Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0D008906.46ON53953922810.0
NCAS0H009006.46ON49554811651e-155
ZYRO0C07172g6.46ON4504539361e-121
CAGL0J11792g6.46ON5104648981e-114
TDEL0G042406.46ON4444658851e-113
KAFR0L004206.46ON4604768601e-109
SAKL0E01980g6.46ON4654558451e-107
Skud_13.1056.46ON5125048051e-100
Suva_13.1176.46ON5134767991e-99
Smik_13.1066.46ON5064827953e-99
YML043C (RRN11)6.46ON5074967938e-99
KLTH0C10582g6.46ON4814847794e-97
Kwal_56.225276.46ON4814917361e-90
KLLA0C05852g6.46ON4824786653e-80
KNAG0E009106.46ON4863416593e-79
Ecym_30496.46ON5014676133e-72
ACL020W6.46ON5394646093e-71
TPHA0J005106.46ON4373455638e-66
TBLA0B005706.46ON5173655497e-63
Kpol_1037.116.46ON4013285093e-58
Ecym_40275.693ON38271723.2
NCAS0A132407.197ON113857706.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0D00890
         (539 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.4...   883   0.0  
NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.4...   453   e-155
ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly...   365   e-121
CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa...   350   e-114
TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.4...   345   e-113
KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46...   335   e-109
SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {...   330   e-107
Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {...   314   e-100
Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {...   312   1e-99
Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {...   310   3e-99
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...   310   8e-99
KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} simila...   304   4e-97
Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {...   288   1e-90
KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly...   260   3e-80
KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {O...   258   3e-79
Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON} s...   240   3e-72
ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-synteni...   239   3e-71
TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...   221   8e-66
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...   216   7e-63
Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON} (23974....   200   3e-58
Ecym_4027 Chr4 complement(64272..65420) [1149 bp, 382 aa] {ON} s...    32   3.2  
NCAS0A13240 Chr1 (2605834..2609250) [3417 bp, 1138 aa] {ON} Anc_...    32   6.9  

>NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.46
           YML043C
          Length = 539

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/539 (82%), Positives = 446/539 (82%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRH       GILPTP         
Sbjct: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHNNNNNNNGILPTPESSATESHD 60

Query: 61  XXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDHHESAH 120
                    LI          SVIGEAYSDTDL                  MSDHHESAH
Sbjct: 61  DDDATTSDDLIKRKRLRRRWKSVIGEAYSDTDLDDDDDDEEEEEDVDVEDEMSDHHESAH 120

Query: 121 HIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLL 180
           HIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLL
Sbjct: 121 HIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLL 180

Query: 181 HASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTLL 240
           HASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTLL
Sbjct: 181 HASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTLL 240

Query: 241 IRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKSGS 300
           IRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKSGS
Sbjct: 241 IRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKSGS 300

Query: 301 RTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLLDLIEK 360
           RTHTPKYTLTWLWKSLIQYSTKK                        NIDRNNLLDLIEK
Sbjct: 301 RTHTPKYTLTWLWKSLIQYSTKKIISGNNNSNESLEDGSSSELDIDINIDRNNLLDLIEK 360

Query: 361 ISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRGDIERNQVIQHIQKTK 420
           ISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRGDIERNQVIQHIQKTK
Sbjct: 361 ISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRGDIERNQVIQHIQKTK 420

Query: 421 SYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSNNNNVTDEDVDMQLQDIPNPYXX 480
           SYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSNNNNVTDEDVDMQLQDIPNPY  
Sbjct: 421 SYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSNNNNVTDEDVDMQLQDIPNPYSN 480

Query: 481 XXXXXXXXXXXXXXEDYIFSDFSFDKDLEDLDTQDPKIYGREEDEEHYENNLVQSDSSE 539
                         EDYIFSDFSFDKDLEDLDTQDPKIYGREEDEEHYENNLVQSDSSE
Sbjct: 481 NTNNATTNINNSIAEDYIFSDFSFDKDLEDLDTQDPKIYGREEDEEHYENNLVQSDSSE 539

>NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.46
           YML043C
          Length = 495

 Score =  453 bits (1165), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 259/548 (47%), Positives = 338/548 (61%), Gaps = 62/548 (11%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MF+LP   +NKR A ERKIRYTYINQLS+KYNR              LPTP         
Sbjct: 1   MFDLPTQISNKRIANERKIRYTYINQLSRKYNRQDAESSS-------LPTPENSASESHE 53

Query: 61  XXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDHHESAH 120
                     +          +VIGEA SDT                         E   
Sbjct: 54  STGEDEE---VRRRRLKRRWKNVIGEAVSDT-----------------DEDEDGEEERED 93

Query: 121 HIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLL 180
              EN+ER+FFK +EKPQE++EIW T+N KR+P+ K  I+++KL KIEK  KR++   LL
Sbjct: 94  EGPENQERRFFKTHEKPQESYEIWSTDNNKRMPLQKKFISFSKLNKIEKSTKRRMQGSLL 153

Query: 181 HASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTLL 240
           H+SK N +CFE++S+G ELVTPL T E+F+L+HIE LT LL++NV +  W++AY+IF L+
Sbjct: 154 HSSKFNNICFESISQGQELVTPLHTPESFTLKHIENLTNLLHINVMKGKWEVAYKIFALM 213

Query: 241 IRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKSGS 300
           +RI K+DIRSIWGIGV+ILS+++ T TLDFL WMNSVYSSR+N+IQG+ +R+DPVF+SGS
Sbjct: 214 VRIPKVDIRSIWGIGVKILSQRAATTTLDFLVWMNSVYSSRINYIQGMTHRVDPVFRSGS 273

Query: 301 RTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLLDLIEK 360
           +TH+ K+T+TWLWKSLI Y T                             R+ L  LIEK
Sbjct: 274 KTHSSKFTITWLWKSLI-YCTD-------------TDNDEDIDSDYGGFGRDKLQILIEK 319

Query: 361 ISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRGDIERNQVIQHIQKTK 420
           +SE+VLIPPFMED+EVWFIY+LCHMV AD LS  FN   SNGS  DI RN+VIQ+IQ  K
Sbjct: 320 VSELVLIPPFMEDAEVWFIYALCHMVKADQLSLNFNLNQSNGSARDIARNEVIQNIQLVK 379

Query: 421 SYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSN---NNNVTDEDVDM---QLQDI 474
           ++LQT+M+KG FEYPE++I +QL+ +E+RLY+ D T++   +NN +D    M    +Q +
Sbjct: 380 TFLQTAMSKGHFEYPERFITRQLNTFEERLYSKDETNSKDKDNNESDNGSSMDNGNIQLV 439

Query: 475 P--NPYXXXXXXXXXXXXXXXXEDYIFSDFSFDKDLEDLDTQDPKIYGREED-EEHYENN 531
           P  NP                 ++Y+FSDFSF     DLDTQ  +    EED  E    +
Sbjct: 440 PETNPI------------PPAEDEYVFSDFSFTNAAHDLDTQALEPMIHEEDLMEEDPFS 487

Query: 532 LVQSDSSE 539
            +QSDSSE
Sbjct: 488 QIQSDSSE 495

>ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 450

 Score =  365 bits (936), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 190/453 (41%), Positives = 263/453 (58%), Gaps = 48/453 (10%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MFELP++  +KRT T RK++Y YIN LSKKY+               LPTP         
Sbjct: 1   MFELPLVITSKRTRTSRKLKYQYINNLSKKYDGINGISNGQTE----LPTPENSATETSE 56

Query: 61  XXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDHHESAH 120
                                S+IGE+YSD +                    SD  +   
Sbjct: 57  NEEVGQQKRRRIRKRLK----SIIGESYSDLE--------------------SDEEQPVE 92

Query: 121 HIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLL 180
            + +NEERKF++KYEKPQ TFE WQ +  KR PI ++ I Y ++ +I++   R++   L 
Sbjct: 93  EV-DNEERKFYRKYEKPQLTFEKWQCDPRKRTPIQRNRINYNRMNRIQRHGLRRMETSLA 151

Query: 181 HASKINKLCFEAMSEGLELVTPLVTIEN-FSLQHIEKLTTLLYLNVSRENWDIAYRIFTL 239
            AS+ NK  F A ++G +L  P     N F L+HI  LT+LL++NV +  W++AY+ F L
Sbjct: 152 VASRTNKTFFHATTQGYQLFDPTYGRANTFQLKHIGTLTSLLHINVLKRKWELAYKCFAL 211

Query: 240 LIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKSG 299
           LIRI  +D+R++WG+G RIL+E+ PT++L+FL WM+SVYS++L F   +NYRM PVF  G
Sbjct: 212 LIRIPGVDVRTLWGLGERILAERQPTRSLEFLQWMSSVYSTKLPFADDVNYRMAPVFTKG 271

Query: 300 SRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLLDLIE 359
           S+THTPKYT TWLW+ LI+Y+                                N   L++
Sbjct: 272 SKTHTPKYTTTWLWECLIRYANGLEDLEMDSKSAA-----------------ENFQSLMD 314

Query: 360 KISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRGDIERNQVIQHIQKT 419
           +ISEMVL PP+M+D EVWFIY+LCHMV AD LS +F+P ++  +R DI  NQVIQHIQ T
Sbjct: 315 RISEMVLGPPYMDDPEVWFIYALCHMVKADTLSQQFDPRLTGSAR-DIASNQVIQHIQNT 373

Query: 420 KSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYA 452
           KS+LQ   +KG F +P++YI +QL+ +E RLY 
Sbjct: 374 KSHLQQCSSKGGFTFPKRYIARQLAAFEARLYG 406

>CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa]
           {ON} similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043c RRN11 RNA polymerase I specific transcription
           initiation factor
          Length = 510

 Score =  350 bits (898), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 274/464 (59%), Gaps = 27/464 (5%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MFE+PI YN +R   ER++RY YIN LS+KY+    R          LPTP         
Sbjct: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYH--AKRRSKRRRQANSLPTPENSAVENDQ 58

Query: 61  XXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDHHESAH 120
                     I            +GE YSD++                     D +E A+
Sbjct: 59  SESQLPSREQIKEKKMK------LGEDYSDSE---------AETSSEGEDTTKDDNEFAN 103

Query: 121 HIHENEERKFFKKYEKPQETFEIW----QTNNLKRVPINKSMITYTKLKKIEKQAKRKIT 176
            +++ E + F++KYEKP+ +FE+W      N  K+  + K+ I YT+L ++E+ AK+++ 
Sbjct: 104 DMNKFE-KLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVE 162

Query: 177 VPLLHASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRI 236
             ++H   +NK  F+  SEG E++ PLV I+++ L+HIE LT +L+ +VS+ NWDIAYR 
Sbjct: 163 KNVVHMPLVNKRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRT 222

Query: 237 FTLLIRIKKLDIRSIWGIGVRILSEKS-PTKTLDFLNWMNSVYSSRLNFIQGINYRMDPV 295
           F+LLIRI ++DIR+IWG+G RIL E+   T++L+FL WM++VYSS+ NF+Q   +R  PV
Sbjct: 223 FSLLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPV 282

Query: 296 FKSGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLL 355
           F+SGSRTHTPKY LTWLW  LI+ +  +                         +D+  L 
Sbjct: 283 FRSGSRTHTPKYALTWLWNCLIKVT--ELISIEEEKGVNTNEEENDNGSKQSAMDK--LT 338

Query: 356 DLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRGDIERNQVIQH 415
           +LI+KISEMVL+PP+++D E+WFIYS+CHMV AD LS KFN    +GSR DI RNQV QH
Sbjct: 339 ELIDKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQH 398

Query: 416 IQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSNN 459
           I   K+YLQ    KG+FEYP+++I  +L  +E+R+Y  +    N
Sbjct: 399 IHYVKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPEN 442

>TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.46
           YML043C
          Length = 444

 Score =  345 bits (885), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/465 (41%), Positives = 271/465 (58%), Gaps = 47/465 (10%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MFE P+    +R    +K+RY Y+N LS K+NR +            LPTP         
Sbjct: 1   MFEQPVALTTRRLRNAKKLRYQYVNNLSAKFNRLER-----ITNTNGLPTPENSAAESSE 55

Query: 61  XXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDHHESAH 120
                                S  GE+YSD++                   + ++H++  
Sbjct: 56  NEEALQRKKK----RIRRRLKSAAGESYSDSE----------------SDEVDNNHDNEV 95

Query: 121 HIHENEE--RKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVP 178
              E E+  RKF   YE PQE+FE WQ +  KRVPI +S I++TK +++ + AKRK+   
Sbjct: 96  VEDEEEDQERKFLNNYELPQESFEKWQDDPSKRVPIQRSKISFTKYQRLRRHAKRKMNTS 155

Query: 179 LLHASKINKLCFEAMSEGLELVTPL-VTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIF 237
           +  ASK NK+  + +SEG E+V P+    + F ++HI  LTTLL+L+VSR  WD AY  F
Sbjct: 156 IDLASKRNKIYMDTISEGFEMVDPVDGKPDTFQMKHISILTTLLHLHVSRREWDAAYTCF 215

Query: 238 TLLIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFK 297
            LLIR+ K+DIR+IWGIG  IL E+ P K+L+FL+WM+SVYSSR  F + +N+R  PVF 
Sbjct: 216 ALLIRVPKVDIRNIWGIGDLILREREPIKSLEFLSWMSSVYSSRSAFAEDVNHRTPPVFT 275

Query: 298 SGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNN-LLD 356
            GS+TH PK+  TW+W+SLIQ +                            I+ N+ L D
Sbjct: 276 KGSKTHVPKFATTWMWESLIQCTKNS-----------------LETGELEQIESNDGLQD 318

Query: 357 LIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRGDIERNQVIQHI 416
           LIE+ISEMVL PP+M+ SEVWFIY LCH++ AD LS++F+  ++ GS  DI  NQVIQHI
Sbjct: 319 LIERISEMVLAPPYMDASEVWFIYGLCHLIKADILSNQFDGRLA-GSARDIASNQVIQHI 377

Query: 417 QKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSNNNN 461
           Q+TKS LQT ++KGDF+YP++YI +QL  +E+RL   + T ++++
Sbjct: 378 QRTKSCLQTCLSKGDFKYPKRYIERQLEEFEKRLDRQEDTPDDSD 422

>KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46
           YML043C
          Length = 460

 Score =  335 bits (860), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/476 (41%), Positives = 268/476 (56%), Gaps = 63/476 (13%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MFE+P+  N+K  + ERK+RY YINQ ++++ R  +R+       G++ TP         
Sbjct: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKDDRN-------GMI-TPETSEDELQQ 52

Query: 61  XXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDHHESAH 120
                                 VIGE  SD D                     +      
Sbjct: 53  RKKRDWL--------------HVIGEYGSDDD--------ERSGGQQDDEEEEEEVIDED 90

Query: 121 HIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLL 180
           +   NEERKFFKK +KPQET+E W ++  K+  I + ++TY +  K+ +  +RK+   L+
Sbjct: 91  YNLNNEERKFFKKIDKPQETYEHWPSHR-KKTRIQRDILTYHRYNKVSRYVERKMANSLV 149

Query: 181 HASKINKLCFEAMSEGLELVTPL-VTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTL 239
           H S  N+  F+   +G+E+V PL     NF L+ IE LT LLYLNV+R NW+IAY+IF +
Sbjct: 150 HVSSKNRYHFKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAM 209

Query: 240 LIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKSG 299
           LIRI K+DIRS+W +G RIL EK   ++L+FL WM+SVYS+R+ FIQGINYR DPVF+SG
Sbjct: 210 LIRIPKVDIRSVWNVGNRILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSG 269

Query: 300 SRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLLDLIE 359
           S+ HTPKYTL WLW SL++Y+ +                           D  N+  LI+
Sbjct: 270 SKNHTPKYTLQWLWNSLLEYTEQLFEN-----------------------DDENIDKLID 306

Query: 360 KISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRGDIERNQVIQHIQKT 419
           KI+EMVLIPPFM+D E+WFIYS+CHMV AD LSSKF+   S GS  DI  NQVIQHI   
Sbjct: 307 KIAEMVLIPPFMDDPEIWFIYSMCHMVKADFLSSKFDTH-SVGSMRDISMNQVIQHINDV 365

Query: 420 KSYLQTSMNK--GDFEYPEKYILKQLSIYEQRLYAS-----DPTSNNNNVTDEDVD 468
           K YL     K  G +E  E  I KQL  +E RLY       +P ++ +   +E+VD
Sbjct: 366 KRYLNVCKEKSQGQYESNEMIITKQLKAFEVRLYKEPVFPLEPENDLDGDNEEEVD 421

>SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {ON}
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 465

 Score =  330 bits (845), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/455 (40%), Positives = 259/455 (56%), Gaps = 49/455 (10%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MFELP++  NK+  ++RK+RY YIN L+KK+ +   +          LPTP         
Sbjct: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTVG-----LPTPESSAAETSD 55

Query: 61  XXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDHHESAH 120
                                S++G A S +D                   +S+      
Sbjct: 56  TDELEDSQSKRTKRRKRRLQ-SILGHAVSSSD----------------EDDISEEENDND 98

Query: 121 HIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLL 180
           +   + E+    KY KPQET+E+W T    RVP+N + +TY + KKI K A R++T  L 
Sbjct: 99  YEECDYEKHVKNKYYKPQETYELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLS 158

Query: 181 HASKINKLCFEAMSEGLELVTPLVT--IENFSLQHIEKLTTLLYLNVSRENWDIAYRIFT 238
           ++SK +   F A+  G E   P  T  +EN+   HI  LT LL++NV  +NW+IAYR F+
Sbjct: 159 YSSKNSAAFFSAIYNGYE---PYETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFS 215

Query: 239 LLIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKS 298
           +LIR+  +DIRSIWGIGVRIL E    ++ +FL WM+SV+S++ NF QG N+ MDPVF+S
Sbjct: 216 ILIRLPGVDIRSIWGIGVRILKEIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRS 275

Query: 299 GSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLLDLI 358
           GS+THTPK+  +WLW++L+  ++K                         N D N L  L 
Sbjct: 276 GSKTHTPKFVTSWLWETLMGCTSKD--------------------ENNGNRDVNKLQFLT 315

Query: 359 EKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKF--NPLISNGSRGDIERNQVIQHI 416
           EKISE+VL PP+M+D ++WFIY+LCH+V AD LS +F  N  I NGSR DI RNQVIQHI
Sbjct: 316 EKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQQFIENEHIKNGSRRDIARNQVIQHI 375

Query: 417 QKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLY 451
              K++LQT   KG F++P+++I KQLS +E RLY
Sbjct: 376 TNAKNFLQTCQEKGGFQFPKQHIEKQLSNFENRLY 410

>Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {ON}
           YML043C (REAL)
          Length = 512

 Score =  314 bits (805), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/504 (37%), Positives = 271/504 (53%), Gaps = 55/504 (10%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MFE+PI   NK+ A  RK++Y YIN LS+++++              LPTP         
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKV----AKTTNTTDSLPTPENSAVENND 56

Query: 61  XXXXXXXXXLI--------------XXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXX 106
                                              SV+GE YS T+              
Sbjct: 57  DDYDYDEDEEQIDEADVYRRSILQQTKRRRERHWKSVVGELYSSTETESDSQQEEIQE-- 114

Query: 107 XXXXXMSDHHESAHHIHE-NEERKFFKKYEKPQETFEIWQTNNLK-RVPINKSMITYTKL 164
                 +D  E+     + +EERKF+KK+EKP+ +FEIWQT +L+ + PIN+  +TY K 
Sbjct: 115 ------NDGRETGRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKF 168

Query: 165 KKIEKQAKRKITVPLLHASKINKLCFEAMSEGLE-LVTPLVTIENFSLQHIEKLTTLLYL 223
           +KI+K + RK+ +PLLH +K N+L F ++S+GLE L TP  TI N+  +HI  LT LL++
Sbjct: 169 QKIQKNSLRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHI 228

Query: 224 NVSRENWDIAYRIFTLLIRIKKLDIRSIWGIGVRILSE-KSPTKTLDFLNWMNSVYSSRL 282
           NVSR NW +AYRIF  LIRI ++ ++SIWG GV+IL      + +LDFL WM  +YSS+ 
Sbjct: 229 NVSRHNWSLAYRIFATLIRIPEVQMKSIWGFGVKILDNLPDSSSSLDFLQWMCQIYSSKA 288

Query: 283 NFIQGINYR-MDPVFKSGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXX 341
            F+Q IN+R + P F++GSRTHT K+  T+LW SLI                        
Sbjct: 289 RFVQNINHRSIVPPFQTGSRTHTAKFATTYLWASLINCQ--------------KSIEPST 334

Query: 342 XXXXXXNIDRNNLLDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISN 401
                 +++ + L +LI+KISE VL PPFMED+EVWFIY+ CH++ AD LS +F   +++
Sbjct: 335 INDKHYDMENDRLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQF---VND 391

Query: 402 GSRG-------DIERNQVIQHIQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASD 454
           G++G       DI+ NQVI+HI   K +LQT ++KG F  P + I  QL  +E RLY   
Sbjct: 392 GTKGDLIGLDRDIKINQVIKHIHYVKVFLQTCLDKGGFTIPNRLIEIQLKNFELRLYGET 451

Query: 455 PTSNNNNVTDEDVDMQLQDIPNPY 478
                  + D   +  +  + N +
Sbjct: 452 QDVQEREIVDGYDETDISSVENSF 475

>Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {ON}
           YML043C (REAL)
          Length = 513

 Score =  312 bits (799), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 190/476 (39%), Positives = 263/476 (55%), Gaps = 50/476 (10%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXX- 59
           MFE+PI   NK+ A  RK++Y YIN +S++++R   +          LPTP         
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHISRRFDRITKKSNTTDS----LPTPENSAAENND 56

Query: 60  ------------XXXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXX 107
                                             SVIGE YS T+               
Sbjct: 57  EDYDDDEEERNYESDAGESSIRQQTKRRRERHWKSVIGELYSSTETESDSQEEDDQEGDQ 116

Query: 108 XXXXMSDHHESAHHIHENEERKFFKKYEKPQETFEIWQT-NNLKRVPINKSMITYTKLKK 166
                 +H         +EERKF+KKYEKP+++FE+WQT ++  + PINK  ITY   KK
Sbjct: 117 V-----EHETRLKEEDTDEERKFWKKYEKPEKSFEVWQTVSSHNKSPINKQKITYHNYKK 171

Query: 167 IEKQAKRKITVPLLHASKINKLCFEAMSEGLE-LVTPLVTIENFSLQHIEKLTTLLYLNV 225
           IEK + RK+ +PLLH +K NKL F+ +++GLE L +P     N+  +HI  LT LL+LNV
Sbjct: 172 IEKNSLRKMEIPLLHCTKENKLYFQLLAKGLEPLQSPTSAARNYQTRHIITLTNLLHLNV 231

Query: 226 SRENWDIAYRIFTLLIRIKKLDIRSIWGIGVRILSEKSP--TKTLDFLNWMNSVYSSRLN 283
           SR NW +AY+IF  LIRI  + I+SIWGIGV+IL + SP  + +LDFL WM  VYSS+  
Sbjct: 232 SRHNWPLAYKIFATLIRIPNVQIKSIWGIGVKIL-DNSPNLSSSLDFLQWMCQVYSSKSR 290

Query: 284 FIQGINYR-MDPVFKSGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXX 342
           F+Q +NYR + P F++GSRTHT K+ +T+LW  LI  S +K                   
Sbjct: 291 FVQNVNYRSVVPPFQTGSRTHTSKFAITYLWSCLI--SCQK------------SIESSNA 336

Query: 343 XXXXXNIDRNNLLDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKF------N 396
                +++ + L +LI++ISE VLIPPFMED+EV+FIY+ CH++ AD LS +F      N
Sbjct: 337 TDNQYDMENSRLEELIDQISEWVLIPPFMEDAEVYFIYASCHLLKADLLSRQFVNDNRNN 396

Query: 397 PLISNGSRGDIERNQVIQHIQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYA 452
            L+  G   DI+ NQVI++I   K +LQT ++KG F  P + I  QL  +E RLY 
Sbjct: 397 DLV--GLNKDIKINQVIKNIHYVKVFLQTCLDKGGFTIPNRLIENQLKSFESRLYG 450

>Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {ON}
           YML043C (REAL)
          Length = 506

 Score =  310 bits (795), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 194/482 (40%), Positives = 262/482 (54%), Gaps = 69/482 (14%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXX--- 57
           MFE+PI   NK+ A  RK++Y YIN  S+++ +   +          LPTP         
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHTSRRFEKIVKKSTTALS----LPTPENSAAENNE 56

Query: 58  ---XXXXXXXXXXXXLIXXXXXXXXX---XSVIGEAYSDTDLXXXXXXXXXXXXXXXXXX 111
                          LI             SV+GE YS T+                   
Sbjct: 57  EDDGERNGEGGAYRRLILQQRKRRRERHWKSVVGEIYSSTETE----------------- 99

Query: 112 MSDHHESAHHIHE----------NEERKFFKKYEKPQETFEIWQT-NNLKRVPINKSMIT 160
            SD  E A    E          +EERKF+KKYEKP+E+FE+W+T ++  + PINK  +T
Sbjct: 100 -SDSQEDAEEDEECNTEGKEEDIDEERKFWKKYEKPEESFEVWRTVSSQNKSPINKQKMT 158

Query: 161 YTKLKKIEKQAKRKITVPLLHASKINKLCFEAMSEGLELVTPLVT-IENFSLQHIEKLTT 219
           Y   KKIEK + RK+ VPLLH +K +KL F+++S+GLE + P  + + N+  +HI  LT 
Sbjct: 159 YHTFKKIEKNSLRKMEVPLLHCTKESKLHFQSLSKGLEPLQPSTSEVRNYRTKHIITLTN 218

Query: 220 LLYLNVSRENWDIAYRIFTLLIRIKKLDIRSIWGIGVRILSEKSP--TKTLDFLNWMNSV 277
           LL+LNVSR NW +AY+IF  LIRI  + I+SIWGIGV IL+  SP  + +LDFL WM  +
Sbjct: 219 LLHLNVSRHNWSLAYKIFATLIRIPGVQIKSIWGIGVEILN-NSPNLSTSLDFLQWMCQI 277

Query: 278 YSSRLNFIQGINYR-MDPVFKSGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXX 336
           YSS+L F+Q  NYR + P F++GSRTHT K+  T+LW SLI                   
Sbjct: 278 YSSKLRFVQSTNYRSIVPPFQTGSRTHTSKFATTYLWSSLI--------------TCQKS 323

Query: 337 XXXXXXXXXXXNIDRNNLLDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKF- 395
                      +++ + L DLI++ISE VL PPFMED+EVWFIY+ CH++ AD LS +F 
Sbjct: 324 MELPDINDKRYDMENDLLQDLIDRISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFA 383

Query: 396 -----NPLISNGSRGDIERNQVIQHIQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRL 450
                + LI  G   DI+ NQVI+HI   K +LQT  +KG F  P + I  QL  +E RL
Sbjct: 384 NDNKTSDLI--GLDRDIKINQVIKHIHYVKVFLQTCSDKGGFTVPNRLIESQLKGFESRL 441

Query: 451 YA 452
           Y 
Sbjct: 442 YG 443

>YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON}
           RRN11Component of the core factor (CF) rDNA
           transcription factor complex; CF is required for
           transcription of 35S rRNA genes by RNA polymerase I and
           is composed of Rrn6p, Rrn7p, and Rrn11p
          Length = 507

 Score =  310 bits (793), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 191/496 (38%), Positives = 264/496 (53%), Gaps = 56/496 (11%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MFE+PI   N++ A  RK++Y YIN +S++++R   +          LPTP         
Sbjct: 1   MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDS----LPTPENSAAENND 56

Query: 61  XXXXXXXXXLIXXXXXXXXXX--------SVIGEAYSDTDLXXXXXXXXXXXXXXXXXXM 112
                                        SV+GE YS T+                    
Sbjct: 57  EEEGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTE-------SETDSQEEETEEG 109

Query: 113 SDHHESAHHIHENEERKFFKKYEKPQETFEIWQT-NNLKRVPINKSMITYTKLKKIEKQA 171
            +H         +EERKF+KKYEKP+++FEIW+T ++  + PINK  +TY   KKIEK  
Sbjct: 110 GEHDTGIDKEDSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIP 169

Query: 172 KRKITVPLLHASKINKLCFEAMSEGLE-LVTPLVTIENFSLQHIEKLTTLLYLNVSRENW 230
            RK+ +PLLH +K NKL F+++S GLE L T    + N+  +HI  LT LL+LNVSR NW
Sbjct: 170 LRKMEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNW 229

Query: 231 DIAYRIFTLLIRIKKLDIRSIWGIGVRILSEKSPTKT-LDFLNWMNSVYSSRLNFIQGIN 289
            +AY+IF  LIRI  + I+S+WGIGV IL   S + + LDFL WM  +YSS+  F+Q IN
Sbjct: 230 SLAYKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNIN 289

Query: 290 YR-MDPVFKSGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXN 348
           YR + P F++GSRTHT K+ +T+LW SLI                              +
Sbjct: 290 YRSIVPPFQTGSRTHTAKFAITYLWSSLIN-------------CQKSMEPSSNIIDKPFD 336

Query: 349 IDRNNLLDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKF------NPLISNG 402
            + + L +LI+KISE VL PPFMED+EVWFIY+ CH++ AD LS +F      N LI  G
Sbjct: 337 TENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLI--G 394

Query: 403 SRGDIERNQVIQHIQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSNNNNV 462
              DI+ NQVI+HI   +++L+  ++KG F  P + I  QL  +E RLY           
Sbjct: 395 LDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLYG---------- 444

Query: 463 TDEDVDMQLQDIPNPY 478
             E  D+Q +D+ N Y
Sbjct: 445 --EAQDIQERDVANVY 458

>KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} similar
           to uniprot|Q04712 Saccharomyces cerevisiae YML043C RRN11
           rDNA transcription factor CF component which also
           contains Rrn6p and Rrn7p which is required for rDNA
           transcription by RNA polymerase I component of rDNA
           transcription factor
          Length = 481

 Score =  304 bits (779), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 171/484 (35%), Positives = 252/484 (52%), Gaps = 52/484 (10%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MFELP++ N KR  T RK+RY YIN L ++Y + Q+           LPTP         
Sbjct: 1   MFELPLVRNTKRVRTVRKLRYQYINTLYQEYRKVQS----FANANSTLPTPENSAAEEAS 56

Query: 61  XXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDHHESAH 120
                                SV+G A +DT+L                    +  E +H
Sbjct: 57  DGDHNSADATSRRRRRKRRLLSVLGHAETDTELSDM-----------------EAEEGSH 99

Query: 121 HIHE-NEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPL 179
              + + E++FF ++EKPQETFE+W T+  K VP+N + ++Y   K+IEK A+++++  +
Sbjct: 100 EADQADSEKEFFTRHEKPQETFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGM 159

Query: 180 LHASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTL 239
            H SK     F+AM +G E V    T E+  L HI +L  LL+ N+ +  WD AYR F+L
Sbjct: 160 AHISKNANFHFQAMKDGYETVAE--TPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSL 217

Query: 240 LIRIKKLDIRSIWGIGVRILSE-----KSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDP 294
           LIR+  +DIRS+WG G RIL E     K    + +FL W++ ++SSR NF Q +N+ MDP
Sbjct: 218 LIRLPGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDP 277

Query: 295 VFKSGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNL 354
           VF+ GS+TH  K+ + WLW+ L                               +     L
Sbjct: 278 VFRCGSKTHAAKFVVAWLWELLFASCPDG-----------------TEHPSAEDASNRKL 320

Query: 355 LDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKF--NPLISNGSRGDIERNQV 412
             L+E++SEMVLIPP+MED EVWFI+++CH+V AD LS +F    L ++    DI RNQV
Sbjct: 321 SHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSADQLSQRFISTKLRTSELERDISRNQV 380

Query: 413 IQHIQKTKSYLQTS-MNKGDFEYPEKYILKQLSIYEQRLYASDPTSNNNNVTDEDVDMQL 471
            QHI      ++T    K +F +P + I +QL+ +E+RLY +   S  +  +D     +L
Sbjct: 381 TQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLACFEKRLYQN---SGESTASDLGSGFEL 437

Query: 472 QDIP 475
            + P
Sbjct: 438 DNSP 441

>Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {ON}
           YML043C (RRN11) - component of rDNA transcription factor
           [contig 185] FULL
          Length = 481

 Score =  288 bits (736), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 168/491 (34%), Positives = 253/491 (51%), Gaps = 52/491 (10%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MFELP+  N+ R  T RK+RY YIN LS+++ R Q+           LPTP         
Sbjct: 1   MFELPLARNSNRVRTVRKLRYQYINSLSQEHRRIQD----SAAAHATLPTPENSAAEDAS 56

Query: 61  XXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDHHESAH 120
                                SV+G   S+++L                       ES H
Sbjct: 57  DGDQDSEDAGSRRRRRKRRILSVLGHIDSESELSDVDMST----------------ESHH 100

Query: 121 HIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLL 180
              +  E++FF  +EKPQ+T+E W T+  K V +  + ++Y + K IE +A+R++   + 
Sbjct: 101 SELQESEKEFFSHHEKPQDTYETWNTDRRKAVSMTTATLSYAENKLIEARAQRRVIERIG 160

Query: 181 HASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTLL 240
           H S+I +  F ++  G E+ +    +   +  HI  L  LL++NV    W+ A+R F++L
Sbjct: 161 HFSRIARSHFNSIKRGYEIYSRPSQVHQTT--HITHLNELLHINVMEGQWETAFRCFSIL 218

Query: 241 IRIKKLDIRSIWGIGVRILSEKSPT-----KTLDFLNWMNSVYSSRLNFIQGINYRMDPV 295
           IR+  +DIRS+WG+GVRIL E S T      + +FL W++ +Y+SR NF   +N+ MDPV
Sbjct: 219 IRLPGVDIRSMWGLGVRILRELSSTDKNVASSDEFLGWLSGIYTSRSNFNHTMNFLMDPV 278

Query: 296 FKSGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLL 355
           F++GS+ HT K+   WLW+ L      K                              L+
Sbjct: 279 FRTGSKKHTAKFVSAWLWEMLFAACPDK----------------LEERQADNGSGNRKLI 322

Query: 356 DLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGS--RGDIERNQVI 413
            L+EK+SEMVLIPP+MED E+WFIY+LCH+V AD+LS +F    S  +    DI RNQV 
Sbjct: 323 QLLEKLSEMVLIPPYMEDPEIWFIYALCHLVSADELSQRFTFTYSESTELERDISRNQVT 382

Query: 414 QHIQKTKSYLQTSMNKG-DFEYPEKYILKQLSIYEQRLY--ASDPTSNNNN----VTDED 466
           QHI    + ++T   KG DF +P + I +QL+ +E+RLY    D T++  +    +T E 
Sbjct: 383 QHITNAHNCIRTCEAKGDDFFFPRRIIEEQLAFFERRLYEHVGDSTTSEQDSPHEMTFEP 442

Query: 467 VDMQLQDIPNP 477
            +   QD+P+P
Sbjct: 443 HNFDTQDLPSP 453

>KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 482

 Score =  260 bits (665), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 165/478 (34%), Positives = 235/478 (49%), Gaps = 52/478 (10%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHXXXXXXXGILPTPXXXXXXXXX 60
           MF+LP+I  + R    RKIRY YIN L +KY++                           
Sbjct: 1   MFQLPVIDRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENS 60

Query: 61  XXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDHHESAH 120
                    L           SV+G A   +D                     D  E   
Sbjct: 61  ESSEAEAADLEKKHRRKRRLQSVLGNALDSSDEEL------------------DGDEDG- 101

Query: 121 HIHENE-ERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPL 179
              EN+ E +F++ + KPQ TFE+W  N   R PI +  ITY  +KK+EK A + +T  L
Sbjct: 102 -TDENDPETQFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKL 160

Query: 180 LHASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTL 239
            + +K   + F+A+  G + V P   +      H+  L  LLY NV  +NW+IAYR F++
Sbjct: 161 NYQTKKLNMYFQALKFGFD-VYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSI 219

Query: 240 LIRIKKLDIRSIWGIGVRILSEKSPTKTLD-FLNWMNSVYSSRLNFIQGINYRMDPVFKS 298
           LIR++ +D+RS+W IG  IL+    T++ + +L W+  V+ SR+ F QG NY +DPVF+ 
Sbjct: 220 LIRLEDVDVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRC 279

Query: 299 GSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLL-DL 357
           GSRTHTP + LTWLW  L   ++                           +D+   L  L
Sbjct: 280 GSRTHTPTFVLTWLWTRLFIATSGSSA-----------------------VDKEKFLQSL 316

Query: 358 IEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPL--ISNGSRGDIERNQVIQH 415
           I+++ EMVL PP+M+DSE+W+I+ L H+V+A +LSSKF     I  GSR DI RNQVIQH
Sbjct: 317 IDRLDEMVLSPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQH 376

Query: 416 IQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSNNNNVTDEDVDMQLQD 473
           I   K+ LQ      ++E+PE  I  QL   E+ LY  + +    N TDE      +D
Sbjct: 377 INNAKNCLQMCKANSNYEFPENVIEHQLVQLERSLYTDELSV---NCTDESAKSSDED 431

>KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {ON}
           Anc_6.46 YML043C
          Length = 486

 Score =  258 bits (659), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 202/341 (59%), Gaps = 36/341 (10%)

Query: 128 RKFFKKYEKPQETFEIWQTNNLKR-VPINKSMITYTKLKKIEKQAKRKITVPLLHASKIN 186
           RK+FK +EKP++ +E+W     +R VPI +  ++Y +L+ IE++AKRK+ VPLLH S++ 
Sbjct: 110 RKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVR 169

Query: 187 KLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTLLIRIKKL 246
              F A  +G ++V+      +F  +HI+ L TLL+ ++S ENW++AY++F LLIR+ ++
Sbjct: 170 SSEFSAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRV 229

Query: 247 DIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKSGSRTHTPK 306
           DIR++W +GV IL+ +  T  +DFL WM+SVYS++  FIQ +N+R+ P F+SGSRTHT +
Sbjct: 230 DIRAVWNLGVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQ 289

Query: 307 YTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLLDLIEKISEMVL 366
           YT TWLW SL   + +                               L  L +K SE++L
Sbjct: 290 YTTTWLWLSLRAATEQAQEGAPTTL--------------------EPLELLTDKTSELLL 329

Query: 367 IPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISN------GSRGDIERNQVIQHIQKTK 420
            PP+M+DSEVWFIY  C+ V AD LS   +  +++       S  D+ RN+V+Q I + +
Sbjct: 330 TPPYMDDSEVWFIYCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQ 389

Query: 421 SYLQTSMNKGD---------FEYPEKYILKQLSIYEQRLYA 452
             L T+  K D         +E P  YI +QL   E+RL A
Sbjct: 390 KTLHTAEEKSDQARHRAHAYWELPTGYIKRQLQQIEKRLTA 430

>Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ACL020W
          Length = 501

 Score =  240 bits (613), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 157/467 (33%), Positives = 229/467 (49%), Gaps = 39/467 (8%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNR---TQNRHXXXXXXXGILPTPXXXXXX 57
           MFE PII  N +    RK++Y YIN L +KY     TQ            LPTP      
Sbjct: 1   MFESPIISYNSKDRKRRKLKYKYINSLKRKYEHLVGTQGGSKGSTKDTSGLPTPGNSAAE 60

Query: 58  XXXXXXXXX-XXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDHH 116
                         +          S++G A  + +                     D +
Sbjct: 61  ASDGDGREEDELSRLRRRKRRIRLQSILGHAADEDEDEAEAEGAVGSED-------DDGY 113

Query: 117 ESAHHIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKIT 176
           E  +   ++ E+ F+ KY  P+ET+E+W T+   R+PI +  ++Y   + IEK A +K+ 
Sbjct: 114 EDGYLDEKDPEKIFYSKYYVPEETYEVWTTSINNRIPIQRRSMSYHVFRTIEKYAHKKVA 173

Query: 177 VPLLHASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRI 236
             L  +SK     FE +  G E   P   I N+   H+  L  LLY+N+ R ++D AYR 
Sbjct: 174 ASLALSSKKLTGFFEVIRSGYE-TCPRERITNYQKVHLHHLVDLLYINILRGDFDTAYRC 232

Query: 237 FTLLIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVF 296
           F+LLIR+  +D+RS+W +G +IL   +      FL WM++V +S   F Q    ++DPVF
Sbjct: 233 FSLLIRMNFVDLRSMWNLGSKILEHYNLDDQERFLEWMSTVLTSNSAFPQNSKNQLDPVF 292

Query: 297 KSGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLLD 356
           +SGSRTH P + L+WLW  L     ++                          D N LLD
Sbjct: 293 RSGSRTHIPNFVLSWLWLVLENAVKERVFSSGH--------------------DINWLLD 332

Query: 357 LIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLIS-NGSRG---DIERNQV 412
              KISE+VL PP+M+D+EVWFIY++C+ + AD LS +     S NG +G   DI RNQV
Sbjct: 333 ---KISELVLRPPYMDDAEVWFIYAMCYFIKADKLSLQLKQEGSLNGLKGSQLDIARNQV 389

Query: 413 IQHIQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSNN 459
           I++I   K++L+    KG F+YP++ I  QL  +E+RLY    T  N
Sbjct: 390 IENIHHVKNHLRICEEKGGFQYPKRVIEAQLVEFEKRLYPESSTHIN 436

>ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML043C (RRN11)
          Length = 539

 Score =  239 bits (609), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 143/464 (30%), Positives = 224/464 (48%), Gaps = 51/464 (10%)

Query: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKY---NRTQNRHXXXXXXXGILPTP--XXXX 55
           MFE PI+  +KR+  +R ++Y Y++ + +KY   N   +            PTP      
Sbjct: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105

Query: 56  XXXXXXXXXXXXXXLIXXXXXXXXXXSVIGEAYSDTDLXXXXXXXXXXXXXXXXXXMSDH 115
                                     S++G A  D +                   +   
Sbjct: 106 ASDGDALEGDVDTAARRLKRKRLRLQSILGHATLDAE----------------EGDLGSE 149

Query: 116 HE---SAHHIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAK 172
            E   +     ++ E++FF +Y KP+ T+E+W T+   RVPI + M++Y   K+IE  + 
Sbjct: 150 EEDDLNGGSTAKDYEKQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSN 209

Query: 173 RKITVPLLHASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDI 232
           +++   L  ++K      E M  G E   P   + N+   H+  L  LLY N+  ENW  
Sbjct: 210 QRMKATLSLSTKKAAAYHEVMRLGYE-TCPKEEVTNYQKLHLNHLVGLLYSNIISENWGT 268

Query: 233 AYRIFTLLIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRM 292
           AYR F LLIR+K +D+RSIW +G  ILS  +      FL WM +V++S   F Q     +
Sbjct: 269 AYRCFALLIRMKSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLI 328

Query: 293 DPVFKSGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRN 352
           DPVF+SGSR HTP + L WLW  L   +  +                             
Sbjct: 329 DPVFRSGSRAHTPNFMLAWLWLVLRGATADEVLDST-----------------------R 365

Query: 353 NLLDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKF---NPLISNGSRGDIER 409
           ++  L+EK+SE+VL PP+M+D+E+WF+Y++C+ + AD LS++      +  +GS+ DI +
Sbjct: 366 SMAWLLEKVSELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIKLHGSKLDIAK 425

Query: 410 NQVIQHIQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYAS 453
            QV Q+I   K+ L++   KG+F YPE+ I +QL  +E+RLYA 
Sbjct: 426 TQVTQYICSVKNCLESCREKGNFTYPERIIQEQLLEFERRLYAG 469

>TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {ON}
           Anc_6.46 YML043C
          Length = 437

 Score =  221 bits (563), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 193/345 (55%), Gaps = 43/345 (12%)

Query: 125 NEERKFFKKYEKPQETFEIWQTNNLKRVP-INKSMITYTKLKKIEKQAKRKITVPLLHAS 183
           +EE+K+F +Y+KPQE+FE W++NNLKR   +NK+ ITY + KK  KQ  +K  V  +H +
Sbjct: 111 DEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLN 170

Query: 184 KINKLCFEAMSEGLELV-----TPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFT 238
           K  K  FE M +G E +     +    ++N++  H+  LT L+Y N+ ++ WDIAY+ FT
Sbjct: 171 KNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFT 230

Query: 239 LLIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSR-LNFIQGINYRMDPV-F 296
            L+RI  +DIR +W +G  IL     TK +DFL W+++VYS++  +F+QGINYR D   F
Sbjct: 231 FLLRIPDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNF 290

Query: 297 KSGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLLD 356
             GSR  TP YT T LW  L   S  +                         ID      
Sbjct: 291 NGGSRRLTPLYTKTLLWHKLTLSSDSETCESE--------------------ID-----S 325

Query: 357 LIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKF------NPLISNGSR----GD 406
           LIE+I+EMV+IPP+ ED+E+W+I++LCH+V AD+LS K       NP +          +
Sbjct: 326 LIEQIAEMVVIPPYSEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTE 385

Query: 407 IERNQVIQHIQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLY 451
           I  N++   I   K YL+ +    +F+YP + I  +L   E R +
Sbjct: 386 IYNNKITICINNCKKYLRKATQDKNFDYPARTIETKLKTIETRTF 430

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score =  216 bits (549), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 131/365 (35%), Positives = 207/365 (56%), Gaps = 27/365 (7%)

Query: 125 NEERKFFKKYEKPQETFEIWQTN--------NLK---RVPINKSMITYTKLKKIEKQAKR 173
           NEE KFF +Y++PQE+FE+W T+         LK   R+PIN++ I++ +L +++K   +
Sbjct: 99  NEETKFFNRYDRPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNKISFNRLNRVKKFTNK 158

Query: 174 KITVPLLHASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIA 233
           K+   L H +K  K   +A+SEG E         +F+  HIE L  LLY N+  +N++ A
Sbjct: 159 KLEARLQHCTKRLKTHIKAISEGYETSYRDKQTTSFNNIHIENLINLLYYNICEKNFNQA 218

Query: 234 YRIFTLLIRIKKLDIRSIWGIGVRILSEK-SPTKTLDFLNWMNSVYSSRLNFIQGINYRM 292
           Y IF+L+IR+  +DIR+ W +G  IL +K S  ++L+FLNW++S+YSS   +   INY+ 
Sbjct: 219 YHIFSLIIRLPNIDIRNFWNLGSIILLKKVSIQESLNFLNWIHSIYSSNQKYNNSINYKT 278

Query: 293 DPVFKSGSRTHTPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRN 352
            P F   SR HT K+T ++LW +L    TK                         N  + 
Sbjct: 279 APAFTQSSRNHTGKFTTSFLWMTLSLIHTK---------FSDLTSRNIKEIVEELNYLKK 329

Query: 353 NLLDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDL--SSKFNPLISNGSRGDIERN 410
            L   +EK+SEMVL PPF+EDSE+W+IYSL H++LA  L   ++ N +       DI +N
Sbjct: 330 KLKKFVEKLSEMVLAPPFIEDSEIWYIYSLSHLILARMLMFETRNNDISQTSVEKDITKN 389

Query: 411 QVIQHIQKTKSYLQ-TSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSNNNNVTDEDVDM 469
           ++I +IQ  KS+LQ    N+ D+ +  + I  +L   E++LY    TS++  + +E+  +
Sbjct: 390 EIISNIQHCKSHLQKVRENQNDYNFKFQKIEIELKDMEKKLY---DTSSDEEILNEEEFL 446

Query: 470 QLQDI 474
             +D+
Sbjct: 447 DNEDV 451

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 24/33 (72%)

Query: 1  MFELPIIYNNKRTATERKIRYTYINQLSKKYNR 33
          MFE P+  ++K  A ERKIRY YIN  +K+Y++
Sbjct: 1  MFEAPLNIHSKVLANERKIRYQYINTFTKRYSQ 33

>Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON}
           (23974..25179) [1206 nt, 402 aa]
          Length = 401

 Score =  200 bits (509), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 118/328 (35%), Positives = 185/328 (56%), Gaps = 30/328 (9%)

Query: 128 RKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLLHASKINK 187
           +K+F +Y+KP+++FE W +N   R  IN+ M++Y K  K+ K +++KI VPL+ +++  +
Sbjct: 97  KKYFSRYDKPEDSFERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQ 156

Query: 188 LCFEAMSEGLELVTPLVTI-ENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTLLIRIKKL 246
             F ++ +G EL+   + + ENF++ +++ LT L+Y ++ +ENW IAYR FTLLIR+ K 
Sbjct: 157 ENFLSVIDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKT 216

Query: 247 DIRSIWGIGVRILSE-KSPTKTLDFLNWMNSVYS--SRLNFIQGINYRMDPVFKSGSRTH 303
            IR IW +G  I+   +   KT++FL   N+++S   +  F Q +NYR  PVF  GSR  
Sbjct: 217 SIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNK 276

Query: 304 TPKYTLTWLWKSLIQYSTKKXXXXXXXXXXXXXXXXXXXXXXXXNIDRNNLLDLIEKISE 363
           TP Y  T LWK +   ST                               N  +LIE +SE
Sbjct: 277 TPIYIKTLLWKEITTTSTSSRTSS-------------------------NYNELIEYLSE 311

Query: 364 MVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRG-DIERNQVIQHIQKTKSY 422
           + LIPPFMEDSE+W+IY + H+  A++LS      I N S   DI  N+V+Q+I+  + +
Sbjct: 312 LTLIPPFMEDSEIWYIYGIVHLQRANELSMNLEHYIDNSSSSKDIANNEVVQNIKLAQKF 371

Query: 423 LQTSMNKGDFEYPEKYILKQLSIYEQRL 450
           L+ +      E PE+ I   +   E R+
Sbjct: 372 LKKAKELSKIEVPERQITLMIKNIEGRM 399

>Ecym_4027 Chr4 complement(64272..65420) [1149 bp, 382 aa] {ON}
           similar to Saccharomyces cerevisiae YOR084W LPX1
          Length = 382

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 247 DIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKSGSRTHTP- 305
           D+RSI G+  R   E     T D L  + SV+  R    +G   R++ VF  GS  +   
Sbjct: 11  DVRSIQGMSPRSWPESVIDPTQDLLQVVYSVFEPREGVKRGGGTRVNMVFLHGSGMNRAL 70

Query: 306 -KYTLTWLWKS 315
            +Y L  LW S
Sbjct: 71  WEYYLVPLWHS 81

>NCAS0A13240 Chr1 (2605834..2609250) [3417 bp, 1138 aa] {ON}
           Anc_7.197 YIL031W
          Length = 1138

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 128 RKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLLHASK 184
           +KFF   E P+ET E+W+ + ++    +K +  Y + K    QA+RK+   LLH  K
Sbjct: 708 QKFF---ENPKETLEMWRNSKVRSKSASKKINLYFE-KSSRGQARRKLRDILLHLQK 760

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,701,515
Number of extensions: 2158128
Number of successful extensions: 8439
Number of sequences better than 10.0: 33
Number of HSP's gapped: 8610
Number of HSP's successfully gapped: 62
Length of query: 539
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 425
Effective length of database: 40,409,475
Effective search space: 17174026875
Effective search space used: 17174026875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)