  FE  NNVK+ G L+M
Sbjct: 408 --NGSHGEPGLSNWANTWCGLLDYIFYIE-GDHNQDTRQKEPLNAFEGNNNVKIIGYLRM 464

Query: 467 PQSKEMCEHAIPYKGEYPSDHLCMMIQLELL 497
           P ++EM +H+ P++GEY SDH+ +M Q+ L 
Sbjct: 465 PCAQEMPKHSQPFEGEYASDHISLMCQIRLF 495

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  345 bits (885), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 186/443 (41%), Positives = 254/443 (57%), Gaps = 28/443 (6%)

Query: 61  GFEPDIPSELQFIKRPLLTL-HDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWV 119
           G +PD P+E QFI+RP+L + H D+  +G  L IMTYNCLAQ+LI+R++FP SG ALKW 
Sbjct: 49  GLDPDFPAECQFIERPILLVPHGDNYERGLPLSIMTYNCLAQTLIRREMFPESGPALKWF 108

Query: 120 RRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWK 179
            RSKVLL+E+K+Y++D+  LQEID VQ+  +W   L K GY   ++ ++ K HGV+IAWK
Sbjct: 109 VRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGVMIAWK 168

Query: 180 RNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLN-----KDKSAIKKKGVIIG 234
             LF     + I+FD+     I+PRTRT NVGL++AL F +      ++    + GVIIG
Sbjct: 169 EELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRSGVIIG 228

Query: 235 TTHLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEKWYPFFTGDFNSQPKDAPYVSITS 294
           T HLFWH FGT++RTRQC V+  ++ +F   + G   +   FTGDFNSQP   PY+ +T 
Sbjct: 229 TFHLFWHPFGTYDRTRQCLVIKKKILEFAGTVKG--DYCKMFTGDFNSQPNSVPYLVLTQ 286

Query: 295 KPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXX 354
                  + +  IE S AY+YS                +                     
Sbjct: 287 PRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKREYEYDQG------- 339

Query: 355 PNQPSNA-RPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINNDRG 413
              P N  RP  F  T EQ +LV+ L    N + L A SLYS+GY  VDP +     D  
Sbjct: 340 -TDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHI---ADHH 395

Query: 414 EPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSKEMC 473
           EPELS W+  W+GLLDYIF++        +++  +  TFE  NN+ + G L+MP   +M 
Sbjct: 396 EPELSSWSTKWAGLLDYIFYV--------NQRPSTPATFETANNIAIAGYLQMPTHAQMH 447

Query: 474 EHAIPYKGEYPSDHLCMMIQLEL 496
            H+ PY GEYPSDH+ MM  LE+
Sbjct: 448 NHSQPYTGEYPSDHISMMCALEI 470

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  345 bits (884), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 180/450 (40%), Positives = 270/450 (60%), Gaps = 35/450 (7%)

Query: 61  GFEPDIPS-ELQFIKRPLLTLH----DDDPVKGTML-------KIMTYNCLAQSLIQRDL 108
           G +PD P+ +LQFI+RP L ++     D    G  +       +IMTYN LAQ+LI+RD 
Sbjct: 69  GKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQVPPSSLDVQIMTYNTLAQTLIRRDF 128

Query: 109 FPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKN 168
           FP SG ALKW +RSKVL++ELK Y  D++SLQE+D+ +   +W     KLG+   F +  
Sbjct: 129 FPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELG-FWHENFHKLGFGSTFRRHE 187

Query: 169 GKIHGVLIAWKRNLFAKVKSLPIDFDETLSG-TIKPRTRTKNVGLVIALEFLNKDKSAIK 227
           GK HG+++AW    F +     +D+D  L+G  I  RTRTKN+ L+++L    K+ + + 
Sbjct: 188 GKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISARTRTKNIALIVSLSV--KNMTNLS 245

Query: 228 KKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEKWYPFFTGDFNSQPKDA 287
             GVI+  THLFWH FG FER RQ ++++ ++++ +K       W+    GDFN++P++ 
Sbjct: 246 TSGVIVANTHLFWHPFGVFERLRQSFLVLKKIEE-IKTCPKYYGWHSLLMGDFNTEPEEP 304

Query: 288 PYVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXX 347
           PY++IT +P++     + + ECS AY+YS                +              
Sbjct: 305 PYMAITRRPLTLTGSARAMTECSLAYRYSKMRNGEESDQDEECDEESTGEGQH------- 357

Query: 348 XXXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAY 407
                   +QP N +P +F  T+EQ  LV+QL ALHNSL+++ ISLY + Y KV P+N+ 
Sbjct: 358 --------DQPQNPKPKYFVATKEQKNLVNQLVALHNSLHVKGISLYGLSYGKVHPDNSK 409

Query: 408 INNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMP 467
            N+  GEPELS WA  W GLLDYIF+++  D  ++  K + +K FE +NNVK+ G L+MP
Sbjct: 410 ENH--GEPELSNWANTWCGLLDYIFYIERNDNVSS-SKDEPVKNFEDQNNVKIIGYLRMP 466

Query: 468 QSKEMCEHAIPYKGEYPSDHLCMMIQLELL 497
           +++EM +H+ P++GEY SDH+ +M QL L 
Sbjct: 467 RAEEMPKHSQPFEGEYASDHISLMCQLRLF 496

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  337 bits (864), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/450 (40%), Positives = 257/450 (57%), Gaps = 40/450 (8%)

Query: 65  DIPSELQFIKRPLLTLHDDDPVKGTM--------LKIMTYNCLAQSLIQRDLFPGSGQAL 116
           D+  E+ FIKRPLL +    P  G +        +KIMTYN LAQ+LI+R  FP +  A+
Sbjct: 37  DVAREI-FIKRPLLEV----PYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAI 91

Query: 117 KWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLI 176
           KW RRS+VL+ EL+YYD+D++ LQE D +Q+ ++W     +LGY   F+   GK+HGV I
Sbjct: 92  KWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAI 151

Query: 177 AWKRNLF--AKVKSLPIDFDETLSG-TIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVII 233
            WK ++F    +  LP+  D+ ++G  I   T T+ V L +AL   +   S    + +I 
Sbjct: 152 VWKTSMFEDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTS----RPIIF 207

Query: 234 GTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGI-----EKWYPFFTGDFNSQPKDAP 288
            TTHLFWHLFGTFERTRQ +V++ +++KF+KK+        ++ Y FFTGDFNSQP DAP
Sbjct: 208 STTHLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAP 267

Query: 289 YVSITSKPVSFQNETKIVIECSAAYKYSXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXX 348
           Y+S+T KPV  +   K +IECS +Y+YS                +               
Sbjct: 268 YLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDET---- 323

Query: 349 XXXXXXPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENA-- 406
                  N+P + RP  +    EQ E V  L  LHN + L+ +SLY +GY  V PEN+  
Sbjct: 324 -------NRPQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNK 376

Query: 407 YINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKM 466
           Y  +   EP+LS  A  WSGLLDYIF +  W    N  K+  L+  ER+  +K+ G L+M
Sbjct: 377 YSTSVNQEPQLSHRALHWSGLLDYIFLITEW--SENATKISDLQALERQTGIKINGYLRM 434

Query: 467 PQSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496
           P  +EMC+H  P++ EYPSDHL MM  + L
Sbjct: 435 PLKEEMCDHTEPHENEYPSDHLAMMCDISL 464

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 104/235 (44%), Gaps = 32/235 (13%)

Query: 79  TLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLL 137
           T H ++ +      +++YN L        ++  +   AL W  R + L  +L  +D+D++
Sbjct: 442 TNHMNNTLLKNSFTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVI 501

Query: 138 SLQEIDFVQFKQYWKIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVK 187
            LQE++ + +++YW  ++ K  Y C F+ K          + K+ G  I +K++ F  V 
Sbjct: 502 CLQEVETLTYEEYWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVF 561

Query: 188 SLPIDFDETLSGTIK--------PRTRTK-NVGLVIALEFLNKDKSAIKKKGVIIGTTHL 238
              IDF        K         R   K NV L+  L+ LN +++      V + TTHL
Sbjct: 562 QDSIDFSSAWRSHKKFHRTEDYLNRAMNKDNVALIAELKHLNTNEN------VWVVTTHL 615

Query: 239 FWHLFGTFERTRQCYVMMDQMDKFMKKL------GGIEKWYPFFTGDFNSQPKDA 287
            W       +T Q  VM+D ++  +K+         I+K      GDFNSQ   A
Sbjct: 616 HWDPQFNDVKTFQVGVMLDYLETLIKQHHHVNNNNDIKKIPMVICGDFNSQLDSA 670

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 95/217 (43%), Gaps = 32/217 (14%)

Query: 93  IMTYNCLAQSLIQRDLFP-GSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++      AL W  R + L +E+  Y +D++ LQE++   ++++W
Sbjct: 400 LLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKTYEEFW 459

Query: 152 KIVLAKLGYDCEFYKKN----------GKIHGVLIAWKRNLFAKVKSLPIDFD------- 194
             +L K GY   F+ K            K+ G  I +K + F  V    IDF        
Sbjct: 460 LPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWMKHK 519

Query: 195 --ETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQC 252
             +     +       NV L+I L      +     + V + TTHL W       +T Q 
Sbjct: 520 KFQRTEDYLNRAMNKDNVALIIKL------RHERTGEHVWVVTTHLHWDPHFNDVKTFQV 573

Query: 253 YVMMDQMDKFMKKLGGI-----EKWYPF-FTGDFNSQ 283
            VM+D ++K +K+ GG+     +K  P    GDFNSQ
Sbjct: 574 AVMLDYIEKLLKQHGGVGSPQDKKKIPLVICGDFNSQ 610

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 99/238 (41%), Gaps = 32/238 (13%)

Query: 91  LKIMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQ 149
             +++YN L Q      ++  +   AL W  R   L  ++  YDSD+L LQE++   F+ 
Sbjct: 537 FSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSKLKEQILSYDSDVLCLQEVESKTFED 596

Query: 150 YWKIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFD----- 194
           YW  +L K GY   FY K          + K+ G  I +KR+ F  V    +DF      
Sbjct: 597 YWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWMK 656

Query: 195 ----ETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTR 250
               +     +       NV L + L+ ++   +      + + TTHL W       +T 
Sbjct: 657 HKKFQRTEDYLNRAMNKDNVALFLKLQHVSSGDT------IWVVTTHLHWDPKFNDVKTF 710

Query: 251 QCYVMMDQMDKFMKK------LGGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNE 302
           Q  V++D ++  +K+         I+K      GDFNS    A Y  I++  V    E
Sbjct: 711 QVGVLLDHLESLLKEDTTHNSRQDIKKSPVLICGDFNSYINSAVYELISTGRVQVHQE 768

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 98/236 (41%), Gaps = 32/236 (13%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++  +   AL W  R   L  ++  YDSDLL LQE++   F++YW
Sbjct: 507 VLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEEYW 566

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFD------- 194
             +L K GY   F+ K          + K+ G  I +KR+ F  +    +DF        
Sbjct: 567 VPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMKHK 626

Query: 195 --ETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQC 252
             +     +       NV L + L+ +    +      +   TTHL W       +T Q 
Sbjct: 627 KFQRTEDYLNRAMNKDNVALFLKLQHIPSGDT------IWAVTTHLHWDPKFNDVKTFQV 680

Query: 253 YVMMDQMDKFMKKLGG------IEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNE 302
            V++D ++  +K+         I+K+     GDFNS    A Y  I +  V    E
Sbjct: 681 GVLLDHLETLLKEETSHNFRQDIKKFPVLICGDFNSYINSAVYELINTGRVQIHQE 736

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 95/220 (43%), Gaps = 26/220 (11%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           IM+YN L Q      ++  +   AL W  R + L  E+  Y +D++ LQE++   ++++W
Sbjct: 526 IMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEEHW 585

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFDET----- 196
             ++ K GY   F+ K          + K+ G  + +K + F       +DF  T     
Sbjct: 586 APLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMKHK 645

Query: 197 -LSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQCYVM 255
               T     R  N   V+    LN  KS    + V I TTHL W       +T Q  ++
Sbjct: 646 KFQRTEDYLNRAMNKDNVVIYIKLNHLKSG---ESVWIATTHLHWDPQFNDVKTFQVGIL 702

Query: 256 MDQMDKFMKKLGG------IEKWYPFFTGDFNSQPKDAPY 289
           MD +++ +K+ G        +K      GDFNSQ   A Y
Sbjct: 703 MDHLEELIKEHGSPSSRQDPKKSPVIICGDFNSQKDSAVY 742

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 98/236 (41%), Gaps = 32/236 (13%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++  +   AL W  R   L  ++  Y SD+L LQE++   F+ YW
Sbjct: 501 VLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFEDYW 560

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFD------- 194
             +L K GY   F+ K          + K+ G  I +KR+ F  V    +DF        
Sbjct: 561 VPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWMKHK 620

Query: 195 --ETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQC 252
             +     +       NV L + L+ ++   +      + + TTHL W       +T Q 
Sbjct: 621 KFQRTEDYLNRAMNKDNVALFLKLQHVSSGDT------IWVVTTHLHWDPKFNDVKTFQV 674

Query: 253 YVMMDQMDKFMKK------LGGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNE 302
            V++D ++  +K+         I+K      GDFNS    A Y  I++  V    E
Sbjct: 675 GVLLDHLETLLKEDTTHNSRQDIKKSPVLICGDFNSYINSAVYELISTGRVQAHQE 730

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 104/230 (45%), Gaps = 31/230 (13%)

Query: 86  VKGTMLK----IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQ 140
           V+  +LK    I++YN L Q      ++  +   AL+W  R + L  ++  Y  D+L LQ
Sbjct: 457 VEAGLLKKSFTILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQ 516

Query: 141 EIDFVQFKQYWKIVLAKLGYDCEFY----------KKNGKIHGVLIAWKRNLFAKVKSLP 190
           E++   ++ +W  +L K GY   F+          K + K+ G  + +K++ F  +    
Sbjct: 517 EVESKTYEDFWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEA 576

Query: 191 IDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAI--KKKGVIIG------TTHLFWHL 242
           +DF    SG  +   R +     +    +NKD  AI  K + V  G      TTHL W  
Sbjct: 577 LDF----SGAWQKHKRFQRTEDYLN-RAMNKDNVAIYMKLQHVQSGEYLWVVTTHLHWDP 631

Query: 243 FGTFERTRQCYVMMDQMDKFMKKLG---GIEKWYPFFTGDFNSQPKDAPY 289
                +T Q  V++D M+  +K+      ++K+    TGDFNS    A Y
Sbjct: 632 KFNDVKTFQVGVLLDHMESIIKEENPKQDVKKFPIIITGDFNSYLTSAVY 681

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 100/231 (43%), Gaps = 32/231 (13%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++  +   AL W  R + L  ++ YY +D++ LQE++   ++ +W
Sbjct: 412 LLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFW 471

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFD------- 194
             +L + GY   F+ K          + K+ G  + ++ + F  +    +DF        
Sbjct: 472 APLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHK 531

Query: 195 --ETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQC 252
             +     +       NV L++ L+ L   +       V   TTHL W       +T Q 
Sbjct: 532 KFQRTEDYLNRAMNKDNVALLVKLQHLKSGEH------VWAATTHLHWDPQFNDVKTFQV 585

Query: 253 YVMMDQMDKFMKKLGG------IEKWYPFFTGDFNSQPKDAPYVSITSKPV 297
            V++D M+K +K+  G      ++K      GDFNSQ   A Y  +++  V
Sbjct: 586 GVLLDHMEKVIKEHSGYNNSQELKKVPVIICGDFNSQVDSAVYELLSTGSV 636

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (42%), Gaps = 32/221 (14%)

Query: 93  IMTYNCLAQSLIQRDLFP-GSGQALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++      AL W  R + L  E+  Y +D++ LQE++   ++++W
Sbjct: 447 LLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEEFW 506

Query: 152 KIVLAKLGYDCEFYKKN----------GKIHGVLIAWKRNLFAKVKSLPIDFD------- 194
             +L K GY   F+ K            K+ G  I +K + F+ +    IDF        
Sbjct: 507 LPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMKHK 566

Query: 195 --ETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQC 252
             +     +       N+ L++ L      K  +  + V + TTHL W       +T Q 
Sbjct: 567 KFQRTEDYLNRAMNKDNIALIVKL------KHELSGEHVWVVTTHLHWDPHFNDVKTFQV 620

Query: 253 YVMMDQMDKFMKKLGGI-----EKWYPF-FTGDFNSQPKDA 287
            V++D ++K +K+   I     +K  P    GDFNSQ   A
Sbjct: 621 GVLLDYIEKLLKQQSNIGNPQEKKKVPLIICGDFNSQSHSA 661

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 99/227 (43%), Gaps = 27/227 (11%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++  +   AL W  R   L +++  Y  D++ LQE++   F+ +W
Sbjct: 437 VLSYNTLCQHYATPKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFEDFW 496

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTI 201
             +L K GY   F+ K          + K+ G  + +KR  F  +K   +DF  T     
Sbjct: 497 LPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMKHE 556

Query: 202 KPRTRTKNVGLVIALEFLNKDKSAI--------KKKGVIIGTTHLFWHLFGTFERTRQCY 253
           K + RT++         +NKD  A+          + + + TTHL W       +T Q  
Sbjct: 557 KFQ-RTED----FLNRAMNKDNIALYFKLQHIASGEHIWVATTHLHWDPKFNDVKTFQVG 611

Query: 254 VMMDQMDKFMKKLG---GIEKWYPFFTGDFNSQPKDAPYVSITSKPV 297
           V++D +   +++      ++K      GDFNS    A Y  ++S  V
Sbjct: 612 VLLDHLQTLIRQDNPRQDVKKAPVIICGDFNSYIDSAVYELLSSGSV 658

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 97/236 (41%), Gaps = 32/236 (13%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++  +   AL W  R   L  ++  YDSDLL LQE++   F+ YW
Sbjct: 509 VLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEDYW 568

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFD------- 194
             +L K GY   F+ K          + K+ G  I +K++ F  +    +DF        
Sbjct: 569 VPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMKHK 628

Query: 195 --ETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQC 252
             +     +       NV L + L+ +    +      +   TTHL W       +T Q 
Sbjct: 629 KFQRTEDYLNRAMNKDNVALFLKLQHIPSGDT------IWAVTTHLHWDPKFNDVKTFQV 682

Query: 253 YVMMDQMDKFMKK------LGGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNE 302
            V++D ++  +++         I+K      GDFNS    A Y  I++  V    E
Sbjct: 683 GVLLDHLETLLREETTHNFRQDIKKSPVLICGDFNSYINSAVYELISTGRVQINQE 738

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 96/231 (41%), Gaps = 32/231 (13%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++  +   AL W  R   L  ++  + +D++ LQE++   F+ +W
Sbjct: 401 LLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVVCLQEVECKTFEDFW 460

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFD------- 194
              L K GY   F+ K          + K+ G  + +K + F  V    +DF        
Sbjct: 461 APFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWMKHK 520

Query: 195 --ETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQC 252
             +     +       NV L + L+ L  ++       + + TTHL W       +T Q 
Sbjct: 521 KFQRTEDYLNRAMNKDNVALFVKLQHLKTNEQ------IWVTTTHLHWDPQFNDVKTFQV 574

Query: 253 YVMMDQMDKFMKKLGGI------EKWYPFFTGDFNSQPKDAPYVSITSKPV 297
            V++D M+K ++   G+      +K      GDFNSQ   A Y   +S  V
Sbjct: 575 GVLLDYMEKLLRDQNGVGNNQEMKKVPLVICGDFNSQLDSAVYELFSSGTV 625

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 101/237 (42%), Gaps = 30/237 (12%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++  +   AL W  R + L  ++  Y +D++ LQE++   F++YW
Sbjct: 466 VLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEEYW 525

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTI 201
             ++ K GY   F+ K          + K+ G  + ++ N F       +DF    SG  
Sbjct: 526 APLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDF----SGVW 581

Query: 202 KPRTRTKNVGLVIALEFLNKDKSAIKKK--------GVIIGTTHLFWHLFGTFERTRQCY 253
           +   + +     +    +NKD  AI  K         V I TTHL W       +T Q  
Sbjct: 582 QKHKKFQRTEDYLN-RAMNKDNVAIYLKLQHIKSGESVWIVTTHLHWDPQFNDVKTFQVG 640

Query: 254 VMMDQMDKFMKKLGGIE------KWYPFFTGDFNSQPKDAPYVSITSKPVSFQNETK 304
           V+MD ++  +K+    +      K      GD NS+   A Y  +++  V   ++ K
Sbjct: 641 VLMDHIENLLKEQSNAQSKQEAKKCPVILCGDLNSEIHSAVYELLSTGRVQAHDDIK 697

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 98/232 (42%), Gaps = 32/232 (13%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           I++YN L Q      ++  +   AL W  R + L  ++  Y++D++ LQE++   ++ +W
Sbjct: 410 ILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKTYEDFW 469

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFD------- 194
             +L + GY   F+ K          + K+ G    +K + F  +    +DF        
Sbjct: 470 APLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWMKHK 529

Query: 195 --ETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQC 252
             +     +       NV LV+ L+ +   +       V   TTHL W       +T Q 
Sbjct: 530 KFQRTEDYLNRAMNKDNVALVVKLQHIKSGEH------VWAATTHLHWDPQFNDVKTFQV 583

Query: 253 YVMMDQMDKFMKKLGG------IEKWYPFFTGDFNSQPKDAPYVSITSKPVS 298
            V++D M+K +K+         ++K      GDFNSQ   A Y  + +  VS
Sbjct: 584 GVLLDYMEKVIKEQNNCNNTQELKKVPVVICGDFNSQTNSAVYELLNTGNVS 635

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 98/235 (41%), Gaps = 29/235 (12%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           I++YN L Q      ++  +   AL W  R + L  ++  Y SD+L LQE++   F+++W
Sbjct: 571 ILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEEFW 630

Query: 152 KIVLAKLGYDCEFY----------KKNGKIHGVLIAWKRNLFAKVKSLPIDFDET----- 196
             +L K  Y   F+          K++ K+ G  I +K++ F  +    +DF  T     
Sbjct: 631 GPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMKHK 690

Query: 197 ----LSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQC 252
                   +       NV L + L+      S    + V + TTHL W       +T Q 
Sbjct: 691 KFQRTEDYLNRAMNKDNVALYMKLQ------SITSGETVWVVTTHLHWDPKFNDVKTFQV 744

Query: 253 YVMMDQMDKFMKKLG---GIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNETK 304
            +++D M+  +K+      ++K      GD NS    A Y   T+  V    + K
Sbjct: 745 GILLDHMETLLKEENPKQDVKKANVVICGDLNSYLDSAVYELFTTGRVVNHQDNK 799

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 99/245 (40%), Gaps = 36/245 (14%)

Query: 83  DDPVKGTMLK----IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLL 137
           D  +   MLK    +++YN L Q      ++  +    L W  R + L N++    SD++
Sbjct: 528 DSHISTEMLKKSFTVLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVI 587

Query: 138 SLQEIDFVQFKQYWKIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVK 187
            LQE++   ++ +W  +L K GY   F+ K          + K+ G  I +K + F    
Sbjct: 588 CLQEVEAQTYEDFWLPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQH 647

Query: 188 SLPIDFD---------ETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHL 238
              +DF          +     +       NV L + LE +N  +S      V + TTHL
Sbjct: 648 QESVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALFVKLEHINSGES------VWVVTTHL 701

Query: 239 FWHLFGTFERTRQCYVMMDQMDKFMKKLGG------IEKWYPFFTGDFNSQPKDAPYVSI 292
            W       +T Q  V++D ++  +K          I K      GD NS  + A Y  +
Sbjct: 702 HWDPQFNDVKTFQVGVLLDHLESLLKDYNNASSKQEIRKCPVIICGDLNSHLQSAVYELL 761

Query: 293 TSKPV 297
           ++  V
Sbjct: 762 STGHV 766

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 93/223 (41%), Gaps = 32/223 (14%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++  +   AL W  R + L +++  + SD++ LQE++   ++++W
Sbjct: 454 VLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEEFW 513

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFD------- 194
             +L K GY   FY K          + K+ G  I +K + F  +    +DF        
Sbjct: 514 LPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMKHK 573

Query: 195 --ETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQC 252
             +     +       NV L + LE +   +S      V + TTHL W       +T Q 
Sbjct: 574 KFQRTEDYLNRAMNKDNVALYMKLEHIKSGES------VWVVTTHLHWDPQFNDVKTFQV 627

Query: 253 YVMMDQMDKFMKKLGG------IEKWYPFFTGDFNSQPKDAPY 289
            +++D +++ +K          I K      GD NS    A Y
Sbjct: 628 GILLDHLEELLKDNNNASSKQEIRKCPVIICGDLNSHLDSAVY 670

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 94/220 (42%), Gaps = 29/220 (13%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++  +   AL W  R + L +++  Y SD+L LQE++   F+++W
Sbjct: 528 LLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEEFW 587

Query: 152 KIVLAKLGYDCEFY----------KKNGKIHGVLIAWKRNLFAKVKSLPIDFDET----- 196
             +L K  Y   F+          K + K+ G  I +K++ F  +    +DF  T     
Sbjct: 588 SPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDFSGTWMKHK 647

Query: 197 ----LSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQC 252
                   +       NV L + L+ L   +S      V + TTHL W       +T Q 
Sbjct: 648 KFQRTEDYLNRAMNKDNVALYLKLQSLTSGES------VWVVTTHLHWDPKFNDVKTFQV 701

Query: 253 YVMMDQMDKFMKKLG---GIEKWYPFFTGDFNSQPKDAPY 289
            +++D M+  +K+      ++K      GD NS    A Y
Sbjct: 702 GILLDHMEALLKEENPKQDVKKANVVICGDLNSYFDSAVY 741

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 96/225 (42%), Gaps = 36/225 (16%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++  +   AL W  R   L +++  + SD+L LQE++   +  +W
Sbjct: 566 VLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDDFW 625

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGT- 200
           + +L K GY   F+ K          + K+ G  I +K + F  +    +DF    SG  
Sbjct: 626 EPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDF----SGIW 681

Query: 201 --IKPRTRTKNVGLVIALEFLNKDKSAIK------KKGVI--IGTTHLFWHLFGTFERTR 250
              K   RT++         +NKD  AI       K G +  I TTHL W       +T 
Sbjct: 682 MKHKNFQRTEDY----LNRAMNKDNVAIYMKLQHIKSGEVTWIVTTHLHWDPQFNDVKTF 737

Query: 251 QCYVMMDQMDKFMKKLGGI------EKWYPFFTGDFNSQPKDAPY 289
           Q  V++D ++  +K+   I      +K      GD NS    A Y
Sbjct: 738 QVGVLLDHLESLLKEHSNIHSKQDVKKCPIIICGDLNSYLDSAVY 782

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 103/234 (44%), Gaps = 27/234 (11%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQ-ALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYW 151
           +++YN L Q      ++  +   AL W  R + L  ++  +++D++ LQE++   F+ +W
Sbjct: 540 MLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFEDFW 599

Query: 152 KIVLAKLGYDCEFYKK----------NGKIHGVLIAWKRNLFAKVKSLPIDFDETLSGTI 201
           + +L K GY   F+ K          + K+ G    +K + F  +    +DF   L    
Sbjct: 600 QPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDF-SGLWMKH 658

Query: 202 KPRTRTKNVGLVIALEFLNKDKSAIKKK------GVI--IGTTHLFWHLFGTFERTRQCY 253
           K   RT++         +NKD  AI  K      G I  + TTHL W       +T Q  
Sbjct: 659 KKFQRTEDY----LNRAMNKDNVAIVMKLQHIQSGEIMWLVTTHLHWDPKFNDVKTFQVG 714

Query: 254 VMMDQMDKFMKKLG---GIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNETK 304
           V++D M+  +K+      ++K+     GD NS    + Y   ++  V   ++ K
Sbjct: 715 VLLDHMETLLKEQNPKQDVKKYPLVICGDLNSYLSSSVYELFSTGRVQHHHDGK 768

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 105/260 (40%), Gaps = 60/260 (23%)

Query: 91  LKIMTYNCLAQSLIQRDLFP-GSGQALKWVRRSKVLLNE-LKYYDSDLLSLQEIDFVQFK 148
           L ++TYN L+   +   ++     +  KW  R K+L  E L  Y +D++ LQE+  + ++
Sbjct: 22  LSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGLYRADIMCLQELTSLDYQ 81

Query: 149 QYW-KIVLAKLGYDCEFYKKN---------GKIHGVLIAWKRNLFAKVKSLPIDFDE--- 195
           QYW K+++ K  Y  ++  K           ++ GV + +  N F  + S  I  ++   
Sbjct: 82  QYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDYISSTGIYLNDLFG 141

Query: 196 ----------------------------TLSGTIKPRTRTKNVGLVIALEFLNKDKSAIK 227
                                       TLS  +K R +   V + ++L      +    
Sbjct: 142 TFDLKEQNYLEHKMLQLTDGQGNPMEKMTLSDVLKGRNQ---VCMFVSL------RHKAT 192

Query: 228 KKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKK-LGGIE-----KWYPFFTGDFN 281
              +I+  THL+W       +  QC ++M ++ K +K  L G++     K    F GD N
Sbjct: 193 NTFLIVINTHLYWKYDEV--KLAQCMIIMRRLSKIIKDLLIGVQDTTYNKVKIIFAGDMN 250

Query: 282 SQPKDAPYVSITSKPVSFQN 301
           S         +   PVS +N
Sbjct: 251 SSRDSLVVKFLKGDPVSHEN 270

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 97/238 (40%), Gaps = 60/238 (25%)

Query: 94  MTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNE-LKYYDSDLLSLQEIDFVQFKQYW 151
           MTYN L+   +   ++       K W  R K+L  E L  Y +D++ LQE+    + QYW
Sbjct: 32  MTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDYHQYW 91

Query: 152 KIVLAK-LGYDCEF--------YKKNGK-IHGVLIAWKRNLFAKVKSLPI---------D 192
           + V+ +   Y   F        ++K+ K + GV I +  N F  + S  I         D
Sbjct: 92  EEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLIGSFD 151

Query: 193 FDE----------------------TLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKKG 230
            DE                      TL   +K R +   VGL +AL+  +KD + I    
Sbjct: 152 LDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQ---VGLFVALK--HKDTNTI---- 202

Query: 231 VIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL------GGIEKWYPFFTGDFNS 282
            ++  THL+W       +  QC ++M ++ K ++ L          K    F GD NS
Sbjct: 203 FVVINTHLYWKYDEV--KLTQCLIIMRKLAKIIRDLLVGEHGTTYNKMKVVFAGDLNS 258

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 93/225 (41%), Gaps = 35/225 (15%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNE-LKYYDSDLLSLQEIDFVQFKQY 150
           ++TYN L+QS +   ++       K W  R K+L  E LK Y++D++ LQE+    ++ Y
Sbjct: 24  LLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYEYY 83

Query: 151 WKIVLAKLGYDCEFY---------KKNGKIHGVLIAWKRNLFAKVKS--------LPIDF 193
           W+  L+K     +F          K    + GV I +  ++F  + S        L  DF
Sbjct: 84  WRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLISDF 143

Query: 194 DETLSGTIKPRT------RTKNVGLVIALEFLNKDKSA-----IKKKGVIIGTTHLFWHL 242
           ++     +  R         + + +   L+ L +         +K K        +  HL
Sbjct: 144 EQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKNQVCLFMTLKHKRTGATVVVVTTHL 203

Query: 243 FGTFERTR--QCYVMMDQMDKFMK---KLGGIEKWYPFFTGDFNS 282
           +  ++  +  QC ++M Q+ K MK   K  G       F GD NS
Sbjct: 204 YWKYDEIKLTQCMIIMRQLSKIMKDQLKKDGSSFVKVLFAGDLNS 248

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 100/247 (40%), Gaps = 43/247 (17%)

Query: 85  PVKGTMLKIMTYNCLAQSLIQRDLFP-GSGQALKWVRRSKVLLNEL-KYYDSDLLSLQEI 142
           P       ++TYN L+ + +   ++     Q  +W  R  +L  EL   Y +D++ +QE+
Sbjct: 33  PKHDNRFTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEM 92

Query: 143 DFVQFKQYWK-IVLAKLGYDCEFYKKNG---------KIHGVLIAWKRNLFAKVKSLPID 192
               ++Q+W  I   K     EF  K           ++ GV I + R +F  V S  I 
Sbjct: 93  TKRDYQQFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIY 152

Query: 193 FDETLSG----------------TIKPRTRTKNVGLVIALEFLNKDKSAI----KKKGV- 231
            ++ L                  T      T    L+  L+  N+    +    K  G+ 
Sbjct: 153 LNQMLDAFNDHELEYLGQKKLGLTDGAGNPTGETNLLNFLKLKNQVSLFVSLQHKSTGMY 212

Query: 232 -IIGTTHLFWHLFGTFERTRQCYVMMDQM----DKFMKKLGGI--EKWYPFFTGDFNSQP 284
            ++  THL+W       +  QC V+M ++    D  +K +  +  EK    FTGD NS  
Sbjct: 213 FVVINTHLYWKYDEV--KLTQCMVIMRELSQIIDDLLKDVPDVTKEKVKIIFTGDLNST- 269

Query: 285 KDAPYVS 291
           K++P ++
Sbjct: 270 KNSPVIN 276

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 99/231 (42%), Gaps = 40/231 (17%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNEL-KYYDSDLLSLQEIDFVQFKQY 150
           ++TYN L+ S +   ++       K W  R K+L +EL   Y +D++ LQE+    + + 
Sbjct: 32  LLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDYNEN 91

Query: 151 WKIVLAK-LGYDCEFYKKN---------GKIHGVLIAWKRNLFAKVKSLPI---DFDETL 197
           WK +L   +GY  +F  K+          +I GV I +    F  + S  I    F    
Sbjct: 92  WKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFDFISSSGIYLNQFLNVF 151

Query: 198 SGT------IKPRTRTKNVGLVIALEFL-----NKDKSAI------KKKG--VIIGTTHL 238
           S T       K    T   G+ I  + L      K++  +      K+ G   ++  THL
Sbjct: 152 SSTELEYLHSKRLVLTDGAGVPIGEKNLLDVISGKNQVCLFVSLKHKETGEMFVVINTHL 211

Query: 239 FWHLFGTFERTRQCYVMMDQMDKFMKKL-GGIE---KWYPFFTGDFNSQPK 285
           +W       +  QC ++M ++ K + +L  G++   K    FTGD NS  K
Sbjct: 212 YWKYDEV--KLTQCMIIMRELSKIIDELVKGVDDPGKVKILFTGDLNSTKK 260

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 100/234 (42%), Gaps = 44/234 (18%)

Query: 90  MLKIMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNEL-KYYDSDLLSLQEIDFVQF 147
           +  +++YN L+ S +   ++    +  K W  R K+L  EL   Y +D++ LQE+    +
Sbjct: 21  LFTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDY 80

Query: 148 KQYWKIVL-AKLGYDCEFYKKN---------GKIHGVLIAWKRNLFAKVKSLPIDFDETL 197
             +WK  L   + Y   +  K           ++ GV I +  + F  +    I  ++ L
Sbjct: 81  SNFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLL 140

Query: 198 SGTI----------KPRTRTKNVGLVIALEFL-----NKDKSAI------KKKG--VIIG 234
            G            KP T T   G  +  + L     +K++ A+      K+ G   ++ 
Sbjct: 141 -GVFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNVFVVI 199

Query: 235 TTHLFWHLFGTFERTRQCYVMMDQMDKFMKK-LGGIE-----KWYPFFTGDFNS 282
            THL+W       +  QC ++M ++ + ++K L G+E     K    FTGD NS
Sbjct: 200 NTHLYWKYDDV--KLTQCMIIMRELARIIEKHLVGLENVTDDKIKILFTGDLNS 251

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 97/246 (39%), Gaps = 52/246 (21%)

Query: 83  DDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNEL-KYYDSDLLSLQ 140
           + P       ++TYN L+   +   ++    +  K W  R ++L +EL K Y +D++ LQ
Sbjct: 22  NKPFFNNKFTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQ 81

Query: 141 EIDFVQFKQYW-KIVLAKLGYDCEFYKK---------NGKIHGVLIAWKRNLFAKVKSLP 190
           E+    +  +W K +   L Y   F  K           ++ GV I +  + F  + S  
Sbjct: 82  ELTTKDYHNFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSS 141

Query: 191 IDFDETLSGTIKPR----------TRTKNVGLVIALEFL-----------------NKDK 223
           I  ++ L G    R          T T   G  I  + L                 +KD 
Sbjct: 142 IYLNDVL-GIFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDT 200

Query: 224 SAIKKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKK-LGGIE-----KWYPFFT 277
           + +     ++  THL+W       +  QC  +M ++++ +K  L G+E     K    F+
Sbjct: 201 NTV----FVVINTHLYWKYDEV--KLSQCLTIMRKLERIIKSLLMGVEGVTYSKVKILFS 254

Query: 278 GDFNSQ 283
           GD NS 
Sbjct: 255 GDLNSN 260

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 102/233 (43%), Gaps = 48/233 (20%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNELKY-YDSDLLSLQEIDFVQFKQY 150
           ++TYN L+   +   ++       K W  R ++L +EL Y Y SD++ LQE+    + ++
Sbjct: 36  MLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDYNEF 95

Query: 151 WKI-VLAKLGYDCEFYKKNGK---------IHGVLIAWKRNLFAKVKSLPIDFDETLSGT 200
           WK  ++ ++ Y   F  K            + GV I +  + F  + S  +  ++ L GT
Sbjct: 96  WKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLND-LVGT 154

Query: 201 IKPR----------TRTKNVGLVI---ALEFLNKDKSAI----------KKKGVIIGTTH 237
              +          T T   G VI   +L  + K ++ +           K  +++  TH
Sbjct: 155 FDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESKSIIVVINTH 214

Query: 238 LFWHLFGTFERTR--QCYVMMDQMDKFMKK-LGGIE-----KWYPFFTGDFNS 282
           L+W     ++  +  QC ++M ++ + +K  L GIE          F+GDFNS
Sbjct: 215 LYW----KYDEVKLVQCLIIMRKLQRIIKGLLMGIEGVTYSNVKILFSGDFNS 263

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 96/235 (40%), Gaps = 41/235 (17%)

Query: 87  KGTMLKIMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNEL-KYYDSDLLSLQEIDF 144
           K     ++TYN L+ S +   ++    +  K W  R ++L  EL   + +D++ LQE+  
Sbjct: 23  KDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTA 82

Query: 145 VQFKQYW-KIVLAKLGYDCEFYKKN---------GKIHGVLIAWKRNLFAKVKSLPIDFD 194
             ++ YW   +   + Y  +F  K            + GV I +    F  + S  I  +
Sbjct: 83  RDYEDYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLN 142

Query: 195 ETLSG---------TIKPRTRTKNVGLVIALEFL-----NKDKSAI------KKKGVI-- 232
           + L+            K  T T     VI  + L      K++  +      K+ G I  
Sbjct: 143 QLLNVFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETGTIFV 202

Query: 233 IGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL-----GGIEKWYPFFTGDFNS 282
           +  THL+W       +  QC ++M ++ K +K+L      G E+    FTGD NS
Sbjct: 203 VLNTHLYWKYDEV--KLTQCMIIMRELSKIIKQLLPGDVKGQERVKILFTGDLNS 255

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 100/235 (42%), Gaps = 41/235 (17%)

Query: 87  KGTMLKIMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNEL-KYYDSDLLSLQEIDF 144
           K     ++TYN L+ S +   ++    +  K W  R K+L  EL   + +D++ LQE+  
Sbjct: 23  KDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFKADIMCLQEMTA 82

Query: 145 VQFKQYWK-IVLAKLGYDCEF-------YKKN--GKIHGVLIAWKRNLFAKVKSLPIDFD 194
             ++ YW+  +   + Y  +F       Y KN    + GV I +    F  + S  I  +
Sbjct: 83  RDYEDYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGIYLN 142

Query: 195 ETLSG---------TIKPRTRTKNVGLVIALEFL-----NKDKSAI------KKKGV--I 232
           + L+            K  T T     ++  + L      K++  +      K+ G   +
Sbjct: 143 QLLNVFNERELKYLFNKKVTLTDGASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGTVFV 202

Query: 233 IGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL--GGIE---KWYPFFTGDFNS 282
           +  THL+W       +  QC ++M ++ K +K+L  G ++   K    FTGD NS
Sbjct: 203 VLNTHLYWKYDEV--KLTQCMIIMRELSKIIKQLLSGDVKSQRKVKILFTGDLNS 255

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 93/235 (39%), Gaps = 41/235 (17%)

Query: 87  KGTMLKIMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNEL-KYYDSDLLSLQEIDF 144
           K     ++TYN L+ S +   ++    +  K W  R K+L  EL   + +D++ LQE+  
Sbjct: 23  KDARFTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTT 82

Query: 145 VQFKQYW-KIVLAKLGYDCEFYKKN---------GKIHGVLIAWKRNLFAKVKSLPIDFD 194
             ++ YW   +   + Y  +F  K            + GV I +    F  + S  I  +
Sbjct: 83  RDYENYWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLN 142

Query: 195 ETLSG---------TIKPRTRTKNVGLVIA----LEFLNKDKS-----AIKKKGV----I 232
           + L+            K  T T     VI     L+ L          ++K K      +
Sbjct: 143 QLLNVFNERELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLKHKETNTIFV 202

Query: 233 IGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL-----GGIEKWYPFFTGDFNS 282
           +  THL+W       +  QC ++M ++ K +K+L        EK    FTGD NS
Sbjct: 203 VLNTHLYWKYDEV--KLTQCMIIMRELSKIIKQLLPGDANAQEKVKILFTGDLNS 255

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 56/255 (21%), Positives = 102/255 (40%), Gaps = 59/255 (23%)

Query: 84  DPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNE-LKYYDSDLLSLQE 141
           + V  +   +MTYN L+   +   ++    +  K W  R ++L  E L  Y +D++ +QE
Sbjct: 23  NSVSRSTFTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQE 82

Query: 142 IDFVQFKQYWKIVL-AKLGYDCEFYKKN---------GKIHGVLIAWKRNLFAKVKSLPI 191
           +    ++ +WK     K+ Y   +  K           ++ GV I +  N F  + +  I
Sbjct: 83  LTCKDYEGFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSI 142

Query: 192 DFDET-----------LSGTIKPRTR-----------------TKNVGLVIALEFLNKDK 223
             ++            L  TI   T                     V L ++L  L+K+ 
Sbjct: 143 YLNDLIGLFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSL--LHKET 200

Query: 224 SAIKKKGVIIGTTHLFWHLFGTFERTR--QCYVMMDQMDKFMKK-LGGIE-----KWYPF 275
             +     ++  THL+W     ++  +  QC  +M ++ + +K  L G+E     K    
Sbjct: 201 RTL----FVVVNTHLYW----KYDEVKLCQCLTIMRKLHRVIKSLLMGMEGVTYSKVKIL 252

Query: 276 FTGDFNSQPKDAPYV 290
           F GD NS P D+P +
Sbjct: 253 FAGDLNSAP-DSPVI 266

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 93/230 (40%), Gaps = 43/230 (18%)

Query: 73  IKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNE-LK 130
           I++P  TL      K      ++YN L+   +   ++    Q  K W  R  +L  E L 
Sbjct: 29  IQQPHQTL---PAAKNPTFTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLLEKEILD 85

Query: 131 YYDSDLLSLQEIDFVQFKQYWKIVLAK-LGYDCEFYKKNG---------KIHGVLIAWKR 180
            Y SD++ +QE+  + +  +W+  L K   Y   F  KN          ++ GV I +  
Sbjct: 86  KYRSDIMCVQELTTIDYYSFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGVGIFYNL 145

Query: 181 NLFAKVKSLPIDFDETLSG---------TIKPRTRTKNVGLVIALE-----FLNKDKSA- 225
           ++F  + S  I+ ++  S            K  T     G V   E      L+K++   
Sbjct: 146 DMFDYIGSRSINLNDLASTFDRKELDYMAAKEITILNGNGDVTGKESLYELALSKNQVCL 205

Query: 226 -------IKKKGVIIGTTHLFWHLFGTFERTR--QCYVMMDQMDKFMKKL 266
                  I K   +I  THL+W     +E  +  QC ++M ++ K + +L
Sbjct: 206 FVMVEHKISKDVFVIINTHLYW----KYEEVKLTQCMIIMRKLAKIVNEL 251

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 95/236 (40%), Gaps = 41/236 (17%)

Query: 86  VKGTMLKIMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNEL-KYYDSDLLSLQEID 143
           + G    ++TYN L+   +   ++       K W  R  +L +EL + Y +D++ LQE+ 
Sbjct: 32  IPGHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELT 91

Query: 144 FVQFKQYWKIVLAK-LGYDCEFYKKN---------GKIHGVLIAWKRNLFAKVKSLPI-- 191
           +  +  YWK V  K L Y  +F  K           ++ G  I +  + F  + S  +  
Sbjct: 92  WEDYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRLFL 151

Query: 192 -----DFDETLSGTIKPRT--RTKNVGLVIALEFL-----NKDKSAI--------KKKGV 231
                 F+E     +K +    T   G  +  E L     N+++  +             
Sbjct: 152 NDVVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCLFVSLKHKETNNVF 211

Query: 232 IIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL-----GGIEKWYPFFTGDFNS 282
           ++  THL+W       +  QC ++M ++ + + +L       + K   F TGD NS
Sbjct: 212 VVINTHLYWKYDEV--KLTQCMIIMRKLSQIINELLIGADPSLSKDVIFITGDLNS 265

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 93/235 (39%), Gaps = 41/235 (17%)

Query: 87  KGTMLKIMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNEL-KYYDSDLLSLQEIDF 144
           K     ++TYN L+ S +   ++    +  K W  R K+L  EL   + +D++ LQE+  
Sbjct: 23  KDARFTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFKADIMCLQEMTR 82

Query: 145 VQFKQYW-KIVLAKLGYDCEFYKKN---------GKIHGVLIAWKRNLFAKVKSLPIDFD 194
             ++ YW   +   + Y  +F  K            + GV I +  + F  + S  I  +
Sbjct: 83  RDYEDYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMDGVSIFYNLDKFDFISSSGIYLN 142

Query: 195 ETLS-------------GTIKPRTRTKNVGLVIALEFLNKDKS-----AIKKKGV----I 232
           + L+               I     +  VG    L+ L          ++K K      +
Sbjct: 143 QLLNVFNERELKYLYNKRVILTDGASNVVGEDSLLDVLKGKNQVCLFVSLKHKETDTIFV 202

Query: 233 IGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL-----GGIEKWYPFFTGDFNS 282
           +  THL+W       +  QC ++M ++ K +++L      G  K    FTGD NS
Sbjct: 203 VLNTHLYWKYDEV--KLTQCMIIMRELSKIIEQLLPGDAKGRGKVKILFTGDLNS 255

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 96/227 (42%), Gaps = 39/227 (17%)

Query: 93  IMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVL-LNELKYYDSDLLSLQEIDFVQFKQY 150
           +++YN L+ S +   ++       K W  R  +L L  L  Y +D++ +QE+    +  Y
Sbjct: 32  VLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDYIDY 91

Query: 151 WKIVLA-KLGYDCEFYKKNG---------KIHGVLIAWKRNLFAKVKSLPIDFDETLS-- 198
           W++ L   +GY  +F  K+           + GV I +    F  + S  I  +E L   
Sbjct: 92  WQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFLDVF 151

Query: 199 -----GTIKPRT--RTKNVGLVI----ALEFLN-KDKSAI------KKKG--VIIGTTHL 238
                  +K +T   T   G+ I      E L+ K++ ++      K+ G   II  THL
Sbjct: 152 NPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLFVCLKHKETGQVFIIINTHL 211

Query: 239 FWHLFGTFERTRQCYVMMDQMDKFMKKL---GGIEKWYPFFTGDFNS 282
           +W       +  QC ++M ++ K + +L       K    F GD NS
Sbjct: 212 YWKYDEV--KLSQCIIIMRELSKIIDELLQDVRHSKVKIIFAGDLNS 256

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 91  LKIMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVLLNELKY-YDSDLLSLQEIDFVQFK 148
           L ++TYN L+   +   ++       K W  R K+L  EL Y + +D+L LQE+    + 
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 149 QYW-KIVLAKLGYDCEFYKK 167
           Q+W K +  +L Y   F  K
Sbjct: 90  QFWRKQMKRRLSYGSNFISK 109

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 23/117 (19%)

Query: 388 LRAISLYSVGYRKVDPENAYINN---DRGEPELSE---WARMWSGLLDYIFFLQHWDGKT 441
           L+  S++      ++P   Y+N+      EPEL E   ++    G+ DYI++        
Sbjct: 273 LKGESVHRADLSLINPLRPYLNHYIYQDVEPELFEHTCYSGKLKGIFDYIWY-------- 324

Query: 442 NHEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLELLE 498
            H+K   LK         L G     + +E  E  +P K  +PSDH+ ++ +LE+LE
Sbjct: 325 -HDKDFRLKRI-------LSGAEVSQELREFQEFGLPNKN-HPSDHIPVLTELEILE 372

>ADR400W Chr4 (1423238..1425628) [2391 bp, 796 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL047C (SPC72)
          Length = 796

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 11/67 (16%)

Query: 242 LFGTFERTRQCYVMMDQMDKFMKKLGGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQN 301
           +FG FE      +  D +D+ MKKL  I+K Y       N    D+ Y+ I       QN
Sbjct: 658 MFGIFE----SILQQDSIDQAMKKLDSIDKGYTLSNSRRNQLKLDSIYMFI-------QN 706

Query: 302 ETKIVIE 308
            T  ++E
Sbjct: 707 ATSSIVE 713

>Suva_16.197 Chr16 complement(346987..348189) [1203 bp, 400 aa] {ON}
           YPL112C (REAL)
          Length = 400

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 23/48 (47%)

Query: 234 GTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEKWYPFFTGDFN 281
           GT    + L G F RTR+C   +DQ+ K       + ++   + G F+
Sbjct: 182 GTPFRLFSLLGKFNRTRKCNFQVDQIKKIWLNEASLREFLDLYYGIFD 229

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 57/118 (48%), Gaps = 12/118 (10%)

Query: 71  QFIKRPLLTLHDDDPVKGTM----LKIMTYNCLAQSLIQRDLFPGSGQALK-WVRRSKVL 125
           + I R LL ++      G        ++TYN L+   +   ++    +  K W  R K+L
Sbjct: 18  RMINRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLL 77

Query: 126 LNELKY-YDSDLLSLQEIDFVQFKQYW-KIVLAKLGYDCEFYKKNGKIHGVLIAWKRN 181
             EL + Y +D+L LQE+    ++++W K +  ++ ++ ++ +K    +     WKR+
Sbjct: 78  EYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKPPPAY-----WKRS 130

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,641,759
Number of extensions: 1952565
Number of successful extensions: 4968
Number of sequences better than 10.0: 73
Number of HSP's gapped: 4939
Number of HSP's successfully gapped: 104
Length of query: 498
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 384
Effective length of database: 40,409,475
Effective search space: 15517238400
Effective search space used: 15517238400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)