Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0D008706.16ON1069106950260.0
CAGL0B03641g6.16ON98894021400.0
NCAS0H008806.16ON100473319440.0
ZYRO0C07898g6.16ON97469516950.0
TDEL0G045306.16ON95863516400.0
Skud_5.286.16ON99862115900.0
SAKL0E01078g6.16ON94860015730.0
YEL061C (CIN8)6.16ON100063715620.0
Smik_5.266.16ON100263715470.0
KAFR0L003706.16ON96363815200.0
Suva_5.66.16ON99962015140.0
KLTH0C11330g6.16ON94168814440.0
Ecym_30206.16ON94467814430.0
Kwal_56.224036.16ON94368814191e-180
ACR010C6.16ON94567813691e-172
KNAG0M011306.16ON95066913551e-170
KLLA0D01045g6.16ON96563513441e-168
TPHA0M002406.16ON93970513271e-166
TBLA0A072306.16ON109764013191e-163
Kpol_1045.736.16ON96262610571e-126
Kpol_1032.66.16ON10041637091e-77
TPHA0J003006.16ON9826277062e-77
Smik_2.537.387ON11134826394e-68
Suva_2.547.387ON11102206378e-68
YBL063W (KIP1)7.387ON11112206342e-67
Skud_2.417.387ON11102206332e-67
SAKL0F12298g7.387ON11123196333e-67
ACR228C7.387ON11292276307e-67
TPHA0E008907.387ON12322166202e-65
Ecym_46887.387ON11342186094e-64
TDEL0C016007.387ON11052146051e-63
ZYRO0B03234g7.387ON11383055952e-62
NDAI0E043007.387ON11862215943e-62
NCAS0E026407.387ON11022165844e-61
KAFR0L017107.387ON11512275792e-60
TBLA0D006407.387ON11423284553e-45
SAKL0G05016g5.531ON5041763561e-34
KLTH0G03850g5.531ON4731733522e-34
KLLA0B00759g5.531ON4561883451e-33
Kwal_47.186085.531ON4791733442e-33
SAKL0G18920g2.633ON6491993263e-30
KNAG0B005203.528ON7231983175e-29
ADR145C2.633ON6351913138e-29
Ecym_34152.633ON6621863131e-28
ZYRO0D12650g5.531ON4781872972e-27
Ecym_40665.531ON4781722972e-27
CAGL0D04994g3.479ON6921482996e-27
Kwal_47.190933.528ON8191933007e-27
Skud_7.533.528ON8051923008e-27
ZYRO0E08668g3.528ON7781802999e-27
CAGL0I07029g3.528ON7051912971e-26
YGL216W (KIP3)3.528ON8051922962e-26
Suva_7.443.528ON8051922952e-26
TBLA0C039403.479ON7391832943e-26
NCAS0E005503.528ON7841822934e-26
Smik_7.483.528ON8051922934e-26
TDEL0D059603.528ON7331812925e-26
Kpol_423.83.528ON8061932926e-26
Kpol_1004.255.531ON5062152869e-26
KNAG0A078803.479ON7641432882e-25
TBLA0C049603.528ON8011882882e-25
TPHA0D032003.479ON7241482862e-25
KAFR0F042103.528ON6721922853e-25
NDAI0I029603.528ON8682022863e-25
KLLA0A01606g3.528ON7691822845e-25
KLTH0G01606g3.528ON8191932837e-25
SAKL0F01760g3.528ON8091802837e-25
TDEL0F036403.479ON7041482828e-25
YPR141C (KAR3)3.479ON7291442819e-25
Kpol_1050.1033.479ON6971522801e-24
TPHA0D034803.528ON8471812811e-24
SAKL0F03168g3.479ON7061512801e-24
Ecym_12003.528ON8331892802e-24
Skud_16.4353.479ON7291442792e-24
AGR253W3.479ON7091752792e-24
Smik_16.3883.479ON7291442782e-24
Kpol_1013.78.678ON6201952773e-24
KAFR0B065903.479ON7061742764e-24
TBLA0C053103.479ON6761742755e-24
Kpol_505.393.479ON6921482746e-24
NCAS0F034703.479ON6981802746e-24
Suva_16.4693.479ON7311442747e-24
NCAS0C013508.678ON6551852738e-24
NDAI0B057703.479ON7631642749e-24
AER441C3.528ON8181892749e-24
ZYRO0B04290g3.479ON7311492731e-23
KLLA0D05951g8.678ON6682912674e-23
KAFR0H024108.678ON6582432657e-23
Ecym_44073.479ON7111752641e-22
Kwal_26.88068.678ON7152132622e-22
ZYRO0F07414g8.678ON6541972603e-22
TPHA0D012708.678ON6962112594e-22
SAKL0H06490g8.678ON6572302585e-22
KLLA0B10956g3.479ON6901532586e-22
NDAI0E02090singletonON6851982578e-22
KLTH0D11286g8.678ON6782602561e-21
CAGL0M02189g8.678ON6721952551e-21
KLTH0F14498g3.479ON7021542551e-21
YPL155C (KIP2)8.678ON7062132506e-21
ACR145W8.678ON6852132452e-20
Skud_16.1278.678ON7062022443e-20
Smik_6.3528.678ON7152082382e-19
Ecym_23958.678ON6872162362e-19
KNAG0J017208.678ON6251862362e-19
TPHA0D041903.479ON6721522273e-18
TBLA0C018808.678ON4681502201e-17
TDEL0B072702.633ON6442682221e-17
TDEL0A062408.678ON6372352202e-17
Suva_16.1558.678ON7042122183e-17
Kpol_1019.112.633ON6472021712e-11
YKL079W (SMY1)2.633ON6561231702e-11
TPHA0N016502.633ON6821871675e-11
Skud_11.1482.633ON6561031649e-11
Kwal_55.21164singletonOFF5881641622e-10
Kwal_YGOB_55.211643.479ON6571641612e-10
Smik_11.1602.633ON656851551e-09
Suva_11.1452.633ON6571031523e-09
TBLA0A008202.633ON8031711399e-08
NDAI0C004802.633ON5981941326e-07
NCAS0H031802.633ON6601751318e-07
ZYRO0E01078g2.633ON6682031301e-06
KNAG0M025402.633ON5221011254e-06
CAGL0L05104g2.633ON6751881237e-06
TBLA0C008002.633ON6931331202e-05
KAFR0C040202.633ON667178960.011
NCAS0C052002.633ON57263890.082
KNAG0H003602.633ON681117880.11
Skud_12.1428.6ON24489840.18
YOR001W (RRP6)6.25ON733104850.22
YLR078C (BOS1)8.6ON24489820.30
ZYRO0B11220g8.210ON755120791.1
YKR054C (DYN1)1.216ON409274781.9
TPHA0C002605.638ON38265762.1
Skud_7.703.509ON101991762.5
SAKL0F07282g7.186ON1170142763.3
NCAS0C028308.401ON874127753.4
KAFR0D019305.39ON704102744.8
Smik_11.3161.216ON409074736.8
Smik_12.1378.6ON23456708.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0D00870
         (1069 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...  1940   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   828   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   753   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   657   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   636   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   617   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   610   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   606   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   600   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   590   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   587   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   560   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   560   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   551   e-180
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   531   e-172
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   526   e-170
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   522   e-168
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   515   e-166
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   512   e-163
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   411   e-126
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   277   1e-77
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   276   2e-77
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   250   4e-68
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   249   8e-68
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   248   2e-67
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   248   2e-67
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   248   3e-67
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   247   7e-67
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   243   2e-65
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   239   4e-64
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   237   1e-63
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   233   2e-62
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   233   3e-62
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   229   4e-61
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   227   2e-60
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   179   3e-45
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   141   1e-34
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   140   2e-34
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   137   1e-33
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   137   2e-33
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   130   3e-30
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   126   5e-29
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   125   8e-29
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   125   1e-28
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   119   2e-27
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   119   2e-27
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   119   6e-27
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   120   7e-27
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   120   8e-27
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   119   9e-27
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   119   1e-26
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   118   2e-26
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   118   2e-26
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   117   3e-26
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   117   4e-26
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   117   4e-26
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   117   5e-26
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   117   6e-26
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   114   9e-26
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   115   2e-25
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   115   2e-25
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   114   2e-25
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   114   3e-25
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   114   3e-25
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   114   5e-25
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   113   7e-25
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   113   7e-25
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   113   8e-25
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   112   9e-25
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   112   1e-24
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   112   1e-24
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   112   1e-24
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   112   2e-24
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   112   2e-24
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   112   2e-24
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   111   2e-24
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   111   3e-24
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   110   4e-24
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   110   5e-24
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   110   6e-24
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   110   6e-24
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   110   7e-24
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   109   8e-24
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   110   9e-24
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   110   9e-24
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   109   1e-23
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   107   4e-23
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   106   7e-23
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   106   1e-22
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   105   2e-22
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   104   3e-22
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   104   4e-22
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   103   5e-22
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   103   6e-22
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   103   8e-22
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   103   1e-21
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   102   1e-21
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   102   1e-21
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...   100   6e-21
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    99   2e-20
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    99   3e-20
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    96   2e-19
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    96   2e-19
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    96   2e-19
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    92   3e-18
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    89   1e-17
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    90   1e-17
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    89   2e-17
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    89   3e-17
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    70   2e-11
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    70   2e-11
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    69   5e-11
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    68   9e-11
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    67   2e-10
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    67   2e-10
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    64   1e-09
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    63   3e-09
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    58   9e-08
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    55   6e-07
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     55   8e-07
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    55   1e-06
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    53   4e-06
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    52   7e-06
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    51   2e-05
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    42   0.011
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    39   0.082
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    39   0.11 
Skud_12.142 Chr12 complement(270459..271190,271280..271282) [735...    37   0.18 
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...    37   0.22 
YLR078C Chr12 complement(285736..286467,286557..286559) [735 bp,...    36   0.30 
ZYRO0B11220g Chr2 (886235..888502) [2268 bp, 755 aa] {ON} simila...    35   1.1  
YKR054C Chr11 complement(535647..547925) [12279 bp, 4092 aa] {ON...    35   1.9  
TPHA0C00260 Chr3 complement(40434..41582) [1149 bp, 382 aa] {ON}...    34   2.1  
Skud_7.70 Chr7 complement(122463..125522) [3060 bp, 1019 aa] {ON...    34   2.5  
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    34   3.3  
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     33   3.4  
KAFR0D01930 Chr4 complement(389972..392086) [2115 bp, 704 aa] {O...    33   4.8  
Smik_11.316 Chr11 complement(525589..537861) [12273 bp, 4090 aa]...    33   6.8  
Smik_12.137 Chr12 complement(265551..266252,266370..266372) [705...    32   8.9  

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score = 1940 bits (5026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 975/1069 (91%), Positives = 975/1069 (91%)

Query: 1    MVEVPXXXXXXXXXXXXXXXXXRQNNSRRIPQEQQKQSRRDPKEGEQEEEELNITVAVRC 60
            MVEVP                 RQNNSRRIPQEQQKQSRRDPKEGEQEEEELNITVAVRC
Sbjct: 1    MVEVPSSNISLSSINSTLSATSRQNNSRRIPQEQQKQSRRDPKEGEQEEEELNITVAVRC 60

Query: 61   RGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVFGPSANQQL 120
            RGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVFGPSANQQL
Sbjct: 61   RGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVFGPSANQQL 120

Query: 121  IFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGIIPRILFKL 180
            IFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGIIPRILFKL
Sbjct: 121  IFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGIIPRILFKL 180

Query: 181  FDTLEMNQEDYVVKCSFIELYNEXXXXXXXXXXXXXXXXXXXXXXLRIFDSSTASNVNVP 240
            FDTLEMNQEDYVVKCSFIELYNE                      LRIFDSSTASNVNVP
Sbjct: 181  FDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFDSSTASNVNVP 240

Query: 241  GXXXXXXXXXXXXXXXXXXXXXXVGTTNNNYLRRKLKSSRYSNPENSNIFTSNASSSVKN 300
            G                      VGTTNNNYLRRKLKSSRYSNPENSNIFTSNASSSVKN
Sbjct: 241  GSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKLKSSRYSNPENSNIFTSNASSSVKN 300

Query: 301  MTKNSFLXXXXXXXXXXXXXXXXXXXPPKLPTSSLETPPQDDNNNGIYIQNLQEFHISNA 360
            MTKNSFL                   PPKLPTSSLETPPQDDNNNGIYIQNLQEFHISNA
Sbjct: 301  MTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQDDNNNGIYIQNLQEFHISNA 360

Query: 361  KEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSKMNLVDLAGSEN 420
            KEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSKMNLVDLAGSEN
Sbjct: 361  KEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSKMNLVDLAGSEN 420

Query: 421  INRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTRLLQDSLGGNTKTA 480
            INRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTRLLQDSLGGNTKTA
Sbjct: 421  INRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTRLLQDSLGGNTKTA 480

Query: 481  LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNITTELSQVKSDLLS 540
            LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNITTELSQVKSDLLS
Sbjct: 481  LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNITTELSQVKSDLLS 540

Query: 541  TKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLKDKRTSNEVNELQR 600
            TKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLKDKRTSNEVNELQR
Sbjct: 541  TKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLKDKRTSNEVNELQR 600

Query: 601  IKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMIENYECQQIDVKSKIE 660
            IKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMIENYECQQIDVKSKIE
Sbjct: 601  IKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMIENYECQQIDVKSKIE 660

Query: 661  QIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDMIQNEVIKMLGTTQEKAEKTYKQ 720
            QI              HQNKIKTLNSGTDFDIGSNLDMIQNEVIKMLGTTQEKAEKTYKQ
Sbjct: 661  QILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQNEVIKMLGTTQEKAEKTYKQ 720

Query: 721  FIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEYNNLKQYLNENLFQNN 780
            FIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEYNNLKQYLNENLFQNN
Sbjct: 721  FIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEYNNLKQYLNENLFQNN 780

Query: 781  HEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLNSFKAATDEVINKEMEL 840
            HEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLNSFKAATDEVINKEMEL
Sbjct: 781  HEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLNSFKAATDEVINKEMEL 840

Query: 841  FIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITASINQMYDNSTRLKTEMSA 900
            FIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITASINQMYDNSTRLKTEMSA
Sbjct: 841  FIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITASINQMYDNSTRLKTEMSA 900

Query: 901  DNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLKCAVASVNNLNHLEDSIK 960
            DNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLKCAVASVNNLNHLEDSIK
Sbjct: 901  DNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLKCAVASVNNLNHLEDSIK 960

Query: 961  MAVRDTRIKGGPTEGEVGVPFKKENGKEGPTKPGLQPLQPTNEIFLNSQQDQQHTTNGHG 1020
            MAVRDTRIKGGPTEGEVGVPFKKENGKEGPTKPGLQPLQPTNEIFLNSQQDQQHTTNGHG
Sbjct: 961  MAVRDTRIKGGPTEGEVGVPFKKENGKEGPTKPGLQPLQPTNEIFLNSQQDQQHTTNGHG 1020

Query: 1021 NYINKDNDNINHKSNNSGNVTIIKHSKKRQLEKIDEKNVSNKKITSNKG 1069
            NYINKDNDNINHKSNNSGNVTIIKHSKKRQLEKIDEKNVSNKKITSNKG
Sbjct: 1021 NYINKDNDNINHKSNNSGNVTIIKHSKKRQLEKIDEKNVSNKKITSNKG 1069

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/940 (48%), Positives = 614/940 (65%), Gaps = 42/940 (4%)

Query: 50  EELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVD 109
           EELNI VAVRCRGRNEREIK KSSV+V VPD   +NEVSINTTDDVGI A+MNSKTYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 110 KVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSES 169
           KVFGPSA+Q+L+++E+AEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL ++
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 170 AGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEXXXXXXXXXXXXXXXXXXXXXXLRIF 229
           AGIIPR+LF+LFDTLE N++DY+VKCSF+ELYNE                      LRIF
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKK---LRIF 206

Query: 230 DSSTASNVNVPGXXXXXXXXXXXXXXXXXXXXXXVGTTNNNYLRRKLKSSRYSNPENSNI 289
           DS      NV G                         +    LRRKL   R++   NS I
Sbjct: 207 DS------NVNGTSASGSSSRSSSRNNSPRSAP--DNSRAQMLRRKL--GRHNTTGNSKI 256

Query: 290 FTSNAS--SSVKNMTKNSFLXXXXXXXXXXXXXXXXXXXPPKLPTSSLETPPQDDNNNGI 347
             +N +  S  K  ++ S                     P     ++ +     D +  I
Sbjct: 257 SNNNHNKFSRFKQTSQES-------TRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSASI 309

Query: 348 YIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRL 407
           YIQNL+EFHI++A EGL LLQKGLK RQVASTKMNDFSSRSH+IFTITLYKE  G LFR+
Sbjct: 310 YIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELFRV 369

Query: 408 SKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTR 467
           SKMNLVDLAGSENI+RSGA+NQRAKE GSINQSLLTLGRVINSLAD++ HIPFRESKLTR
Sbjct: 370 SKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTR 429

Query: 468 LLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNI 527
           LLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLG+ I KDIL+++I
Sbjct: 430 LLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSI 489

Query: 528 TTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLK 587
           T+EL+++KSDLLSTKSKEG+YMS EHY+ L  +++ +KTE +ESKR IE L++QNA+L +
Sbjct: 490 TSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQ 549

Query: 588 DKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMIEN 647
           ++ +  + N   +  ++  +D++  LQ  ++ Q  KE  + S +  +Q + +  KK I  
Sbjct: 550 ERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHL 609

Query: 648 YECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDMIQNEVIKML 707
           +E +Q +++  I                 H   ++      D +I  NL  ++ EV+K++
Sbjct: 610 FEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVVKVI 669

Query: 708 GTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEYNN 767
              +E+A K+Y + ++  LK+TP  F+ +   +++I+   + +H+ +A+ LSD+SEEYNN
Sbjct: 670 KAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYNN 729

Query: 768 LKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLNSFK 827
           LKQYL  N F+NNHE+L++ H+ +T   L  ++  L   F  M++KH++ N+  ML +  
Sbjct: 730 LKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENIL 789

Query: 828 AATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQK-------EVTDGLSYTRSKI 880
             TDEVIN E+++F  ++ KWE+S  LINQCDS+N+ F +       E+ D +S +R  I
Sbjct: 790 GVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDNI 849

Query: 881 TASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVEN 940
            A+I+ +  + TR            N  + + +++ N +IR Q   + +KN       E+
Sbjct: 850 GATISSI-QSRTR------------NRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEH 896

Query: 941 SLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVP 980
           S + A  S+ ++N +E ++K+ +         + G+  VP
Sbjct: 897 STETATTSIGSVNKVEGNLKVIMDKVLNDPQLSRGKAEVP 936

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
            Anc_6.16
          Length = 1004

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/733 (54%), Positives = 536/733 (73%), Gaps = 21/733 (2%)

Query: 333  SSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIF 392
            SS+  P  D+N NGIYIQNLQEFHI+NAKEGL+LLQKGLK+RQVASTKMNDFSSRSHTIF
Sbjct: 289  SSIAGP--DENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIF 346

Query: 393  TITLYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA 452
            TITLYKEH+  LFRLSKMNLVDLAGSENINRSGA+NQRAKETGSINQSLLTLGRVINSLA
Sbjct: 347  TITLYKEHKDNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLA 406

Query: 453  DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 512
            D++ H+PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP
Sbjct: 407  DKSPHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 466

Query: 513  QLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESK 572
            QLGS+I KDILLKNIT+EL++VKSDL+STKSK+GIYMS EHYQ+L+ EL++ KTE  ESK
Sbjct: 467  QLGSVILKDILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESK 526

Query: 573  RIIERLSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVS 632
            R+IE+LSSQN++LLKDKR++NEVNELQRIKL+  +DS++ L EK+EIQNGKE  L+  + 
Sbjct: 527  RMIEKLSSQNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIG 586

Query: 633  KLQTSCDTFKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDI 692
            +L+ S +    +++NY+ +Q  +K++I  I              H++ I+   S  +FD+
Sbjct: 587  QLEKSREKLNSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIR--QSEGNFDV 644

Query: 693  GSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHA 752
              NL +I++E+  ML  TQ K E  YK+FIE FL+QTP N +KI E +  +   +  ++ 
Sbjct: 645  EMNLKVIKDEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYN 704

Query: 753  AVAQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMN 812
             + +NLSDISEEYNNLKQYL+ + FQNNHEDL+N HIN+TS  L  S+  LFN FK MM+
Sbjct: 705  EITENLSDISEEYNNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMD 764

Query: 813  KHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDG 872
             HL  N+ LM+++F+ AT++VI KEMELF P++ KWEESI+LIN+CDS+NNGF   +T  
Sbjct: 765  AHLMENKKLMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQ 824

Query: 873  LSYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNS 932
            +S  ++ + +S + +++    +K+++       +S + K  +E++ +    FNE+  KN 
Sbjct: 825  VSKIKTNLASSSSSIHNAIASIKSQVLEQLSNDDS-DVKTALENDPMFNKHFNEIIEKNM 883

Query: 933  IFQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKKENGKEGPTK 992
            I Q N +N++     S+ N++ L +++K+A+ +       T+G+   P  K       TK
Sbjct: 884  ILQKNRKNAINYTDKSLLNIDELSETVKIALNNIVDDVAITDGDDNSPGTK-------TK 936

Query: 993  PGLQPLQPTNEIFLNSQQDQQHTTNGHGNYINKDNDNINHKSNNSGNVTIIKHSKKRQLE 1052
              L+PL+  +++ +NS Q++++   G         D    K  NS +  +   SK++QL+
Sbjct: 937  SKLRPLRSASQLLINSNQNKENGVRGI--------DVTESKLGNSNSQILKIRSKRKQLD 988

Query: 1053 KIDEKNVSNKKIT 1065
            + D  N+++KKI+
Sbjct: 989  END-GNLASKKIS 1000

 Score =  267 bits (683), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 130/174 (74%), Positives = 146/174 (83%), Gaps = 13/174 (7%)

Query: 40  RDPKEGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITA 99
           R+P E   E+ ELNITVAVRCRGRNEREI  KS V+VTVPDI G+ E+SINTT + GITA
Sbjct: 20  REPPE---EDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITA 76

Query: 100 QMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDE 159
           QMNSKTYTVDKVFGP+A+Q LIF EVAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE
Sbjct: 77  QMNSKTYTVDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDE 136

Query: 160 KLY-NGE-LSESAGIIPRILFKLFDTLEMNQE--------DYVVKCSFIELYNE 203
           KLY NG  LS++AGIIPRILFKLFDTL+ ++         D+VVKCSF+ELYNE
Sbjct: 137 KLYQNGTMLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNE 190

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
            some similarities with uniprot|P27895 Saccharomyces
            cerevisiae YEL061C CIN8 Kinesin motor protein involved in
            mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/695 (49%), Positives = 487/695 (70%), Gaps = 32/695 (4%)

Query: 342  DNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQ 401
            D+ +G+YIQNLQ+FHI++A++GL LLQKGL+ RQVA+TKMNDFSSRSHTIFTITLY+EHQ
Sbjct: 272  DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331

Query: 402  GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461
            G +F++SKMNLVDLAGSENI+RSGA +QRAKE GSINQSLLTLGRVINSLAD++ H+PFR
Sbjct: 332  GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391

Query: 462  ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521
            ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL S I KD
Sbjct: 392  ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451

Query: 522  ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQ 581
            IL+KNIT EL++VKSDLLSTK +EG+YMSQ++Y+++ N+L+++KTE  ESKRIIERLSSQ
Sbjct: 452  ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511

Query: 582  NALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTF 641
            N+LLLKDK+ SNEVNELQRIKL   +D ++ L EK+E Q+ KEQ LV     L+++    
Sbjct: 512  NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571

Query: 642  KKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDF-------DIGS 694
            + +I+ Y  ++  +  +++ I              +   I+T +SG D         I  
Sbjct: 572  QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631

Query: 695  NLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAV 754
            NL++++ EV+++LG  Q++AEK YK +IE  L++ P  F+ I   ++ + + +  +H  +
Sbjct: 632  NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691

Query: 755  AQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKH 814
             +NLSDISE YNNLKQY N++ F+NNHE+++N+HI+ T Q L  SAD L   FK MM+ H
Sbjct: 692  TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751

Query: 815  LESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLS 874
            L+ N+ LM+ S ++AT E I+KEM+LF P++KKWEES DLIN CDS++NGF  ++   LS
Sbjct: 752  LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811

Query: 875  YTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIF 934
              +S   +S + +  + +++K E+     GY   +T  +++ N++++ Q  ++  K+S  
Sbjct: 812  DIKSTFGSSTDVISRSVSKVKDEVK----GYEDAST--ILDGNEVVKRQIADIINKDSSL 865

Query: 935  QDNVENSLKCAVASVNNLNHLEDSIKMAV-------RDTRIKGGPTEGEVGVPFKKENGK 987
            ++ +  S+K +   ++  + L++ I+  +          +I   P  G        +N +
Sbjct: 866  RNGLYKSIKSSQGHISAFDELKERIRNTIASENSTLHQNKIATTPPLG--------QNSE 917

Query: 988  EGPTKPG-LQPLQ-PTNEIF--LNSQQDQQHTTNG 1018
              P KP  LQP Q P N  +   +  +DQ   +NG
Sbjct: 918  RSPLKPTVLQPNQLPENWRYGLRSPPKDQLSKSNG 952

 Score =  283 bits (724), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 134/162 (82%), Positives = 149/162 (91%)

Query: 42  PKEGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQM 101
           P  G ++ EELNITVAVR RGRNEREI+ KSSV+V+VPD+ GS+EV+INTTDDVGITAQM
Sbjct: 5   PAGGGEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQM 64

Query: 102 NSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 161
           NSKTY VDKVFGPSANQQLIF E+AEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKL
Sbjct: 65  NSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKL 124

Query: 162 YNGELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           YN ELS+SAGIIPRILFKLF+TL++  EDYVVKCSF+ELYNE
Sbjct: 125 YNDELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNE 166

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/635 (51%), Positives = 455/635 (71%), Gaps = 9/635 (1%)

Query: 342 DNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQ 401
           D N GIYIQNLQ+FHI+NAKEG+ LLQKGLK+RQVA+TKMNDFSSRSHTIFTITLYKE+ 
Sbjct: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303

Query: 402 GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461
           G +FR+SKMNLVDLAGSENI+RSGA +QRAKE GSINQSLLTLGRVINSL D++ H+PFR
Sbjct: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363

Query: 462 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YA+KAKNIKNKPQLGS+I KD
Sbjct: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423

Query: 522 ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQ 581
           IL+KNIT EL+++K+DLLSTKSKEGIYMSQ++Y++L N+L+++KTE  E KR IE L+SQ
Sbjct: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483

Query: 582 NALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTF 641
           N LLLKDK+ SNEVN+LQRIKL   +D+++ L  K E QN +EQ LV++ S L+T+  T 
Sbjct: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTM 543

Query: 642 KKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDMIQN 701
           + +I+ +E ++ D++SK+  +              +   I+      +  +  N+D I+ 
Sbjct: 544 QSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRG 603

Query: 702 EVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDI 761
           E+ K+L   Q++ +  YK  +E  L +TP +F+   E ++++   I   H  + +NLSD+
Sbjct: 604 EISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDV 663

Query: 762 SEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNL 821
           SEE+NNL+QYLN++ F+NNHE+++ +HI+ T   +  SAD LF  FK+MM+ HLE N++L
Sbjct: 664 SEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDL 723

Query: 822 MLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKIT 881
           ML S K AT +VI KEM+LF P+KKKWE+S   IN+CDS+N  FQ  V   L   +S + 
Sbjct: 724 MLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLG 783

Query: 882 ASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENS 941
           +S   +    T++K +M          +  +++ ++++   QF+ +  K S+  ++++ S
Sbjct: 784 SSQEAINKTITKVKEQMDEHE------SPASMLSNSRVFSEQFSGILNKQSLLHESLKKS 837

Query: 942 LKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGE 976
           +       + ++ L+++I   V +   +G   EGE
Sbjct: 838 VIITSDHADAVDKLKEAIDHVVSE---RGSSMEGE 869

 Score =  289 bits (739), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 143/194 (73%), Positives = 160/194 (82%), Gaps = 5/194 (2%)

Query: 42  PKEGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQM 101
           P+   ++ EELNITVAVRCRGRNEREIK KSSV+V+VPD+ GSNEVSINTT DVGITAQ+
Sbjct: 5   PQASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQI 64

Query: 102 NSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 161
           NSKTYTVD+VFGPSANQ L+F ++AEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKL
Sbjct: 65  NSKTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 124

Query: 162 YNGELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEXXXXXXXXXXXXXXXXXX 221
           Y+GELSESAGIIPRILFKLF+TLE+ +EDYVVKCSF+ELYNE                  
Sbjct: 125 YDGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNE-----ELKDLLGDSQEIA 179

Query: 222 XXXXLRIFDSSTAS 235
               LRIFDS+T S
Sbjct: 180 SSRKLRIFDSNTMS 193

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/621 (52%), Positives = 441/621 (71%), Gaps = 6/621 (0%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           Q+D +NGIYIQNLQEFHI+NA EGL LLQ+GLK+RQVASTKMNDFSSRSHTIFTITLYK+
Sbjct: 307 QNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 366

Query: 400 HQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIP 459
           HQ  LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+L DR+ HIP
Sbjct: 367 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIP 426

Query: 460 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIIS 519
           FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ + 
Sbjct: 427 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMM 486

Query: 520 KDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLS 579
           KDIL+KNIT EL+++KSDLLSTKSKEGIYMSQ+HY+ L ++L++HK E  E KR IE L+
Sbjct: 487 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLA 546

Query: 580 SQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCD 639
           S+N+LL+KDK  S E  + Q  ++   + +IN L+ +++ Q+  E  +    +KLQ   +
Sbjct: 547 SKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTE 606

Query: 640 TFKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDMI 699
             +  +++Y+ +++D+  K E                  + ++  N   + DI  NLDM+
Sbjct: 607 VMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMV 666

Query: 700 QNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLS 759
           +NEV+ ++ T QEKAE  YK  ++  L ++P+ F  I E I+ I I+ QN +  +A+NLS
Sbjct: 667 KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLS 726

Query: 760 DISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNR 819
           DISEE NNLKQYL  + F+NNH++L+N HI+ST + +    +     FK  +N HLE N+
Sbjct: 727 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENK 786

Query: 820 NLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSK 879
            L++ +   AT  VI++EM+LF PR+ KWE S DLIN+CDS+NN F   +   LS  +  
Sbjct: 787 KLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKT 846

Query: 880 ITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVE 939
           +  S N M ++ + +K ++        S N  +++++N     QF +L  K+ I +DN+E
Sbjct: 847 VDTSSNSMNESISVMKGQVEE------SENAISLLKNNTKFNDQFKQLISKHIILKDNIE 900

Query: 940 NSLKCAVASVNNLNHLEDSIK 960
           +S+    + + N++ + ++I+
Sbjct: 901 SSITSTHSHITNVDDIYNTIE 921

 Score =  285 bits (729), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (90%)

Query: 50  EELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVD 109
           EELNITVAVRCRGRNEREI +KSSV+V VPDI GS EVSINTT D GITAQMN+K YTVD
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 110 KVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSES 169
           KVFGP A+Q LIF+EVA PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+++
Sbjct: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154

Query: 170 AGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           AGIIPR+L KLFDTLE+ Q DYVVKCSFIELYNE
Sbjct: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNE 188

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/600 (52%), Positives = 426/600 (71%), Gaps = 6/600 (1%)

Query: 342 DNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQ 401
           + ++ IYIQNLQEFHI+NAK+G+ LLQ+GLK+RQVASTKMNDFSSRSHTIFTI LYK H 
Sbjct: 256 EQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHN 315

Query: 402 GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461
           G +FR+SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLAD+N HIPFR
Sbjct: 316 GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 375

Query: 462 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521
           ESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG+++ KD
Sbjct: 376 ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKD 435

Query: 522 ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQ 581
           IL+KNIT EL+++KSD LSTKSK+GIYM+Q+HY++L ++L+N+KTE  E KR IE+++SQ
Sbjct: 436 ILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQ 495

Query: 582 NALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTF 641
           N LLLKDKR S+EV+ELQRIK+    D I  L +K++ Q+  EQ LV ++  L+ +  T 
Sbjct: 496 NVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTV 555

Query: 642 KKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDMIQN 701
           +  ++N E  Q+  KS++E +                  +K  +S     I  N+D+IQ 
Sbjct: 556 QNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQE 615

Query: 702 EVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDI 761
           E+ ++L +    +    +  +E  L+  P++F+ I  D+ DI+  + ++   + +NL DI
Sbjct: 616 ELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGDI 675

Query: 762 SEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNL 821
           SEEYNN ++YLNE+LF+NNHE+ ++ H++ T   L  SA  LF+ FK+MM+ HLE N++L
Sbjct: 676 SEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKSL 735

Query: 822 MLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKIT 881
           M+ S K A+DEV+ KE++LF P K+KWE S++ IN+CDSLNN F   V D L      I 
Sbjct: 736 MIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNIE 795

Query: 882 ASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENS 941
            S+    + +  +K  +   +G         V+++N  +    NE+  K++  +D VE +
Sbjct: 796 GSLEFSKNTAGDVKDSLKKFDG------ISEVLKNNTKVVNNINEVKEKHTFLRDQVERT 849

 Score =  293 bits (749), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 148/158 (93%)

Query: 46  EQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKT 105
           E+  +ELNITV+VRCRGRNEREIK KSSV+VTVPD+ GSNEVSINTTD++GITAQMNSKT
Sbjct: 11  EENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKT 70

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           YTVDKVFGPSA+Q LIF ++AEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GE
Sbjct: 71  YTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 130

Query: 166 LSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           LS++AGIIPRILFKLFDTLE   EDY+VKCSFIELYNE
Sbjct: 131 LSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNE 168

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/637 (50%), Positives = 446/637 (70%), Gaps = 6/637 (0%)

Query: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEH 400
           +D  NGIYIQNLQEFHI+NA EGL LLQKGLK+RQVASTKMNDFSSRSHTIFTITLYK+H
Sbjct: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369

Query: 401 QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPF 460
           Q  LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+L D++ HIPF
Sbjct: 370 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 429

Query: 461 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISK 520
           RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGS I K
Sbjct: 430 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMK 489

Query: 521 DILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSS 580
           DIL+KNIT EL+++KSDLLSTKSKEGIYMSQ+HY+ L ++L+++K E  E KR IE L+S
Sbjct: 490 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTS 549

Query: 581 QNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDT 640
           +NALL+KDK  S E  + Q  ++   + +I+ L+ +++ Q+  E  +    +KLQ   + 
Sbjct: 550 KNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEV 609

Query: 641 FKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDMIQ 700
            +  + +Y+ +++D+  K E                  N ++  +   + +I  NLDMI+
Sbjct: 610 MQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIK 669

Query: 701 NEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSD 760
           NEV+ ++ T QEKAE  YK  ++  L ++P+ F  + E I+ I +  Q  +  +A+NLSD
Sbjct: 670 NEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSD 729

Query: 761 ISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRN 820
           ISEE NN+KQYL  + F+NNH++L+N H++ST + +    +     FK ++N HL+ N+ 
Sbjct: 730 ISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKK 789

Query: 821 LMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKI 880
           L++ +   AT  VI++EM+LF P++ KWE S DLIN CDS+NN F   +   LS  +S +
Sbjct: 790 LIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTV 849

Query: 881 TASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVEN 940
             S N M ++ + +K ++        S N  +++++N     QF +L  K+++ +DN++N
Sbjct: 850 DTSSNSMNESISVMKGQVEE------SENAISLLKNNTKFNDQFEQLINKHNMLKDNIKN 903

Query: 941 SLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEV 977
           S+    + + N++ + ++I+  +++   K   T+ E+
Sbjct: 904 SITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEM 940

 Score =  288 bits (737), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 140/154 (90%)

Query: 50  EELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVD 109
           EELNITVAVRCRGRNEREI +KSSV+V VPDI GS E+SINTT D GITAQMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 110 KVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSES 169
           KVFGP A+Q LIFDEVA PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS++
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 170 AGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           AGIIPR+L KLFDTLE+ Q DYVVKCSFIELYNE
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/637 (50%), Positives = 443/637 (69%), Gaps = 6/637 (0%)

Query: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEH 400
           +D +NGIYIQNLQEFHI+NA EGL LLQKGLK+RQVASTKMNDFSSRSHTIFTITLYK+H
Sbjct: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371

Query: 401 QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPF 460
           Q  LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+L D++ HIPF
Sbjct: 372 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 431

Query: 461 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISK 520
           RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ I K
Sbjct: 432 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 491

Query: 521 DILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSS 580
           DIL+KNIT EL+++KSDLLSTKSKEGIYM+Q+HY+ L ++L+++K E  E KR IE L+S
Sbjct: 492 DILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTS 551

Query: 581 QNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDT 640
           +N+LL+K+K  S E  + Q  ++   + +I+ L+ +++ Q+  E  +    SKLQ   + 
Sbjct: 552 KNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEV 611

Query: 641 FKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDMIQ 700
            +  +++Y+ +++D+  K E                  + ++  N   + DI  NLD+I+
Sbjct: 612 MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIK 671

Query: 701 NEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSD 760
           NEV+ ++ T QEKAE  YK  ++  L ++P+ F  I E I+ I +  +  +  +A+NLSD
Sbjct: 672 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSD 731

Query: 761 ISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRN 820
           ISEE NNLKQY   + F+NNH++L++ H++ST + +    +     FK  +N HLE N+ 
Sbjct: 732 ISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKK 791

Query: 821 LMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKI 880
           L++ +    T  VI++EM LF P++ KWE S DLIN+CDS+NN F   +   LS  +S +
Sbjct: 792 LIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTV 851

Query: 881 TASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVEN 940
             S N M  + + +K ++        S N  +++++N     QF +L  K++I +DN+E+
Sbjct: 852 DTSSNSMNKSISVMKGQVEE------SENAISLLKNNIKFNDQFKQLINKHTILKDNIES 905

Query: 941 SLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEV 977
           S+    + + N++ + ++I+  + +   K   T+ E+
Sbjct: 906 SITSTNSHITNIDDIYNTIEKIMNNYGNKENATKDEM 942

 Score =  290 bits (742), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 132/154 (85%), Positives = 140/154 (90%)

Query: 50  EELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVD 109
           EELNITVAVRCRGRNEREI +KSSV+V VPDI GS E+SINTT D GITAQMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 110 KVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSES 169
           KVFGP A+Q LIFDEVA PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS+S
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 170 AGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           AGIIPR+L KLFDTLE+ Q DYVVKCSFIELYNE
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/638 (49%), Positives = 433/638 (67%), Gaps = 6/638 (0%)

Query: 331 PTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHT 390
           P  + ++  Q D   GIYIQNLQEFHI+ AKEG+ LLQKGLKYRQVASTKMNDFSSRSHT
Sbjct: 274 PADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHT 333

Query: 391 IFTITLYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINS 450
           IFTITL+KE +G +FRLSKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVINS
Sbjct: 334 IFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINS 393

Query: 451 LADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 510
           LAD+N H+PFRESKLTRLLQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKN
Sbjct: 394 LADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKN 453

Query: 511 KPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADE 570
           KPQLGS I KDILLKNITTEL+++KSDLLSTKSK+GIYM Q+HY++L  +L N+KTE  E
Sbjct: 454 KPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQE 513

Query: 571 SKRIIERLSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSS 630
            KR IE L+SQNALLLKDKRT NE NELQRIK+    +S+  L  KIE Q   E  L   
Sbjct: 514 CKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGK 573

Query: 631 VSKLQTSCDTFKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDF 690
           +     +     K+I+  + ++  V SK + +                   K      +F
Sbjct: 574 IQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNF 633

Query: 691 DIGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNH 750
            +  NL +I++E+  +L T ++  EK Y++ I  FL  TP  F +I +++ ++     N+
Sbjct: 634 TVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNY 693

Query: 751 HAAVAQNLSDISEEYNNLKQYLNENLF---QNNHEDLINAHINSTSQTLTNSADVLFNTF 807
           ++ +A+NLSD+SEEYNN KQ++ +  +   + +  +L+N +IN+T   + +S++ + +T 
Sbjct: 694 YSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTI 753

Query: 808 KDMMNKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQK 867
           ++++N+HL +N+ L++NS    T E+++ E++   P+  KWEES +LIN+ D+LNN F  
Sbjct: 754 QNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFND 813

Query: 868 EVTDGLSYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNEL 927
            V   ++    KI  + + + +N  ++      ++  +++     +++DN II+  F  +
Sbjct: 814 NVESSMTTMTDKIKQTNDSINNNIKKINEHFKTNDIAHSN---NLMIDDNNIIKNNFKSI 870

Query: 928 ARKNSIFQDNVENSLKCAVASVNNLNHLEDSIKMAVRD 965
             KNS   + V+        S+  LN L+ SI+  ++D
Sbjct: 871 EEKNSRLHEFVKEGYLVTNESMKKLNELDTSIRTVLKD 908

 Score =  286 bits (732), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 132/166 (79%), Positives = 148/166 (89%), Gaps = 3/166 (1%)

Query: 41  DP---KEGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGI 97
           DP    + + +EEELNITVAVRCRGRN+REI  KSSV+VTVPDI GS EV+INT++D+G 
Sbjct: 3   DPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGF 62

Query: 98  TAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTG 157
           TAQMNSKTYTVDKVFGPSA Q LIFDE+AEPLF DFIKGYNCT+LVYGMTSTGKTYTMTG
Sbjct: 63  TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 122

Query: 158 DEKLYNGELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           DEKLYN ELS+SAGIIPRILFKLF+TLE   ED++VKCSF+ELYNE
Sbjct: 123 DEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNE 168

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/620 (52%), Positives = 441/620 (71%), Gaps = 6/620 (0%)

Query: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEH 400
           +D +NGIYIQNLQEFHI+NA EGL LLQ+GLK+RQVASTKMNDFSSRSHTIFTITLYK+H
Sbjct: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368

Query: 401 QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPF 460
           Q  LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+LAD++ HIPF
Sbjct: 369 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 428

Query: 461 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISK 520
           RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ I K
Sbjct: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 488

Query: 521 DILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSS 580
           DIL+KNIT EL+++KSDLLSTKSKEGIYMSQ+HY+ L ++L+++K E  E KR IE LSS
Sbjct: 489 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSS 548

Query: 581 QNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDT 640
           +N+LLLKDK  S +  + Q  ++   + +IN L+ +++ Q+  E  +    +KLQ   + 
Sbjct: 549 KNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 608

Query: 641 FKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDMIQ 700
            +  +++Y+ +++D+  K E                  + ++  N   + +I  NLD+I+
Sbjct: 609 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK 668

Query: 701 NEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSD 760
           NEV+ ++ T QEKAE  YK  ++  L ++P+ F  I E I+ I +  Q  +  +A+NLSD
Sbjct: 669 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSD 728

Query: 761 ISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRN 820
           ISEE NNLKQYL  + F+NNH++L+N HI+ST + +          FK+ +N HLE N+ 
Sbjct: 729 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 788

Query: 821 LMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKI 880
           L++ +   AT  VIN+EM+LF P++ KWE S DLIN+CDS+NN F   +   LS  ++ +
Sbjct: 789 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 848

Query: 881 TASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVEN 940
             S N M  + + +K ++        S N  +++++N+    QF +L  K++I +DN+EN
Sbjct: 849 DTSSNSMNKSISVMKGQVEE------SENAVSLLKNNKKFNDQFKQLVNKHTILKDNIEN 902

Query: 941 SLKCAVASVNNLNHLEDSIK 960
           S+    + + N++ + D+I+
Sbjct: 903 SITSTHSHITNIDDIYDTIE 922

 Score =  288 bits (736), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 132/154 (85%), Positives = 140/154 (90%)

Query: 50  EELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVD 109
           EELNITVAVRCRGRNEREI +KSSV+V VPDI GS EVSINTT D GITAQMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92

Query: 110 KVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSES 169
           KVFGP A+Q LIFDEVA PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS++
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 170 AGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           AGIIPR+L KLFDTLE+ Q DYVVKCSFIELYNE
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
            similar to uniprot|P27895 Saccharomyces cerevisiae
            YEL061C CIN8 Kinesin motor protein involved in mitotic
            spindle assembly and chromosome segregation
          Length = 941

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/688 (45%), Positives = 444/688 (64%), Gaps = 47/688 (6%)

Query: 344  NNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGT 403
            N+ I+IQNLQEFHI +AKEG+ LLQ+GL++RQVASTKMND SSRSHTIFTI LY++  G 
Sbjct: 234  NSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGE 293

Query: 404  LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRES 463
             FR+SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLAD+N HIPFRES
Sbjct: 294  SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRES 353

Query: 464  KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDIL 523
            KLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+GS I KD+L
Sbjct: 354  KLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVL 413

Query: 524  LKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNA 583
            +KN+T EL +++SDLL+TKSK+GIYMSQE+Y++L NEL+N+KTE  E KR IERLS+QN 
Sbjct: 414  VKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNG 473

Query: 584  LLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKK 643
            LL K+KR +NEVNE QR+K+ K  ++I+ L +KI+ Q+  EQ L + V +L  +  T + 
Sbjct: 474  LLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQN 533

Query: 644  MIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTD---FDIGSNLDMIQ 700
             ++ YE Q    ++++E++                 K+K    GT+   FD+ +N+D + 
Sbjct: 534  SLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLK----GTEEDGFDVDANIDTLT 589

Query: 701  NEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSD 760
             E+ ++         +  ++F+    +QTP   + I   +  I   + ++ + +  +LS 
Sbjct: 590  KELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSS 649

Query: 761  ISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRN 820
            ISEEYN+LK YLNE+ F+NN +D ++ H++ T   L  SA+ +F   ++MMN+ LE+N+ 
Sbjct: 650  ISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKE 709

Query: 821  LMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKE-----------V 869
            +M+ S K A  EV+ KEM L  P K+ WE S++ IN+CD LN+GF+K+           +
Sbjct: 710  IMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKI 769

Query: 870  TDGLSYTRSKITAS---INQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNE 926
             +GL ++ S +  +   +++  D S  L+T                    + +I     E
Sbjct: 770  NEGLQFSESAVGDANLDLSRFQDASRALRT--------------------DDVIPGSIEE 809

Query: 927  LARKNSIFQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKKENG 986
            + +K+++ +  V++S     A+      ++DSI+  +    +    +E  +    ++ NG
Sbjct: 810  IKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENRIEGLLEQLNG 869

Query: 987  KEGPTKP----GLQPLQPTNEIFLNSQQ 1010
            K  P KP    G  P++ T     +S Q
Sbjct: 870  K--PLKPLGPSGKTPMRITQGCIASSDQ 895

 Score =  283 bits (724), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 133/186 (71%), Positives = 150/186 (80%), Gaps = 5/186 (2%)

Query: 48  EEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYT 107
           EEEELNITVAVRCRGRNE+E+K KSSV+V VPD+ G+NEVSINTT D GITAQ+NSKTYT
Sbjct: 3   EEEELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62

Query: 108 VDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 167
           VD+VFGPSA+Q LIF  +AEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS
Sbjct: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122

Query: 168 ESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEXXXXXXXXXXXXXXXXXXXXXXLR 227
           E AGIIPR+LFKLFD L+ + +DY++KCSFIELYNE                      LR
Sbjct: 123 EGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNE-----ELKDLLDETPDSSMPRKLR 177

Query: 228 IFDSST 233
           IFDS T
Sbjct: 178 IFDSVT 183

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
            Ashbya gossypii ACR010C
          Length = 944

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/678 (44%), Positives = 451/678 (66%), Gaps = 17/678 (2%)

Query: 328  PKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
            PK P  SL      + ++ IYIQNLQEFHI+NA+EG+++LQKGLK+RQVASTKMNDFSSR
Sbjct: 230  PKRP--SLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSR 287

Query: 388  SHTIFTITLYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRV 447
            SHTIFTI LYK ++G LFR+SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRV
Sbjct: 288  SHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRV 347

Query: 448  INSLADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 507
            INSLAD++ HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKN
Sbjct: 348  INSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKN 407

Query: 508  IKNKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTE 567
            IKN+PQLGS + KDIL+K+I++ELS++KSD LSTK+KEGIYMS EHYQ+++N+L+N++TE
Sbjct: 408  IKNRPQLGSFMMKDILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTE 467

Query: 568  ADESKRIIERLSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQML 627
              ESKR +E  SSQN+LLLKDK+ S ++NELQ +K+++ Q++I  L +KIE Q+  E  L
Sbjct: 468  IQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDL 527

Query: 628  VSSVSKLQTSCDTFKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSG 687
            VS++ KL+ +  T K  ++NYE  ++ +++ I+++              H   +KT    
Sbjct: 528  VSTIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLD 587

Query: 688  TDFDIGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKI 747
             +  I  N+D I+    + L + +          ++    Q   ++++  E + D++ K+
Sbjct: 588  KNLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKV 647

Query: 748  QNHHAAVAQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTF 807
            Q +   +   L++++EE NN+K+YL+E+  +NN++++++  +         ++D L ++ 
Sbjct: 648  QTYSVTLTNKLTEMTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSV 707

Query: 808  KDMMNKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQK 867
              MM  H+E +RNLML+S K A  E+I+KE+E+F P K++W  S + IN+CD+ +  F+ 
Sbjct: 708  VSMMESHMEESRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFEN 767

Query: 868  EVTDGLSYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVED---NQIIRTQF 924
            + T        K+  ++ ++ DNS  +  +  A     N  N + +V      + I  Q 
Sbjct: 768  KST--------KLLTNLKELADNSV-VAADDVAKQVQENVTNFEGIVRQASAKESIVKQM 818

Query: 925  NELARKNSIFQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKKE 984
            N++  K+ + +D+ EN++K    S      ++ SIK  +R+   + G  + ++    ++ 
Sbjct: 819  NDINDKHKMLEDHFENNIKYFKESSKGFEEMDCSIKKIIREMSPEVGDIK-QIEALLERV 877

Query: 985  NGKE-GP-TKPGLQPLQP 1000
            N +  GP    G  P++P
Sbjct: 878  NSRSFGPIASTGKTPMRP 895

 Score =  285 bits (730), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 153/187 (81%), Gaps = 7/187 (3%)

Query: 50  EELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVD 109
           EELNITVAVRCRGRNEREIK KS+V+VTVPD+ GSNEVSINTT D+GI  +MNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 110 KVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSES 169
           +VFGPSA+Q+LIF  +AEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELS+S
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138

Query: 170 AGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEXXXXXXXXXXXXXXXXXXXXXXLRIF 229
           AGIIPR+LF+LFDTLE  + D++VKCS+IELYNE                      LRIF
Sbjct: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNE-------ELKDLLDDTPDYSKRLRIF 191

Query: 230 DSSTASN 236
           DS+T +N
Sbjct: 192 DSNTITN 198

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
            (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  551 bits (1419), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 310/688 (45%), Positives = 447/688 (64%), Gaps = 22/688 (3%)

Query: 327  PPKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSS 386
            P K P S   +P +   ++ I+IQNLQEFHI +AKEG+ LLQ+GL++RQVASTKMND SS
Sbjct: 220  PTKSPVSKPVSPCEP--SSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSS 277

Query: 387  RSHTIFTITLYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGR 446
            RSHTIFTI LYK+  G  FR+SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGR
Sbjct: 278  RSHTIFTIMLYKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR 337

Query: 447  VINSLADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 506
            VINSLAD++ HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAK
Sbjct: 338  VINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAK 397

Query: 507  NIKNKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKT 566
            NIKNKPQ+GS I KD+LLK++T EL ++KSDLLSTKSK+GIYMSQE+Y++L NEL+N+KT
Sbjct: 398  NIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKT 457

Query: 567  EADESKRIIERLSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQM 626
            E +E KR +E++S+QN+LL+K+KR SNEVNE Q++KL K  ++I  L +KI+ Q+  EQ 
Sbjct: 458  EVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQE 517

Query: 627  LVSSVSKLQTSCDTFKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNS 686
            L + V +L  +  T ++ +  YE Q     +++E++                 K+K    
Sbjct: 518  LSNVVQELMRALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVD 577

Query: 687  GTDFDIGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIK 746
                D+  N+D +  E+ ++         + ++ +I+    QTP  FK I   +  I   
Sbjct: 578  ENGDDVEVNVDAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSV 637

Query: 747  IQNHHAAVAQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNT 806
            + ++ + +  +LS ISEEYNNLK YLNE+ F+NN ++ ++ H++ T   L  SA+ +F  
Sbjct: 638  VSSYSSNLMIHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLK 697

Query: 807  FKDMMNKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQ 866
             ++M+N+ L++N+  M+ S + A  EV+ KEM L  P K+ WE S++ IN+CD LNN F+
Sbjct: 698  LREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFE 757

Query: 867  KEVTDGLSYTRSKITASINQMYDNST----RLKTEMSADNGGYNSINTKNVVEDNQIIRT 922
             ++      T ++I  +I+Q    S       K+E++     ++S+      ++N II  
Sbjct: 758  NKI----GVTVNEIFKTIDQGQKTSQVTTEDAKSELTRVRAAFSSL------QNNGIILQ 807

Query: 923  QFNELARKNSIFQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFK 982
              + + +K+++ +  V++S     A+      +++SI+  +    I    +E  +    +
Sbjct: 808  NVDSIKKKHNLLKSQVQDSANYMQAATQKFGEIDNSIQDLLNAQTIPQPQSENPIDGLLE 867

Query: 983  KENGKEGPTKPGLQPLQPTNEIFLNSQQ 1010
            + N K       L+PL P+ +  + + Q
Sbjct: 868  QLNDK------SLKPLGPSGKTPMRTVQ 889

 Score =  278 bits (712), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 141/156 (90%)

Query: 48  EEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYT 107
           ++EELNITVAVRCRGRNE+E+K +SSV+V VPD+ G+NEVSINTT D GITAQ+NSKTYT
Sbjct: 3   DDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62

Query: 108 VDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 167
           VDKVFGPSA+Q LIF  +AEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS
Sbjct: 63  VDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122

Query: 168 ESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           E AGIIPR+LFKLFD L    +DY++KCSFIELYNE
Sbjct: 123 EGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNE 158

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL061C
            (CIN8)
          Length = 945

 Score =  531 bits (1369), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 296/678 (43%), Positives = 435/678 (64%), Gaps = 17/678 (2%)

Query: 327  PPKLPTSSLETPPQ--DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDF 384
            PP +  + +    Q   ++ +GIY+QN+QEFHI NA+EG+ +LQKGLK+RQVASTKMNDF
Sbjct: 226  PPPVKANRMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDF 285

Query: 385  SSRSHTIFTITLYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTL 444
            SSRSHTIFTI LYK   G LFR+SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTL
Sbjct: 286  SSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 345

Query: 445  GRVINSLADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 504
            GRVINSLAD++ HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+K
Sbjct: 346  GRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAK 405

Query: 505  AKNIKNKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNH 564
            AKNIKN+PQLG+++ KDIL+KNI++EL+++KSD LSTKSK+GIYMS EHYQ+++N+L+N 
Sbjct: 406  AKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENC 465

Query: 565  KTEADESKRIIERLSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKE 624
            +TE  ESKR IE L+SQN LLLKDK+ S EV ELQ  K+ K Q +I  L +KIE Q+  E
Sbjct: 466  QTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNE 525

Query: 625  QMLVSSVSKLQTSCDTFKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTL 684
              L +++ KL+ +  T +  +++YE  ++ +++ I+++              H  K+K  
Sbjct: 526  TELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVS 585

Query: 685  NSGTDFDIGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENF-KKIGEDINDI 743
                +  I  N++ I       L + +          ++  +K+TP  + K+  E ++ +
Sbjct: 586  MLDKNLSIKENINNITTIFDDTLKSVEANGSDMCDTLVK-LIKETPSMYLKEFNETVSSL 644

Query: 744  NIKIQNHHAAVAQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVL 803
              ++ ++  A+   L++ISEE N+L++YL+++LF+N+ +++++  + S  Q + N +D L
Sbjct: 645  KSELSSYSNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQL 704

Query: 804  FNTFKDMMNKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNN 863
             +    M+  H+E +R LM+NS K   +E+I+ E  LF P + +W  S D INQCD+ + 
Sbjct: 705  LSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQ 764

Query: 864  GFQKEVTDGLSYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQ 923
             F+ + T GL   +    AS+    D   + K    + +     +        +Q ++ Q
Sbjct: 765  NFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCC------DQSLKKQ 818

Query: 924  FNELARKNSIFQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKK 983
             ++++ K+ + +D+ ++++K    S      ++ SIK  + +      P   EVG     
Sbjct: 819  MHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEM----SP---EVGDIKSV 871

Query: 984  ENGKEGPTKPGLQPLQPT 1001
            E   E        P++PT
Sbjct: 872  ETLMERINARTFSPVRPT 889

 Score =  289 bits (739), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 135/185 (72%), Positives = 152/185 (82%), Gaps = 7/185 (3%)

Query: 49  EEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTV 108
           +EELNITVAVRCRGRNEREIK KSSV+VTVPD+ GSNEVSINTTD+VGI A+MNS+TYTV
Sbjct: 18  QEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTV 77

Query: 109 DKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSE 168
           DKVFGPSA+Q LIF E+AEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+LS+
Sbjct: 78  DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSD 137

Query: 169 SAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEXXXXXXXXXXXXXXXXXXXXXXLRI 228
           SAGIIPRI+FKLFD LE    D++VKCS+IELYNE                      LRI
Sbjct: 138 SAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNE-------ELKDLLDESHDSSKRLRI 190

Query: 229 FDSST 233
           FDSS+
Sbjct: 191 FDSSS 195

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
            YEL061C
          Length = 950

 Score =  526 bits (1355), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 301/669 (44%), Positives = 430/669 (64%), Gaps = 23/669 (3%)

Query: 338  PPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLY 397
            PP      GIYIQNL++FHIS AKEGL LLQ+GL+ RQVA+TK+ND SSRSHTIFTITLY
Sbjct: 264  PP---TQTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLY 320

Query: 398  KEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNH 457
            K+ +  L+RLSK+NLVDLAGSEN+N++GA+N RAKE+GSINQSLLTLGRVINSLAD++ H
Sbjct: 321  KKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAH 380

Query: 458  IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSI 517
            IPFRESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLGS 
Sbjct: 381  IPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSF 440

Query: 518  ISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIER 577
            I KDILLK+++ EL ++++DL  TKSKEGIY+SQ++Y++++++LDN KTE  E KR  + 
Sbjct: 441  IIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDS 500

Query: 578  LSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIE---IQNGKEQMLVSSVSKL 634
            L  +N LL K+K++  E  +  + +L   +  +  +  K+     QN K    V+ ++++
Sbjct: 501  LVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRI 560

Query: 635  QTSCDTFKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGS 694
            QT     K +IE Y+ +    K K +++                + +K +NSG ++ I +
Sbjct: 561  QTE---LKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSG-NYQIHT 616

Query: 695  NLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAV 754
            ++D I+ EV+ +L TT+E AE  YK  I+  LK+TP+ F+ I +++ DI    + H+  +
Sbjct: 617  HIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEM 676

Query: 755  AQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKH 814
            A+N SD+SEE+N  KQYL+   FQNNH ++I  H +  +  +   +D L  + ++ +  +
Sbjct: 677  ARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNY 736

Query: 815  LESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLS 874
            L +N  ++ NS      +VINKEM+LF P+K KWEESIDLINQ DSL+N F+  +T  + 
Sbjct: 737  LSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVD 796

Query: 875  YTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARK-NSI 933
               S I  S   M  + + +K  +       N IN++  +  N+++   F  +  K N+I
Sbjct: 797  DIASVIRNSNESMDRSISTIKKHIIE-----NDINSQEQINSNELLTNSFKAIQEKSNNI 851

Query: 934  FQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKKENGKEGP-TK 992
                  +    A  S++ + +L+ SI+  +   +          GV    +N   GP   
Sbjct: 852  LHLVTGDLTVTAQESMDGIQNLDRSIRTLIHGDQY----IHSTKGVHIPPQN--RGPELH 905

Query: 993  PGLQPLQPT 1001
              L PL+P+
Sbjct: 906  STLIPLKPS 914

 Score =  208 bits (530), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 132/157 (84%), Gaps = 4/157 (2%)

Query: 48  EEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYT 107
           E++++NITVAVRCRGRN+REI+ KS ++VTVPD+  + EVSINT+   GI AQ+ +KTYT
Sbjct: 21  EKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYT 80

Query: 108 VDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL-YNGEL 166
           VDKV+GP ++Q+L+F++ AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD ++   G++
Sbjct: 81  VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDV 140

Query: 167 SESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           +  AGI PRIL KLF+ L   Q+DYVVKCSF+ELYNE
Sbjct: 141 NGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNE 174

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  522 bits (1344), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 288/635 (45%), Positives = 421/635 (66%), Gaps = 11/635 (1%)

Query: 342 DNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQ 401
           + ++ IYIQ+LQEFHI++AKEGL LLQKGL +RQVASTKMND SSRSHTIFT+TLYK   
Sbjct: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323

Query: 402 GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461
           G  FR+SK+NLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLAD+N HIPFR
Sbjct: 324 GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383

Query: 462 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLGS + KD
Sbjct: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443

Query: 522 ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQ 581
           IL+KNI+ EL+++KSD LSTKSKEGIYMS  HY ++MN+++N+KTE  ES+R IE+LSSQ
Sbjct: 444 ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQ 503

Query: 582 NALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTF 641
           N LL KDK++S +  E QR+++   Q S++ L EKI++++  E  L + + KL+ +    
Sbjct: 504 NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNM 563

Query: 642 KKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDMIQN 701
           +  ++ +E  +  ++S I+++                + +K       F I  +++ +++
Sbjct: 564 QGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKD 623

Query: 702 EVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDI 761
            +  +L T ++ A    +   +  +   P+ F  +  ++ND+  K+  H   + + LS I
Sbjct: 624 SLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQI 683

Query: 762 SEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNL 821
           + E NNLK YL+ + F+NNH++++N H + T   L  S+  L +   ++++ H+E NR L
Sbjct: 684 TAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTL 743

Query: 822 MLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKIT 881
           ++++ K AT EVI +EM  F P +K WE+S + IN CDSL+N F+ + T+ L+  +S + 
Sbjct: 744 LMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHME 803

Query: 882 ASINQMYDNSTRLKTEMS--ADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVE 939
           +++ +    + ++K  +    D     ++ T         I    +++  K+S+ +D +E
Sbjct: 804 STVRESSLIADKIKDNLCHFQDRNDIANMTTN--------INGTVDDIKNKHSVLRDELE 855

Query: 940 NSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTE 974
            ++    AS      ++ S+K  + + R+  G TE
Sbjct: 856 KNVSFIHASSEGFKAIDSSLK-RIMNFRMPEGKTE 889

 Score =  286 bits (731), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 146/159 (91%)

Query: 45  GEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSK 104
           G  E +ELNITVAVRCRGRNE+EIK KSSV+V  PD+ G+NEVSINT+ D+GITA+MNSK
Sbjct: 6   GSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSK 65

Query: 105 TYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 164
           TYTVDKVFGPSA+Q L+F E+A+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+G
Sbjct: 66  TYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDG 125

Query: 165 ELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           ELSE+AGIIPR+LFKLFDTLE+ + DY+VKCSFIELYNE
Sbjct: 126 ELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNE 164

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
            YEL061C
          Length = 939

 Score =  515 bits (1327), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 297/705 (42%), Positives = 436/705 (61%), Gaps = 27/705 (3%)

Query: 344  NNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGT 403
            N  IYIQNL+EFHI NA+EG+ LLQKGLKYRQVASTKMND SSRSHTIFTI LYKEH+G 
Sbjct: 235  NASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGE 294

Query: 404  LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRES 463
            +F++SKMNLVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINS+AD+N HIPFRES
Sbjct: 295  IFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRES 354

Query: 464  KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDIL 523
            KLTRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLGSII KD+ 
Sbjct: 355  KLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVR 414

Query: 524  LKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNA 583
            LK++  EL+++K DL STK K+G+YM+Q HY+ L N+L+++KTE  E  RI++ L  QNA
Sbjct: 415  LKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNA 474

Query: 584  LLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKK 643
            LLLKDK+ SNEVN+LQ + L++  ++++ +Q  +EIQ+ KEQ+LV  ++  +      K 
Sbjct: 475  LLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKT 534

Query: 644  MIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDMIQNEV 703
            +I+ Y  ++  ++S ++ I              + N I   N     ++  N+ +I+++V
Sbjct: 535  VIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDV 594

Query: 704  IKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISE 763
            I ++  +QE ++K + +F +  +K+TP   +    D+       + + A + +NL  I +
Sbjct: 595  ISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQ 654

Query: 764  EYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLML 823
            +Y+ L +Y + + F++NH  ++N H+N+T   +  S   +F  F+  M    E N  L+L
Sbjct: 655  QYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLIL 714

Query: 824  NSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITAS 883
             + K  + ++I  EM  F   K +W+ S   IN CD LNN +  ++   L   + K+ +S
Sbjct: 715  ENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSS 774

Query: 884  INQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLK 943
               +  +  ++K+ + + N     +NT   + DN      +N++  K     D+++ SL 
Sbjct: 775  DEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDN------YNQIISKRDKLHDHLQISLN 828

Query: 944  CAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKKENGKEGPTKPG--LQPLQPT 1001
                S+   + +  SI+ A  +               + K N +E     G     + P 
Sbjct: 829  STQNSLLVFDEICKSIQFAFAN---------------YSKTNLQESALLKGRLFADIDPL 873

Query: 1002 NEIFLNSQQDQQHTTNGHGNYINKDNDNINHKSN---NSGNVTII 1043
            N+  LN Q+       G      ++N++++ K     N+ NVT+I
Sbjct: 874  NDTNLNKQESLTF-DKGDAKLTKENNEDMSSKDENKLNNQNVTLI 917

 Score =  284 bits (726), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 152/165 (92%), Gaps = 2/165 (1%)

Query: 41  DPKEGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDV--GIT 98
           DP++ E + +E+NI VAVRCRGRN+REIK KSSVIV+VPD+ GSNE+SINT+DD+  G+T
Sbjct: 4   DPQKIEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLT 63

Query: 99  AQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGD 158
           AQ+NSKTYTVDKVFGPSANQ+LIF+E+AEPLF DF++GYNCTVLVYGMTSTGKTYTMTGD
Sbjct: 64  AQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGD 123

Query: 159 EKLYNGELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           EKLY G+LS+SAGIIPR+LFKLF+T+E   ++YV+KCSFIELYNE
Sbjct: 124 EKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNE 168

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  512 bits (1319), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 305/640 (47%), Positives = 411/640 (64%), Gaps = 29/640 (4%)

Query: 342 DNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQ 401
           DNNN IYIQNLQEF+I+NA +G+ LLQKGL++R+VASTKMND SSRSHTIFTITLYKEH 
Sbjct: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388

Query: 402 GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461
           G L+R+SKMNLVDLAGSENIN+SGA +QRAKE GSINQSLLTLGRVINSLAD++ HIPFR
Sbjct: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448

Query: 462 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521
           ESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LGS I KD
Sbjct: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508

Query: 522 ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQ 581
           +LLKNITTEL+++KSDL+ST+ K+G+YMSQ+HY++L N+L+++KTE  ESKR  ERL SQ
Sbjct: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568

Query: 582 NALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTF 641
           N  LLKDK+ SNE+NELQRI++ K  + I  L E ++    +E +LV  + +L+    + 
Sbjct: 569 NGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSM 628

Query: 642 KKMIENYECQQIDV---------------KSKIEQIXXXXXXXXXXXXXXHQNKIKTLNS 686
           +  IENY  + +++               K+++ QI                    +   
Sbjct: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSIE 688

Query: 687 GTDF-DIGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINI 745
             D  +   N+D+I+N  +K+L   QEK++  Y   IE  L   P    K   +IN I+ 
Sbjct: 689 AIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDF 748

Query: 746 KIQNHHAAVAQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINS-TSQTLTNSADVLF 804
           +  +    + +NLSD+SEEYNN K+YLN +  QNN+E ++  H+ S  SQ  + S ++L 
Sbjct: 749 QYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNNLLL 808

Query: 805 NTFKDMMNKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNG 864
           N  K  +N+    N  L         ++++ KE E   P K+KW +SI++IN  D +NN 
Sbjct: 809 NINK-QINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNT 867

Query: 865 FQKEVTDGLSYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQF 924
           F  ++ + +    + I  S N + ++   +K     +N   N I + N    N I     
Sbjct: 868 FHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVNNI----- 922

Query: 925 NELARKNSIFQDNVENSLKC-AVASVNNLNHLEDSIKMAV 963
           NEL  KN  +Q+     LKC   +S N++N+L DS K  +
Sbjct: 923 NELKIKNMDYQE----KLKCIGKSSENSINYL-DSTKQVI 957

 Score =  281 bits (718), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 124/154 (80%), Positives = 144/154 (93%)

Query: 50  EELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVD 109
           EELNITVAVRCRGRNERE++ KSSV+V+VPDI GSNEVSINT+D+VGI A MNSKTYTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 110 KVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSES 169
           KVFGPSA+Q L+F E+AEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELS+S
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 170 AGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           AGIIPR+LFKLF++ E+  +DY++KCSF+ELYNE
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNE 162

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  411 bits (1057), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 228/626 (36%), Positives = 385/626 (61%), Gaps = 9/626 (1%)

Query: 348 YIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRL 407
           YIQNL+EFHI+NAKEG+ LL +GLK RQ+AS+K   +SSR+ TIFTI LYKE +G +FR+
Sbjct: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRV 317

Query: 408 SKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTR 467
           SK N VDLAG+E+ ++    NQR K+   INQ +  L +++NSL ++ + IPF++SKLT 
Sbjct: 318 SKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTY 377

Query: 468 LLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNI 527
           L++D+L GN+K+  I T+   K + +E   TLE+ +K +++K  P LG  I+K+ L+K+I
Sbjct: 378 LIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSI 437

Query: 528 TTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLK 587
           + EL++VKSDLLSTKSKEG+YMS EHY  L  +LD HK E  + K++I+ L+ Q+  L K
Sbjct: 438 SNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRK 497

Query: 588 DKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMIEN 647
           DKR   EVNE+QRIKL   +DS++M+   IE Q  +E  L++S  KL+ + +     I  
Sbjct: 498 DKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIAR 557

Query: 648 YECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDMIQNEVIKML 707
           Y  ++  V+++++ +              +  + +      + +I +NL+    E+ ++L
Sbjct: 558 YTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHEEIKQIL 617

Query: 708 GTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEYNN 767
             ++ + +  +   I+   +++P+ F    +D++ +      ++  +A+ LSD+SEE+NN
Sbjct: 618 QISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNN 677

Query: 768 LKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLNSFK 827
           LKQY+NE  F+NNHE+L+  ++N T   +  S+D     F D++  +LE N++++L + K
Sbjct: 678 LKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIK 737

Query: 828 AATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITASINQM 887
           +AT EVI  EM  FIP+K+KWE+SI+LI +    +N F+ +    +   +  +  +   +
Sbjct: 738 SATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESL 797

Query: 888 YDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLKCAVA 947
           +D  + +K++++            N++E+N+++  +F  + +KN I +D +  ++     
Sbjct: 798 FDTLSEMKSKINELQKA------ANIIENNEVVTEEFISIMKKNGILKDTLNINMTSTEE 851

Query: 948 SVNNLNHLEDSIKMAVR---DTRIKG 970
           S+   + L+DSI+   +   DT I G
Sbjct: 852 SIVAFDKLDDSIRNVFKNEIDTNITG 877

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 97/164 (59%), Gaps = 15/164 (9%)

Query: 44  EGEQEEEELNITVAVRCRGR--NEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQM 101
           +G +++ E NI V  R +G+  NE+   ++  +I+  P +     +     DD       
Sbjct: 5   DGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDAV----- 54

Query: 102 NSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDE-K 160
             + + +D +F     Q+ ++ +  +P+F DFI GYNC+ LVYG T +GKTYT++G+E  
Sbjct: 55  -KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDS 113

Query: 161 LYNGELSE-SAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           L + E S  S G+IPR+L +LFD L  N  D+VVKCS++E+YNE
Sbjct: 114 LLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNE 157

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  277 bits (709), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 148/163 (90%), Gaps = 2/163 (1%)

Query: 41  DPKEGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQ 100
           DP +G  +E  LNI VAVRCRGRNEREIK KSSV+V+VPD+ GS+E++INTT+DVGI  Q
Sbjct: 4   DPDKGNGDE--LNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQ 61

Query: 101 MNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEK 160
           MNSKTYTVDKVFGPSANQ+LIF+EVAEPLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+
Sbjct: 62  MNSKTYTVDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDER 121

Query: 161 LYNGELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           LYNGELS+SAGIIPR+LFKLFD +E   +DY++KCSFIELYNE
Sbjct: 122 LYNGELSDSAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNE 164

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  276 bits (706), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 200/627 (31%), Positives = 355/627 (56%), Gaps = 27/627 (4%)

Query: 345 NGIYIQNLQEFHISNAKEGLALLQKGLKYRQVAST----KMNDFSSRSHTIFTITLYKEH 400
           N IYIQNLQE  I+  +EG+A+++KGLK R++AST      N+FS RSH+IF ITLYKE 
Sbjct: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329

Query: 401 Q-GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIP 459
           +   +FR+SK++ V+ AGSE  + + + N      G+ N +L +  ++IN + + + +  
Sbjct: 330 EVNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYAS 383

Query: 460 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIIS 519
           F +SKLT+LLQ++  G T+T  IA I+P K   + TCS L  A+K K IKN+P+ GS+I+
Sbjct: 384 FLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVIT 443

Query: 520 KDILLKNITTELSQVKSDLLSTKSKE-GIYMSQEHYQKLMNELDNHKTEADESKRIIERL 578
           K+ L+K ++ EL + KSDLLS KS + GIYM ++HY +L   L+++K +   SK  I  L
Sbjct: 444 KESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINEL 503

Query: 579 SSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSC 638
           + +   +  +KRT  E+NE QRIKL   +++I+ L   +E Q+ +E  L +   KL +  
Sbjct: 504 TKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSIL 563

Query: 639 DTFKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDIGSNLDM 698
              +K +E Y  ++I +++K++ +              +   IK      + ++ +N+D 
Sbjct: 564 GNMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDN 623

Query: 699 IQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNL 758
           I+ E++K+   +Q K ++         L  +P+ F+++  ++ ++   ++ +H   ++ L
Sbjct: 624 IKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELL 683

Query: 759 SDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESN 818
           SDISEE+NNL  Y+N+N  +++HE+LI+ +IN T   +   +      FK +++ ++E N
Sbjct: 684 SDISEEFNNLNNYINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKN 743

Query: 819 RNLMLNSFKAATDEVINKEMELFIPRKKKWE----ESIDLINQCDSLNNGFQKEV-TDGL 873
              +  S  + T E++  E+  F P KKKWE    E I+  N+  + N     E+    L
Sbjct: 744 TKSLSKSITSLTSEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSEILAKLL 803

Query: 874 SYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSI 933
           S + S     IN M  +S +   E+  +           +   N +I+++F E+  KN  
Sbjct: 804 SESTSTSELFINNM--SSIKKNVEIVEE--------FSEIFNSNDLIKSEFLEIINKNKK 853

Query: 934 FQDNVENSLKCAVASVNNLNHLEDSIK 960
            +D + ++   +  S+++ ++L+++++
Sbjct: 854 LKDLITDNFNSSENSIDSFDNLKEAMQ 880

 Score =  112 bits (281), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 91/157 (57%), Gaps = 13/157 (8%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPD--INGSNEVSINTTDDVGITAQMNSKTYTVDK 110
           NITVAVRCR   + E    S  I+++ D     SNEV I   +  G       K YT+D 
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEV-IVLDESTG-----RKKIYTLDA 62

Query: 111 VFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYNGEL 166
           V+G   +Q+ +FDE   P +  F  GYN +++ YG   +GK YT+ G+    +   N E 
Sbjct: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE- 121

Query: 167 SESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           SE+ G++PR+L +LF  LE N  D+++KCSF+E+YN+
Sbjct: 122 SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYND 158

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  250 bits (639), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 175/482 (36%), Positives = 270/482 (56%), Gaps = 90/482 (18%)

Query: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITL---- 396
           ++NN+ I ++ +QE  I++A EGL LL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 397 --YKEH--QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA 452
              K+H       ++ K+NLVDLAGSENINRSGA N+RA+E G IN+SLLTLGRVIN+L 
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 453 DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 512
           D +NHIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTP 414

Query: 513 QLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESK 572
           Q+   +SKD  LK+   E+ ++K+DL ++++K+GI+++Q+       +LD          
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQD-------QLD---------- 457

Query: 573 RIIERLSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVS 632
                L   N++L+ +          Q +K+   ++ I   +EK   Q     +L S   
Sbjct: 458 -----LYESNSILIDE----------QNLKIHNLREQIKKFKEKYLTQLDINNLLQSEKE 502

Query: 633 KLQTSCDTFKKMIENYECQQIDVKSKIEQIXXXXXXXXXXXXXXHQNKIKTLNSGTDFDI 692
           KL T       +I +++       SKI+QI                              
Sbjct: 503 KLVT-------VIRDFDIDYSHFYSKIQQIHY---------------------------- 527

Query: 693 GSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHA 752
            +NL++I N+V +   ++ E  +K Y       LK +    +++ + +N +   ++N+++
Sbjct: 528 -TNLELI-NQVTQQRDSSHENCQKQYTANQNMQLKIS----QQVLQTLNSLQNSLRNYNS 581

Query: 753 AVAQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLF----NTFK 808
             +Q ++ ++EE  N     + N  + NH+    + +N+T+  L    + L     N+FK
Sbjct: 582 KFSQVINGVTEELTN-----SVNSHKVNHDSTFKSLMNTTANLLMIKMNELVLSISNSFK 636

Query: 809 DM 810
           D 
Sbjct: 637 DF 638

 Score =  128 bits (322), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 98/188 (52%), Gaps = 16/188 (8%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVF 112
           NI V VRCR RN+REI  KSSV+++     G   +  N +     +++   KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 113 GPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 162
           G  ++Q+ +F+  A+    + + GYNCT+  YG T TGKTYTM+GD          +KL 
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 163 NGELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEXXXXXXXXXXXXXXXXXXX 222
              L E AGIIPR+L  LF  L     +Y VK SF+ELYNE                   
Sbjct: 169 ---LGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDT 225

Query: 223 XXXLRIFD 230
              +RIFD
Sbjct: 226 KRQIRIFD 233

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  249 bits (637), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 171/220 (77%), Gaps = 8/220 (3%)

Query: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITL---- 396
           ++NN+ I ++ +QE  I++A EGL LL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 397 --YKEH--QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA 452
              KEH       ++ K+NLVDLAGSENINRSGA N+RA+E G IN+SLLTLGRVIN+L 
Sbjct: 295 QDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 453 DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 512
           D +NHIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSP 414

Query: 513 QLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQE 552
           Q+   +SKD  LK+   E+ ++++DL ++++K+GI+++Q+
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  130 bits (328), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 97/187 (51%), Gaps = 10/187 (5%)

Query: 51  ELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDK 110
           E NI V VRCR RN REI  KSSV+++     G   +  N +     +   + KTY  D+
Sbjct: 50  ESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQ---SYSSSKKTYQFDQ 106

Query: 111 VFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------N 163
           VFG  ++Q+++F   A+    + + GYNCT+  YG T TGKTYTM+GD  +        N
Sbjct: 107 VFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDN 166

Query: 164 GELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEXXXXXXXXXXXXXXXXXXXX 223
             L E AGIIPR+L  LF  L    ++Y VK SF+ELYNE                    
Sbjct: 167 LLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPTANDSK 226

Query: 224 XXLRIFD 230
             +RIFD
Sbjct: 227 KQIRIFD 233

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  248 bits (634), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 171/220 (77%), Gaps = 8/220 (3%)

Query: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITL---- 396
           ++NN+ I ++ +QE  I++A EGL LL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 397 --YKEH--QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA 452
              K+H       ++ K+NLVDLAGSENINRSGA N+RA+E G IN+SLLTLGRVIN+L 
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 453 DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 512
           D +NHIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 414

Query: 513 QLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQE 552
           Q+   +SKD  LK+   E+ ++++DL ++++K+GI+++Q+
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  129 bits (325), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 99/185 (53%), Gaps = 10/185 (5%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVF 112
           NI V VRCR RN+REI+ KSSV+++     G   +  N +     +++   KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 113 GPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------NGE 165
           G  ++Q+ +F+  A+    + + GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 109 GAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 168

Query: 166 LSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEXXXXXXXXXXXXXXXXXXXXXX 225
           L E AGIIPR+L  LF  L    ++Y VK SF+ELYNE                      
Sbjct: 169 LGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQ 228

Query: 226 LRIFD 230
           +RIFD
Sbjct: 229 IRIFD 233

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  248 bits (633), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 171/220 (77%), Gaps = 8/220 (3%)

Query: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITL---- 396
           ++NN+ I ++ +QE  I++A EGL LL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 234 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 293

Query: 397 --YKEH--QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA 452
              K+H       ++ K+NLVDLAGSENINRSGA N+RA+E G IN+SLLTLGRVIN+L 
Sbjct: 294 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 353

Query: 453 DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 512
           D +NHIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 354 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 413

Query: 513 QLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQE 552
           Q+   +SKD  LK+   E+ ++++DL ++++K+GI+++Q+
Sbjct: 414 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 453

 Score =  127 bits (320), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 97/185 (52%), Gaps = 10/185 (5%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVF 112
           NI V VRCR RN+REI  KSSV+++     G   +  N +     +   + KTY  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQ---SYSSSKKTYQFDQVF 107

Query: 113 GPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------NGE 165
           G  ++Q+ +F+  A+    + + GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 167

Query: 166 LSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEXXXXXXXXXXXXXXXXXXXXXX 225
           L E AGIIPR+L  LF  L    ++Y VK +F+ELYNE                      
Sbjct: 168 LGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPAVNDSKRQ 227

Query: 226 LRIFD 230
           +RIFD
Sbjct: 228 IRIFD 232

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  248 bits (633), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 204/319 (63%), Gaps = 40/319 (12%)

Query: 344 NNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGT 403
           ++ I ++ ++E +I +A+EGL LL +G   RQVASTK ND SSRSHT+FTIT        
Sbjct: 249 SHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDP 308

Query: 404 L-----FRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHI 458
           L      +  K+NLVDLAGSENINRSGA N+RA+E G IN+SLLTLGRVIN+L D + HI
Sbjct: 309 LSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHI 368

Query: 459 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSII 518
           P+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+   +
Sbjct: 369 PYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSM 428

Query: 519 SKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERL 578
           +KD  +     E+ +++ +L +T++K+GIY++QE Y                       L
Sbjct: 429 TKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKYD----------------------L 466

Query: 579 SSQNALLLKDK--RTSNEVNELQRIKLSKFQDSINMLQE------KIEIQNG----KEQM 626
              N +L+ ++  R  N   +++R K  K+   +N+ +E      KI++       K+Q+
Sbjct: 467 YESNCILVGEQKARIDNLEEQIKRFK-EKYVQQVNITKETEQKLQKIDLSYQQVWEKKQL 525

Query: 627 LVSSVSKLQTSCDTFKKMI 645
           L SS+  LQ  C++F+  I
Sbjct: 526 LESSLDYLQQKCNSFEHEI 544

 Score =  138 bits (347), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 96/161 (59%), Gaps = 10/161 (6%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVF 112
           NI V VRCR RN+REI  KSSV+++     G + +  N +     +     KTYT D+VF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 113 GPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 165
           G  ++Q+++F+ VA+    + ++GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 166 ---LSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
              LSE AGIIPR+L  LF  L+    DY VK SF+ELYNE
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNE 214

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  247 bits (630), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 126/227 (55%), Positives = 171/227 (75%), Gaps = 5/227 (2%)

Query: 334 SLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFT 393
           SL+T     N   I+++ ++E +I +A+EGL LL  G   R+VA+TK ND SSRSHTIFT
Sbjct: 238 SLKTDRTSPNGYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFT 297

Query: 394 IT--LYKEHQGT---LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVI 448
           IT  + K H  +     ++ K+NLVDLAGSENINRSGA N+RA+E G IN+SLLTLGRVI
Sbjct: 298 ITTNVTKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVI 357

Query: 449 NSLADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 508
           N+L D + HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+I
Sbjct: 358 NALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSI 417

Query: 509 KNKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQ 555
           KN PQ+  +++K+  +     E+ +++ +L ++ SKEGIY++QE ++
Sbjct: 418 KNTPQVNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFE 464

 Score =  147 bits (372), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 114/189 (60%), Gaps = 19/189 (10%)

Query: 24  QNNSRRIPQEQQKQSRRDPK-EGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDIN 82
           ++ S  +P   QK+ R   + EGE    E NI V VRCR RNEREI+ KSSV+++    N
Sbjct: 27  RSRSSTMPTTTQKRVRSSQQSEGE---PEYNIKVYVRCRSRNEREIREKSSVVISTLGNN 83

Query: 83  GSNEVSINTTDDVGITAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVL 142
           G  EV I T    G     ++KTYT D+VFG  ++Q+ +F++VA     + I+GYNCTV 
Sbjct: 84  G-REV-ILTNPGTG-----SNKTYTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVF 136

Query: 143 VYGMTSTGKTYTMTGDEKLYNGE--------LSESAGIIPRILFKLFDTLEMNQEDYVVK 194
            YG T TGKTYTM+GD  +            LSE AGIIPR+L +LF  L    EDY VK
Sbjct: 137 AYGQTGTGKTYTMSGDITMMGSSEDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVK 196

Query: 195 CSFIELYNE 203
            SF+ELYNE
Sbjct: 197 VSFLELYNE 205

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  243 bits (620), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 164/216 (75%), Gaps = 5/216 (2%)

Query: 343 NNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTI----TLYK 398
           N + I ++ ++E +I +A EGL LL +G   R+VASTK+ND SSRSHTIFTI    T   
Sbjct: 336 NGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKVD 395

Query: 399 EHQGTLF-RLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNH 457
              G  F +  K+NLVDLAGSENINRSGA N+RA+E G IN+SLLTLGRVIN+L DR++H
Sbjct: 396 PVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSHH 455

Query: 458 IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSI 517
           IP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+   
Sbjct: 456 IPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQS 515

Query: 518 ISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEH 553
           +SKD  +     E+ +++++L   ++KEGIY++Q+ 
Sbjct: 516 LSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQ 551

 Score =  114 bits (284), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 97/214 (45%), Gaps = 63/214 (29%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEV-------SINTTDDVGITAQM---- 101
           NI V VRCR R +REI  KSSV+++    NG+  +        +  T+  G T       
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 102 ----------------NSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYG 145
                           N +TYT DKVFG  ++Q+ +F+ VA+    + ++GYNCTV  YG
Sbjct: 111 LNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYG 170

Query: 146 MTSTGKTYTMTGDEKLYNG-------ELSESAGIIPRILFKLFDTLEMNQ---------- 188
            T TGKTYTM+GD  +           L E AGIIPR+L  LF  L  N           
Sbjct: 171 QTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTKVNNN 230

Query: 189 -------------------EDYVVKCSFIELYNE 203
                               +Y VK SF+ELYNE
Sbjct: 231 KNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNE 264

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  239 bits (609), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/218 (54%), Positives = 166/218 (76%), Gaps = 5/218 (2%)

Query: 343 NNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTIT--LYKEH 400
           + + I ++ ++E +I +A+EGL LL +G   R+VA+T+ ND SSRSHTIFTIT  + K H
Sbjct: 251 SGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTKIH 310

Query: 401 QGT---LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNH 457
             +     ++ K+NLVDLAGSENINRSGA N+RA+E G IN+SLLTLGRVIN+L D + H
Sbjct: 311 PISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQH 370

Query: 458 IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSI 517
           IP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STLEYA++AK+IKN PQ+  +
Sbjct: 371 IPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQINQL 430

Query: 518 ISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQ 555
           ++K+  +     E+ +++ +L +  +KEGIY+++E Y+
Sbjct: 431 MAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYE 468

 Score =  152 bits (385), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 109/185 (58%), Gaps = 16/185 (8%)

Query: 27  SRRIPQEQQKQSRRDPKEGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNE 86
           S  +P   QK+ R +   G  EE+  NI V VRCR RN REIK KSSV+V+     G   
Sbjct: 31  SSSLPTASQKRVRSNMMVG-SEEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREI 89

Query: 87  VSINTTDDVGITAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGM 146
           +  N +         N+KTYT D+VFG  ++Q+ +FD+VA     + ++GYNCTV  YG 
Sbjct: 90  ILSNQSTG-------NNKTYTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQ 142

Query: 147 TSTGKTYTMTGDEKLYNGE--------LSESAGIIPRILFKLFDTLEMNQEDYVVKCSFI 198
           T TGKTYTM+GD  +            LSE AGIIPR+L +LF  L+   EDY VK SF+
Sbjct: 143 TGTGKTYTMSGDISVVGASLEDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFL 202

Query: 199 ELYNE 203
           ELYNE
Sbjct: 203 ELYNE 207

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  237 bits (605), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 161/214 (75%), Gaps = 5/214 (2%)

Query: 347 IYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTL-- 404
           I ++ ++EF+I +A EGL LL  G   R+VA+TK ND SSRSHT+FTIT        +  
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 405 ---FRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461
               ++ K+NLVDLAGSENINRSGA N+RA+E G IN+SLLTLGRVIN+L D + HIP+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 462 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521
           ESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   +SK+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 522 ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQ 555
             L     E+ +++ +L +++ KEG+Y++++ +Q
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ 461

 Score =  143 bits (360), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 80/206 (38%), Positives = 112/206 (54%), Gaps = 20/206 (9%)

Query: 42  PKEGEQEEEEL--NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITA 99
           P+E EQ+E  +  N+ V VRCR RNE+EI+ KSSV+++     G   +  N    +    
Sbjct: 28  PRESEQQEGRVSSNMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLS--- 84

Query: 100 QMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDE 159
             + +TYT D+VFG  ++Q+ +FDEVA+    + ++GYNCTV  YG T TGKTYTM+GD 
Sbjct: 85  -HSKRTYTFDQVFGAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDI 143

Query: 160 KLYNG-------ELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEXXXXXXXXX 212
            +           L E +GIIPR+L  LF  L     +Y VK SF+ELYNE         
Sbjct: 144 SILGDLDSQDKILLGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNE-------KL 196

Query: 213 XXXXXXXXXXXXXLRIFDSSTASNVN 238
                        +RIFD+++  N N
Sbjct: 197 KDLLAESEQEEENIRIFDNNSGFNCN 222

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  233 bits (595), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 199/305 (65%), Gaps = 16/305 (5%)

Query: 347 IYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTL-- 404
           I ++ ++E +I +A EGL LL KG   R+VA+TK ND SSRSHTIFTI  +      +  
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 405 ---FRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461
               ++ K+NLVDLAGSENINRSGA N RA+E G IN+SLLTLGRVIN+L + ++HIP+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 462 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521
            SKLTRLLQDSLGG TKT +IATISPA+++ +ET STLEYA++AK+IKN PQ+   +SKD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 522 ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQ 581
             +     E+ +++ +L +++ +EG+Y++QE Y    +  +++    +E K +I+ +  Q
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY----DLYESNSLLVEEQKVVIQNMGEQ 503

Query: 582 NALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTF 641
              + + K    E  +L +    +FQ+S  +  + + IQ   ++ ++ +  K  T+C   
Sbjct: 504 ---IKRFKEKYVEQTKLSKEAHRQFQESQKVC-DTLRIQ---KKFMLETFEKYHTTCKEH 556

Query: 642 KKMIE 646
              I+
Sbjct: 557 AAQID 561

 Score =  134 bits (338), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 95/159 (59%), Gaps = 13/159 (8%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVF 112
           NI V VRCR RN+REI  KSSV+V+     G + +  N +  +        KTY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLS----HPKKTYMFDEVF 99

Query: 113 GPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 165
           G  ++Q+ IF EVA+    + ++GYNCTV  YG T TGKTYTM+GD  ++ G+       
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIW-GDLDSQDKI 158

Query: 166 -LSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
            L E AGIIPR+L  LF  L     ++ VK SF+ELYNE
Sbjct: 159 LLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNE 197

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  233 bits (594), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/221 (55%), Positives = 162/221 (73%), Gaps = 8/221 (3%)

Query: 341 DDNNNG---IYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTI--- 394
           D+NNN    I ++ ++E +I +A EGL LL  G   R+VASTK ND SSRSHT+FTI   
Sbjct: 280 DNNNNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATN 339

Query: 395 -TLYKEHQGTLF-RLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA 452
            T      G  + +  K+NLVDLAGSENINRSGA N+RA+E G IN+SLLTLGRVIN+L 
Sbjct: 340 ITKIDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 399

Query: 453 DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 512
           D + HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AK+IKN P
Sbjct: 400 DHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTP 459

Query: 513 QLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEH 553
           Q+   +SKD  +    +E+ +++ +L +++ K+GI ++Q+ 
Sbjct: 460 QINQSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQ 500

 Score =  134 bits (336), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 72/158 (45%), Positives = 97/158 (61%), Gaps = 12/158 (7%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVF 112
           NI V VRCR R+EREIK KSSV+++     G+  +  N +  +        K+Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 113 GPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEK-LYNGE------ 165
           G  ++Q+ +F++ A+    + + GYNCTV  YG T TGKTYTM+GD   L N E      
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 166 LSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
           L E AGIIPR+L  LF  L + + DY VK SF+ELYNE
Sbjct: 224 LGEHAGIIPRVLVNLFKMLAL-ENDYSVKISFLELYNE 260

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  229 bits (584), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 116/216 (53%), Positives = 159/216 (73%), Gaps = 5/216 (2%)

Query: 344 NNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTIT-----LYK 398
           ++ I ++ ++E +I++A +GL LL  G   R+VA+TK ND SSRSHT+FTIT     L  
Sbjct: 239 SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 399 EHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHI 458
                  +  K+NLVDLAGSENINRSGA N+RA+E G IN+SLLTLGRVIN+L D   HI
Sbjct: 299 VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 459 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSII 518
           P+RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   +
Sbjct: 359 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 519 SKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHY 554
           SKD  +     E+ +++ +L +++ K+GI ++Q+ +
Sbjct: 419 SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQF 454

 Score =  135 bits (341), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 109/191 (57%), Gaps = 19/191 (9%)

Query: 54  ITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVFG 113
           I V VRCR RNEREI+ KSSV+++      S ++ ++        A+   +TYT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPLLPLAYAK---RTYTFDRVFG 117

Query: 114 PSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE-------- 165
             ++Q+ +F++ A+    + ++GYNCTV  YG T TGKTYTM+GD  +  G+        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 166 LSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEXXXXXXXXXXXXXXXXXXXXXX 225
           L E AGIIPR+L +LF  L+ N E Y VK SF+ELYNE                      
Sbjct: 178 LGEHAGIIPRVLVELFRWLDGN-EGYSVKVSFLELYNE-------RLKDLLASEQSEEEN 229

Query: 226 LRIFDSSTASN 236
           +RIFD+ +AS+
Sbjct: 230 IRIFDNVSASS 240

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  227 bits (579), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 167/227 (73%), Gaps = 5/227 (2%)

Query: 333 SSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIF 392
           S ++   +++  + I ++ ++E +I +A EGL LL +G   R+VASTK ND SSRSHTIF
Sbjct: 240 SKIQKSSRNNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIF 299

Query: 393 TITLYKEHQGTL-----FRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRV 447
           TIT        +      ++ K+NLVDLAGSENI+RSGA N RA+E G IN+SLLTLGRV
Sbjct: 300 TITTNITKIDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRV 359

Query: 448 INSLADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 507
           IN+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+
Sbjct: 360 INALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKS 419

Query: 508 IKNKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHY 554
           IKN PQ+   +SKD+ +     E+ +++ +L +++ K+G+Y++QE +
Sbjct: 420 IKNTPQINQSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

 Score =  131 bits (330), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/164 (43%), Positives = 96/164 (58%), Gaps = 13/164 (7%)

Query: 49  EEEL--NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTY 106
           E EL  NI V VRCR RN+REI+ KSSV+++     G  EV ++   D         KTY
Sbjct: 53  ESELGSNIQVYVRCRSRNQREIEEKSSVVISTMGAQG-KEVVLS---DPSSVLSHTKKTY 108

Query: 107 TVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG-- 164
             D+VFG  ++Q+++F+  A+    + ++GYNCT+  YG T TGKTYTM+GD  +     
Sbjct: 109 IFDQVFGVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLE 168

Query: 165 -----ELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
                 L E AGIIPR+L  LF  L     +Y VK SF+ELYNE
Sbjct: 169 SQDKILLGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNE 212

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  179 bits (455), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 134/328 (40%), Positives = 187/328 (57%), Gaps = 53/328 (16%)

Query: 327 PPKLPTSSLETPP----------QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQV 376
           PP   +SS   P           +D +++ I ++ +QE  I NA EGL LL KG   R+V
Sbjct: 178 PPNSGSSSANDPSVSSNIKIFDNKDSSDSSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKV 237

Query: 377 ASTKMNDFSSRSHTIFTIT-----LYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRA 431
            STK+ND SSRSHTIFTIT     L  +      ++ K+NLVDLAGSENI +SG   +R+
Sbjct: 238 KSTKLNDLSSRSHTIFTITTNIIKLDNQTNKEYIKIGKLNLVDLAGSENITKSGL--KRS 295

Query: 432 KETGSINQSLLTLGRVINSLADRNNH------------------------IPFRESKLTR 467
           +ETG IN+SLLTLGRVIN+L+D+ N+                        IP+RESKLTR
Sbjct: 296 QETGLINKSLLTLGRVINALSDKTNNTHGSNNDNNNSSSSSSISNSHHSHIPYRESKLTR 355

Query: 468 LLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNI 527
           LLQDSLGG TKT +IATISPAK   +ET STLEYA++A +IKN P++    +    + + 
Sbjct: 356 LLQDSLGGMTKTCIIATISPAKTCLDETISTLEYATRAMSIKNNPKINKSQNPSNFINDY 415

Query: 528 TTELSQVKSDL-LSTKSKEGIYMSQE---HYQ--KLMNELDNHKTE------ADESKRII 575
             ++ ++K +L  ST    GI++  E   +Y+  +++ E  N K        A   K+ +
Sbjct: 416 INQIDRLKLELQTSTDKIGGIFIPLEKLNYYKSNEILIEEQNAKINNMTNQIAKFKKKFV 475

Query: 576 ERLSSQNALLLKDKRTSNEVNELQRIKL 603
           E++     L    K++  E N+L  IKL
Sbjct: 476 EQIQINKQLNTDMKKSQWEKNQLLTIKL 503

 Score =  128 bits (322), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 96/166 (57%), Gaps = 24/166 (14%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVF 112
           NI V VRCR RN++EI  KSSV+V+    NG+  +  N+T         N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 113 GPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------NGE 165
           G  ++Q+ IF+ VA     + I GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNIL 119

Query: 166 LSESAGIIPRILFKLFDTLE---MNQED-----YVVKCSFIELYNE 203
           L E AGIIPR+L +LF +LE    NQ++     Y VK SF+ELYNE
Sbjct: 120 LGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNE 165

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  141 bits (356), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 116/176 (65%), Gaps = 10/176 (5%)

Query: 348 YIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLF-- 405
           +++ L EF +   +E L  +++G + R V  T MN+ SSRSH IFTI++ K+ + TL   
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISI-KQSETTLAGD 256

Query: 406 ---RLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNH--IPF 460
              R S + LVDLAGSE ++ +GA   R KE  +IN+SL TLGRV++ LA +N    IP+
Sbjct: 257 LTERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPY 316

Query: 461 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGS 516
           R+S LT +L+++LGGN+KT +IA +SP     EET STL YA+ AK +KN  ++ S
Sbjct: 317 RDSALTWVLKENLGGNSKTVMIACVSPCDY--EETISTLRYATTAKEVKNTARVNS 370

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 84/172 (48%), Gaps = 22/172 (12%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVF 112
           NI VAVR R    RE        VT P  +   +  I+T+  +        K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSP-TSFVIQQHISTSSLLATEEFTQGKIFTFDHCF 62

Query: 113 GPSAN----QQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDE---KLYNGE 165
             S N    Q++I+D +     L  + GYN  +L YG T +GK++TM G E     +N +
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 166 ------LSESA-GIIPRILFKLFDTLEM--NQED-----YVVKCSFIELYNE 203
                 + +SA GIIPR+   LFD   M  ++ED     + + CS++E+YNE
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNE 174

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  140 bits (352), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 114/173 (65%), Gaps = 8/173 (4%)

Query: 348 YIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQG----T 403
           +++ LQEF +++  E L  L++G + + V +T +N+ SSRSHTIFTI + ++        
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 404 LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNH--IPFR 461
           L R S + L+DLAGSE  N SGA  +R KE  +IN+SL TLGRVI  LA +     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 462 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 514
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 53/94 (56%), Gaps = 15/94 (15%)

Query: 117 NQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGIIPRI 176
           +Q  +++++A    L  + GYN  +  YG T +GK++TMTG  +L         GI+PR+
Sbjct: 62  DQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRM 113

Query: 177 LFKLFDTLEMNQED-------YVVKCSFIELYNE 203
             +LF+  EM +         + ++CS++E+YNE
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNE 147

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  137 bits (345), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 120/188 (63%), Gaps = 7/188 (3%)

Query: 336 ETPPQ--DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFT 393
           +T P+  + N+   ++Q++  F ++  +E L  L  G   R VAST+MN  SSRSH IFT
Sbjct: 135 DTSPRVRETNDKKTFVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFT 194

Query: 394 ITLYKEHQGTLFRLSKMNLVDLAGSENINRSGAIN--QRAKETGSINQSLLTLGRVINSL 451
           +++ ++      R S + LVDLAGSE  N +  I+  +R KE  +IN+SL TLGR I+ L
Sbjct: 195 LSIKQQEPDGSIRESDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQL 254

Query: 452 ADRNNH-IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 510
           A  + H IP+R+S LT +L+++LGGN+KT +IA ISP  +  EE+ STL YA+ AK IK 
Sbjct: 255 AKNSKHLIPYRDSLLTWVLKENLGGNSKTCMIACISPIDL--EESLSTLRYATTAKEIKL 312

Query: 511 KPQLGSII 518
           +  +  I+
Sbjct: 313 RATMNEIV 320

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 54/101 (53%), Gaps = 9/101 (8%)

Query: 104 KTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 163
           +++  D +F  S++Q  I  E+     L  ++GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 164 GELSESAGIIPRILFKLFDTLEMNQEDY-VVKCSFIELYNE 203
              + + GIIP +   LFD LE+++     V  ++ E+YNE
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNE 127

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  137 bits (344), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 115/173 (66%), Gaps = 8/173 (4%)

Query: 348 YIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLF-- 405
           +++ L+EF +S+ ++ L  +++G + R + ST +N++SSRSHTIFTI++ ++ +  L   
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 406 --RLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNH--IPFR 461
             R S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA R     IP+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 462 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 514
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDY--EETLSTLRYATLARNVKTCAQL 339

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 82/168 (48%), Gaps = 41/168 (24%)

Query: 53  NITVAVRCRGRNEREI------KLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTY 106
           NI VAVR R   ERE+      +++   ++ V D N  NE                ++++
Sbjct: 4   NIKVAVRLRRPLEREVDESIIARVEDGNVIQVKDRNQKNE----------------TRSF 47

Query: 107 TVDKVFGPS----ANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 162
             D+ F  S    A+Q  ++++++    L  + GY+  V  YG T +GK++TMTG     
Sbjct: 48  HFDQCFAYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS---- 103

Query: 163 NGELSESAGIIPRILFKLFDTLEMNQED-------YVVKCSFIELYNE 203
                ES GI+ R+  +LF+  E+ +         + ++CS++E+YNE
Sbjct: 104 ----PESPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNE 147

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  130 bits (326), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 115/199 (57%), Gaps = 20/199 (10%)

Query: 330 LPTSSLETPP--------QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKM 381
           L   SLE P          D  ++GIY++ L   ++++ +E L  +++G   R V+ST M
Sbjct: 172 LLAQSLEKPADKRISLSLHDTKDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSM 231

Query: 382 NDFSSRSHTIFTITLYKEHQGTL---FRLSKMNLVDLAGSENINRSGAINQRAKETGSIN 438
           N  SSRSH+I  I L  E +  L    + S + LVDLAGSE + ++ A     +E   IN
Sbjct: 232 NLESSRSHSIVRINL--EKRNALEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKIN 289

Query: 439 QSLLTLGRVINSLAD-------RNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 491
            SL  LG VIN+L          + HIP+R+SKLTRLLQDSLGGN+KT LI   S ++  
Sbjct: 290 SSLSALGNVINALTQVESKSKRTSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFN 349

Query: 492 SEETCSTLEYASKAKNIKN 510
            +ET STL + S+AK IKN
Sbjct: 350 EQETLSTLRFGSRAKKIKN 368

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 63/109 (57%), Gaps = 11/109 (10%)

Query: 98  TAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTG 157
           + Q N + +T D+VF   + Q+ +++ VA  +   F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 158 DEKLYNGELSESAGIIPRILFKLFDTLEM-NQED--YVVKCSFIELYNE 203
            +        E+ G+IPRI   +F  +E  + ED  + V  SF+E+Y E
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLE 167

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 113/198 (57%), Gaps = 26/198 (13%)

Query: 334 SLETPPQ-----DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRS 388
           S +TPPQ     +D+N  I + NL      + ++ L L+ +G   R  + T+ N  SSRS
Sbjct: 241 SPDTPPQKLVIREDSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRS 300

Query: 389 HTIFTITL--------YKEHQ--GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSIN 438
           H +  I +         KEHQ  GTL      +++DLAGSE    +    +R  E  +IN
Sbjct: 301 HAVLQIHIMQRNKLVDLKEHQTFGTL------SIIDLAGSERAAATKNRGRRLHEGANIN 354

Query: 439 QSLLTLGRVINSLAD-----RNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSE 493
           +SLL LG  IN+L       RN H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +
Sbjct: 355 RSLLALGNCINALCSNDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYD 414

Query: 494 ETCSTLEYASKAKNIKNK 511
           ET +TL+YA++AK IK K
Sbjct: 415 ETLNTLKYANRAKEIKTK 432

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 10/108 (9%)

Query: 98  TAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTG 157
           T   +   +  DK+F    +Q+ ++      L    + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 158 DEKLYNGELSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
                     E+ GII R + +LF  ++     +D+ +  SF+E+YNE
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNE 234

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  125 bits (313), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 114/191 (59%), Gaps = 10/191 (5%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
            + N  G+Y++      +S+  E L  +  G   R   ST MN  SSRSH I  I L K 
Sbjct: 182 HESNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKR 241

Query: 400 H--QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA--DRN 455
              +G + + S + LVDLAGSE + ++ A+    +E   IN SL +LG VIN+L   ++ 
Sbjct: 242 DNLEGNIQK-SDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKR 300

Query: 456 NHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 515
            HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK+IKNK    
Sbjct: 301 THIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNK---- 356

Query: 516 SIISK-DILLK 525
           +I++K D+ LK
Sbjct: 357 AIVNKSDLFLK 367

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 12/105 (11%)

Query: 103 SKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 162
           ++ +  D VFG  A Q+ +FD VAE +   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGPPG-- 114

Query: 163 NGELSESAGIIPRILFKLFDTLEM--NQED--YVVKCSFIELYNE 203
                   G+IPRI  ++F+ + +  N  D  YVV  SF+E+Y E
Sbjct: 115 ------HRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLE 153

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 115/186 (61%), Gaps = 11/186 (5%)

Query: 346 GIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEH--QGT 403
           G+Y+Q+     +S+  E L  +  G   R  +ST MN  SSRSH I  I L K    +G+
Sbjct: 215 GVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKRDNLEGS 274

Query: 404 LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRN---NHIPF 460
           + + S + LVDLAGSE ++++ A+    +E   IN SL +LG VIN+L  ++    HIP+
Sbjct: 275 IQK-SDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIPY 333

Query: 461 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISK 520
           R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK I+NK    +I+++
Sbjct: 334 RDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK----AIVNR 389

Query: 521 -DILLK 525
            D+ LK
Sbjct: 390 SDLFLK 395

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 86/161 (53%), Gaps = 24/161 (14%)

Query: 53  NITVAVRCRGRNEREIKLKSSVI------VTVPDINGSNEVSINTTDDVGITAQMNSKTY 106
           N+ V VR +  +  E +   +V+      V  P+    N+ S  +T+  G+  +  S+++
Sbjct: 34  NVKVMVRLKPIDAPEKQYNVAVVALDESTVEFPN----NDTSPGSTN--GVQGESPSRSF 87

Query: 107 TVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 166
             D VFG ++ Q  ++D VAE +   F  GYN T+L YG T +GK+YTM G         
Sbjct: 88  HFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP-------- 139

Query: 167 SESAGIIPRILFKLFDTLEMNQE----DYVVKCSFIELYNE 203
            ++ G+IPRI  ++F+ + + +     +YVV  SF+E+Y E
Sbjct: 140 IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLE 180

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  119 bits (297), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 115/187 (61%), Gaps = 11/187 (5%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           ++ +++  +++ L+E  + N +E ++ + KG + R V ST MN  SSRSH IF I++ ++
Sbjct: 171 RERHDHSTFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQK 230

Query: 400 --HQ--GTLFRL-SKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLAD- 453
             H+  GT+    S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+ 
Sbjct: 231 ETHKKTGTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEG 290

Query: 454 ---RNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 510
              R+  IP+RES LT +L+++LGGN+ T L+A +SP      E+ STL YAS  K +K 
Sbjct: 291 DRQRSQMIPYRESALTWILKENLGGNSNTCLVACVSPENYY--ESLSTLRYASLTKKVKT 348

Query: 511 KPQLGSI 517
              + S+
Sbjct: 349 NATINSM 355

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 59/114 (51%), Gaps = 21/114 (18%)

Query: 103 SKTYTVDKVFGPS----ANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGD 158
           +K +  D  FG +     +Q +I++ +     L  ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 159 EKLYNGELSESAGIIPRILFKLFDTLEMNQE---------DYVVKCSFIELYNE 203
           +         + GI+PR   +LF+   M  +         D+ VKCSF E+YNE
Sbjct: 109 KG--------NEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNE 154

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  119 bits (297), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 109/172 (63%), Gaps = 7/172 (4%)

Query: 348 YIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYK----EHQGT 403
           YI+ L +  +++ +E L  +++G   R VA T +N+ SSRSH I TI + +        T
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 404 LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA-DRNNHIPFRE 462
           + R+S + LVDLAGSE    S   ++R KE  +IN+SL+TL RV+  L+ ++   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 463 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 514
           S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPCDY--EESISTLRYASTAKHVRTEAHL 342

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 82/160 (51%), Gaps = 23/160 (14%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVF 112
           NI VA+R R +  RE   + SVI        SNE+++   +   +   +   T+  D+VF
Sbjct: 4   NIKVAIRIRDKISRETS-RPSVI----KRKTSNEITLQKDNTANVITTVE-HTFYFDQVF 57

Query: 113 GPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGI 172
             S+NQ+ I+ E+A    L  ++GY+  V+ YG T  GKTYTM G E        +  GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTE--------QEPGI 109

Query: 173 IPRILFKLFDTLEMNQED---------YVVKCSFIELYNE 203
           IP +  +LF  ++M Q++         + V  S+ ++YNE
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNE 149

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  119 bits (299), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/148 (47%), Positives = 96/148 (64%), Gaps = 4/148 (2%)

Query: 366 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSK-MNLVDLAGSENINRS 424
           +L++  K R  AST  N+ SSRSH+IF I L  +++GT  +    +NLVDLAGSE +N S
Sbjct: 540 VLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSS 599

Query: 425 GAINQRAKETGSINQSLLTLGRVINSL---ADRNNHIPFRESKLTRLLQDSLGGNTKTAL 481
             + +R +ET SIN+SL  LG VI++L     +  HIPFR SKLT LLQ SL G++KT +
Sbjct: 600 MVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLM 659

Query: 482 IATISPAKVTSEETCSTLEYASKAKNIK 509
              ISPA +   ET ++L +ASK  N K
Sbjct: 660 FVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 69/167 (41%), Gaps = 34/167 (20%)

Query: 48  EEEELNITVAVRCRGR--------NEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITA 99
           E +EL   + V CR R        N   IK++        D NG   ++IN  +   I  
Sbjct: 343 ELQELRGNIRVYCRIRPPLPHEDDNIEHIKVQP-----FDDDNGDQGMTINRGNSQVIP- 396

Query: 100 QMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDE 159
                 +  DK+F        IF EV + L    + GYN  +  YG T +GKTYTM    
Sbjct: 397 ------FKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---- 445

Query: 160 KLYNGELSESAGIIPRI---LFKLFDTLEMNQEDYVVKCSFIELYNE 203
                 L+   GI+P     +F   D L      Y V C FIE+YNE
Sbjct: 446 ------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNE 486

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  120 bits (300), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 113/193 (58%), Gaps = 11/193 (5%)

Query: 328 PKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
           P+ PT  L    ++D++  I + NL    +S  ++ + L+ KG   R  ++T  N+ SSR
Sbjct: 224 PETPTKKLVL--REDSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSR 281

Query: 388 SHTIFTITLYKEHQGTLF----RLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLT 443
           SH +  + + + ++        + + ++L+DLAGSE  + +    +R  E  +IN+SLL 
Sbjct: 282 SHAVLQVHITQRNRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLA 341

Query: 444 LGRVINSLADRNN-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCST 498
           LG  IN+L          H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +T
Sbjct: 342 LGNCINALCVSGRKRGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNT 401

Query: 499 LEYASKAKNIKNK 511
           L+YA++AK IK K
Sbjct: 402 LKYATRAKEIKTK 414

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D+VF   ++Q  +++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 177

Query: 166 LSESAGIIPRILFKLFDTLEMNQED--YVVKCSFIELYNE 203
             E+ GII   + +LF  +E  Q+   + +  S++E+YNE
Sbjct: 178 -PENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNE 216

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  120 bits (300), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 113/192 (58%), Gaps = 10/192 (5%)

Query: 328 PKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
           P+ P+  L    ++D  N I + NL   H +  ++ + L+ +G   R  + T+ N+ SSR
Sbjct: 252 PETPSKRLVI--REDTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSR 309

Query: 388 SHTIFTITLYKEHQ----GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLT 443
           SH++  I + + ++     +    + ++++DLAGSE  + +     R  E  +IN+SLL 
Sbjct: 310 SHSVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLA 369

Query: 444 LGRVINSLA----DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 499
           LG  IN+L      R  HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL
Sbjct: 370 LGNCINALCLNDGSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTL 429

Query: 500 EYASKAKNIKNK 511
           +YA++AK IK K
Sbjct: 430 KYANRAKEIKTK 441

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 54/100 (54%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F  +++Q  ++ E   PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
                GII   + +LF+ +    +++++ +  S++E+YNE
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNE 244

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  119 bits (299), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 107/180 (59%), Gaps = 9/180 (5%)

Query: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEH 400
           +D+N  I + NL  ++    ++ + L+ KG   R  ++T  N+ SSRSH +  I + + +
Sbjct: 238 EDSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHN 297

Query: 401 QGTLFR----LSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA---- 452
           +    +     + ++++DLAGSE    +     R  E  +IN+SLL LG  IN+L     
Sbjct: 298 RTADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDG 357

Query: 453 -DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 511
             R+ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 358 TRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 55/100 (55%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D++F   + Q+ +++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
             E+ GII + + +LF+ +E   + + + +  SF+E+YNE
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNE 219

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 110/191 (57%), Gaps = 15/191 (7%)

Query: 336 ETPPQ-----DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHT 390
           ETP Q     +D +N I + NL +   +  +E + L+ +G   R  + T+ N+ SSRSH 
Sbjct: 256 ETPSQKLIIREDTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHA 315

Query: 391 IFTITLYKEHQGTLFR----LSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGR 446
           +  I + ++++    +       ++++DLAGSE    +     R  E  +IN+SLL LG 
Sbjct: 316 VLQIHIVQKNRTPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGN 375

Query: 447 VINSLADRNN------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 500
            IN+L    N      H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+
Sbjct: 376 CINALCINGNDERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLK 435

Query: 501 YASKAKNIKNK 511
           YA++AK IK K
Sbjct: 436 YANRAKEIKTK 446

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F   A Q+ ++      L    + G+N TV  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
             E+ GI+ + + +LF  +E   + + + +  SF+E+YNE
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNE 247

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 112/192 (58%), Gaps = 10/192 (5%)

Query: 328 PKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
           P+ P+  L    ++D  N I + NL   H +  ++ + L+ +G   R  + T+ N+ SSR
Sbjct: 252 PETPSKRLVI--REDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSR 309

Query: 388 SHTIFTITLYKEHQ----GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLT 443
           SH +  I + + ++     +    + ++++DLAGSE    +     R  E  +IN+SLL 
Sbjct: 310 SHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLA 369

Query: 444 LGRVINSLA----DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 499
           LG  IN+L      R+ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL
Sbjct: 370 LGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTL 429

Query: 500 EYASKAKNIKNK 511
           +YA++AK IK K
Sbjct: 430 KYANRAKEIKTK 441

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 54/100 (54%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F  +++Q  ++ E   PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
                GII   + +LF+ +    +++D+ +  S++E+YNE
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNE 244

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 111/192 (57%), Gaps = 10/192 (5%)

Query: 328 PKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
           P+ P+  L    ++D  N I + NL   H +  ++ + L+ +G   R  + T+ N+ SSR
Sbjct: 252 PETPSKRLII--REDTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSR 309

Query: 388 SHTIFTITLYKEHQ----GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLT 443
           SH +  I + + ++     +    + ++++DLAGSE    +     R  E  +IN+SLL 
Sbjct: 310 SHAVLQIHIMQTNKLVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLA 369

Query: 444 LGRVINSLA----DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 499
           LG  IN+L      R  HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL
Sbjct: 370 LGNCINALCLNDGSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTL 429

Query: 500 EYASKAKNIKNK 511
           +YA++AK IK K
Sbjct: 430 KYANRAKEIKTK 441

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 55/100 (55%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F  +++Q  ++ E   PL    + GYN TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
                G+I   + +LF+ ++   +++++ +  S++E+YNE
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNE 244

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/183 (40%), Positives = 101/183 (55%), Gaps = 13/183 (7%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYK- 398
            DD +   Y+ N++ F I N  + + L+ K    R  +ST +N  SSRSH IF I L   
Sbjct: 555 HDDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGY 614

Query: 399 EHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSL------- 451
            H+     +SK+NLVDLAGSE IN S     R KET SIN+SL  LG VI++L       
Sbjct: 615 NHKTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNH 674

Query: 452 -----ADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 506
                  +  HIPFR SKLT LL+ SL G++KT +   +S  +    ET ++L +A+K  
Sbjct: 675 LNSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVN 734

Query: 507 NIK 509
           N K
Sbjct: 735 NTK 737

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 16/107 (14%)

Query: 102 NSKTYTV--DKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDE 159
           N+ TY+   D VF        +F+E+ E L    + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 160 KLYNGELSESAGIIP---RILFKLFDTLEMNQEDYVVKCSFIELYNE 203
                 L+ + G+IP   + +F   D+L+ N  +Y V C FIELYNE
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNE 533

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 107/182 (58%), Gaps = 10/182 (5%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           ++D  N I + NL   +    +E + L+ KG   R  + T+ N+ SSRSH +  I + + 
Sbjct: 260 REDGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQT 319

Query: 400 HQGTLFR----LSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA--- 452
           ++          + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+L    
Sbjct: 320 NRTADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTD 379

Query: 453 ---DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 509
              +R+ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK
Sbjct: 380 GGTNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

Query: 510 NK 511
            K
Sbjct: 440 TK 441

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F   A+Q+ ++      L    + G+N TV  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
             E  GII R++ +LF+ +E   + + + +  S++E+YNE
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNE 242

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 112/192 (58%), Gaps = 10/192 (5%)

Query: 328 PKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
           P+ P+  L    ++D  + I + NL   H +  ++ + L+ +G   R  + T+ N+ SSR
Sbjct: 252 PETPSKRLVI--REDTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSR 309

Query: 388 SHTIFTITLYKEHQ----GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLT 443
           SH +  I + + ++     +    + ++++DLAGSE    +     R  E  +IN+SLL 
Sbjct: 310 SHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLA 369

Query: 444 LGRVINSLA----DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 499
           LG  IN+L      R+ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL
Sbjct: 370 LGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTL 429

Query: 500 EYASKAKNIKNK 511
           +YA++AK IK K
Sbjct: 430 KYANRAKEIKTK 441

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 54/100 (54%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F  +++Q  ++ E   PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
                GII   + +LF+ +    +++++ +  S++E+YNE
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNE 244

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 105/181 (58%), Gaps = 9/181 (4%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           ++D+ N I + NL        ++ + L+  G   R  ++T  N+ SSRSH +  I + + 
Sbjct: 238 REDSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQS 297

Query: 400 HQGTLFR----LSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA--- 452
            +          +K++++DLAGSE    +    +R +E  +IN+SLL LG  IN+L    
Sbjct: 298 SRTAEITSDHTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISD 357

Query: 453 --DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 510
              R  H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 358 GTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 417

Query: 511 K 511
           K
Sbjct: 418 K 418

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F  +A Q+ ++      L    + G+N TV  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
             E  G+I   + +LF  +E   +   + +  S++E+YNE
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNE 220

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  117 bits (292), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 110/193 (56%), Gaps = 11/193 (5%)

Query: 328 PKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
           P  P+  L    ++DN + I + NL        ++ + L+ KG   R  ++T  N+ SSR
Sbjct: 245 PDTPSKKLVI--REDNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSR 302

Query: 388 SHTIFTITLYKEHQGTLFR----LSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLT 443
           SH +  I + + ++          + ++++DLAGSE    +    +R  E  +IN+SLL 
Sbjct: 303 SHAVLQIHISQTNRTVDLTSSHVFATLSIIDLAGSERAASTKNRGERLYEGANINKSLLA 362

Query: 444 LGRVINSLA-----DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCST 498
           LG  IN+L       R+ H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +T
Sbjct: 363 LGNCINALCLNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNT 422

Query: 499 LEYASKAKNIKNK 511
           L+YA++AK IK K
Sbjct: 423 LKYANRAKEIKTK 435

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F   ++Q  ++      L    + G+N TV  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
             E  GII   + +LF  +E   + +++ +  S++E+YNE
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNE 237

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  114 bits (286), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 115/215 (53%), Gaps = 29/215 (13%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           +++ +  +YI+N+ E  +SN  + +  ++ G + R   ST MN  SSRSH I +IT+ + 
Sbjct: 182 RENRDRSMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRT 241

Query: 400 H-----QGTLFRLSKMNLVDLAGSENINRSGAI----NQRAKETGSINQSLLTLGRVINS 450
                   ++   S    VDLAGSE   RS A     N R KE  SIN+SL TL RV+ S
Sbjct: 242 DIDLNTNSSIISDSICRFVDLAGSE---RSTATQNCHNDRLKEGNSINKSLSTLRRVLTS 298

Query: 451 LADR--------------NNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETC 496
           L  R              N  +PFRES LT +L+D+LGGN+KT +IA ISP     EE+ 
Sbjct: 299 LKKREELKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPTNF--EESA 356

Query: 497 STLEYASKAKNIKNKPQLGSIISKDILLKNITTEL 531
           STL YA  A+ IK    + +  S   LL N+  +L
Sbjct: 357 STLRYADIAQTIKTNSIINT-YSNTTLLDNLQKQL 390

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 54/107 (50%), Gaps = 16/107 (14%)

Query: 107 TVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 166
             D+ FG   +Q   +         D + GYNC +L YG T +GKTYTM G+ K      
Sbjct: 62  CFDEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ 115

Query: 167 SESAGIIPRILFKLF---------DTLEMNQE-DYVVKCSFIELYNE 203
           +++ G+IPR    LF         D+ +++Q  +Y V CS  E+YNE
Sbjct: 116 NDTRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNE 162

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 90/143 (62%), Gaps = 3/143 (2%)

Query: 366 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLYK-EHQGTLFRLSKMNLVDLAGSENINRS 424
           +L++  K R  AST  N+ SSRSH+IF I L+   H+        +NLVDLAGSE ++ S
Sbjct: 612 VLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSERVHSS 671

Query: 425 GAINQRAKETGSINQSLLTLGRVINSLADRNN--HIPFRESKLTRLLQDSLGGNTKTALI 482
               +R +ET +IN+SL  LG VI +L D+N   HIPFR SKLT LLQ SL GN+KT + 
Sbjct: 672 QVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLMF 731

Query: 483 ATISPAKVTSEETCSTLEYASKA 505
             ISP+     ET ++L +ASK 
Sbjct: 732 VNISPSSSHINETINSLRFASKV 754

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (51%), Gaps = 14/102 (13%)

Query: 105 TYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 164
           ++  DK+F    +   +F EV + L    + GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 165 ELSESAGIIPRILFKLFDTLEMNQE---DYVVKCSFIELYNE 203
            L  + G+IP  +  +FD +E  +E   +Y + C F+E+YNE
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNE 561

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 112/188 (59%), Gaps = 19/188 (10%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           ++D NN I + NL  +  +  +E + L+ +G   R  +ST  N+ SSRSH +  I L ++
Sbjct: 219 REDANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQ 278

Query: 400 HQ------GTLFRLSKMNLVDLAGSENINRSGAINQRAK---ETGSINQSLLTLGRVINS 450
           ++       T    S ++++DLAGSE   R+ +   R +   E  +IN+SLL LG  IN+
Sbjct: 279 NKLNNDINSTEQLFSTLSIIDLAGSE---RAASTKNRGETLLEGANINKSLLALGNCINA 335

Query: 451 L-------ADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 503
           L       + +  HIP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA+
Sbjct: 336 LCINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYAN 395

Query: 504 KAKNIKNK 511
           +AK IK K
Sbjct: 396 RAKEIKTK 403

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 68/134 (50%), Gaps = 19/134 (14%)

Query: 81  INGSNEVSINTTDDVGITAQMNSKTY---------TVDKVFGPSANQQLIFDEVAEPLFL 131
           +N  N++S N  + +  ++Q++ + Y           DK+   ++ QQ +F    EPL  
Sbjct: 76  LNPLNKISENILNSIYSSSQLSRRHYRKNGGELRFIFDKLLDQNSTQQHVFQSTTEPLLD 135

Query: 132 DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGIIPRILFKLFDTLE--MNQE 189
             + GYN TV  YG T  GKTYT++G          E+ GII   L  LF+ +E   + +
Sbjct: 136 SILDGYNGTVFAYGATGCGKTYTISGT--------PENPGIIFLTLQSLFNKIENLKDTK 187

Query: 190 DYVVKCSFIELYNE 203
           +  +  S++E+YNE
Sbjct: 188 EISISLSYLEIYNE 201

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/148 (46%), Positives = 94/148 (63%), Gaps = 4/148 (2%)

Query: 366 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSK-MNLVDLAGSENINRS 424
           +L+K  K R  A+T  N+ SSRSH++F I L  +++ T       +NLVDLAGSE +N S
Sbjct: 571 VLKKATKLRATAATNSNERSSRSHSVFMIYLKGKNEITGDSSEGILNLVDLAGSERLNSS 630

Query: 425 GAINQRAKETGSINQSLLTLGRVINSLADRNN---HIPFRESKLTRLLQDSLGGNTKTAL 481
            A+  R +ET +IN+SL  LG VI++L   +N   HIPFR SKLT LLQ SL G++KT +
Sbjct: 631 QAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKTLM 690

Query: 482 IATISPAKVTSEETCSTLEYASKAKNIK 509
              ISP K    ET ++L +ASK  + K
Sbjct: 691 FVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 55/104 (52%), Gaps = 14/104 (13%)

Query: 103 SKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 162
           S+ Y  D++F  + +   +F E+ + L    + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 163 NGELSESAGIIPRILFKLFDTLEMNQED---YVVKCSFIELYNE 203
              L+++ G+IP  +  +FD  E  +E    Y + C FIE+YNE
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNE 519

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 116/192 (60%), Gaps = 10/192 (5%)

Query: 328 PKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
           P+ P+  L    ++D N+ I + NL      N ++ + L+ +G   R  + T+ N+ SSR
Sbjct: 194 PETPSKKLII--REDQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSR 251

Query: 388 SHTIFTITLYK-----EHQGTLFRL-SKMNLVDLAGSENINRSGAINQRAKETGSINQSL 441
           SH++  I + +     +  G+  ++ S ++++DLAGSE    +     R  E  +IN+SL
Sbjct: 252 SHSVLQIHVKQVLKNFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSL 311

Query: 442 LTLGRVINSLA--DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 499
           L LG  IN+L    ++ HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ +  +ET +TL
Sbjct: 312 LALGNCINALCINKKSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTL 371

Query: 500 EYASKAKNIKNK 511
           +YA++AK IK K
Sbjct: 372 KYANRAKEIKTK 383

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 54/103 (52%), Gaps = 13/103 (12%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F   + Q+ IF++   PL    + G+N TV  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTINGT------- 144

Query: 166 LSESAGIIPRILFKLFDTLEM-----NQEDYVVKCSFIELYNE 203
            SE  GII R + +LF  +E+     N+    +  S++E+YNE
Sbjct: 145 -SEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNE 186

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 111/202 (54%), Gaps = 25/202 (12%)

Query: 328 PKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
           P  P+  L    ++D ++ I + NL   +  + ++ + L+ +G   R  +ST+ N+ SSR
Sbjct: 290 PDTPSKKLII--REDKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSR 347

Query: 388 SHTIF---------TITLYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSIN 438
           SH +           I L  EH       + ++++DLAGSE    +    +R  E  +IN
Sbjct: 348 SHAVLQIHIMQTNTKIDLTSEHT-----FATLSIIDLAGSERAAATKNRGERLYEGANIN 402

Query: 439 QSLLTLGRVINSLADRNN---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAK 489
           +SLL LG  IN+L    N         HIP+R+SKLTRLL+ SLGGN KT +I  ISP+ 
Sbjct: 403 KSLLALGNCINALCIPTNNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSS 462

Query: 490 VTSEETCSTLEYASKAKNIKNK 511
              +ET +TL+YA++AK IK K
Sbjct: 463 SHYDETLNTLKYANRAKEIKTK 484

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 99  AQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGD 158
           A+ N   +  DK+F  +++Q  ++      L    + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 159 EKLYNGELSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
           +        E+ GII R++ +LF+ +E   +++ + +  S++E+YNE
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNE 282

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  114 bits (284), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 107/182 (58%), Gaps = 10/182 (5%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           ++D+ N  ++ NL +    N +E + L+ KG   R  + T  N+ SSRSH +  I + + 
Sbjct: 233 REDSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQM 292

Query: 400 HQGTLFR----LSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRN 455
           ++    +     + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+L   +
Sbjct: 293 NRTADIKQDQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSS 352

Query: 456 N------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 509
                  H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK
Sbjct: 353 TRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIK 412

Query: 510 NK 511
            K
Sbjct: 413 TK 414

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D++F     QQ +++    PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 176

Query: 166 LSESAGIIPRILFKLFDTLEM--NQEDYVVKCSFIELYNE 203
            SE  GII   + +LF  +E   + + + ++ SF+E+YNE
Sbjct: 177 -SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNE 215

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  113 bits (283), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 111/193 (57%), Gaps = 11/193 (5%)

Query: 328 PKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
           P+ P+  L    ++D +  I + NL    +   ++ + L+ KG   R  ++T  N+ SSR
Sbjct: 224 PETPSKKLVL--REDVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSR 281

Query: 388 SHTIFTITLYKEHQGTLF----RLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLT 443
           SH +  + + ++++        + + ++L+DLAGSE  + +    +R  E  +IN+SLL 
Sbjct: 282 SHAVLQVHITQKNRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLA 341

Query: 444 LGRVINSLADRNN-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCST 498
           LG  IN+L          H+P+R+SKLTRLL+ SLGGN KT +I  ISP     +ET +T
Sbjct: 342 LGNCINALCAGGKRGGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNT 401

Query: 499 LEYASKAKNIKNK 511
           L+YA++AK IK K
Sbjct: 402 LKYATRAKEIKTK 414

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D+VF   A+Q+ +++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 177

Query: 166 LSESAGIIPRILFKLFDTLEM--NQEDYVVKCSFIELYNE 203
            +E+ GII   + +LF  +E   + + + +  S++E+YNE
Sbjct: 178 -AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNE 216

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  113 bits (283), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 105/180 (58%), Gaps = 8/180 (4%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           ++D+  GI + NL        ++ + L+ +G   R  + T  N+ SSRSH +  I + ++
Sbjct: 245 REDSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQK 304

Query: 400 HQGTLFR----LSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA--- 452
           ++          + ++++DLAGSE  + +    +R  E  +IN+SLL LG  IN+L    
Sbjct: 305 NRTAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSG 364

Query: 453 -DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 511
                H+P+R+SKLTRLL+ SLGGN KT +I  I+P+    +ET +TL+YA++AK IK K
Sbjct: 365 RRSTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F   A Q  +++    PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 188

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
             E  G+I   + +LF  +E   + + + +  S++E+YNE
Sbjct: 189 -PEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNE 227

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  113 bits (282), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 92/148 (62%), Gaps = 4/148 (2%)

Query: 366 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSK-MNLVDLAGSENINRS 424
           LL++  K R  AST  N+ SSRSH+IF + L  E+  T  R    +NLVDLAGSE IN S
Sbjct: 549 LLKRANKLRSTASTACNERSSRSHSIFIVHLSGENVLTGERSHGILNLVDLAGSERINTS 608

Query: 425 GAINQRAKETGSINQSLLTLGRVINSLADRN---NHIPFRESKLTRLLQDSLGGNTKTAL 481
             I +R +ET SIN+SL  LG VI++L   +    HIPFR SKLT LLQ SL GN+KT +
Sbjct: 609 QVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTLM 668

Query: 482 IATISPAKVTSEETCSTLEYASKAKNIK 509
              IS     + ET ++L +ASK  + K
Sbjct: 669 FVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 76/172 (44%), Gaps = 18/172 (10%)

Query: 35  QKQSRRDPKEGEQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDD 94
           +++S R     E +E   NI V  R R    RE    + + V   + +  N+V     + 
Sbjct: 336 KEESMRRTLHNELQELRGNIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNG 395

Query: 95  VGITAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYT 154
            G   Q+    +  D++F        +F E+ + L    + GYN  +  YG T +GKTYT
Sbjct: 396 YGSGPQI----FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYT 450

Query: 155 MTGDEKLYNGELSESAGIIPRILFKLFDT---LEMNQEDYVVKCSFIELYNE 203
           M          L+ + GIIP  +  +F+    L+     Y V C F+E+YNE
Sbjct: 451 M----------LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNE 492

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  112 bits (281), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 89/144 (61%), Gaps = 4/144 (2%)

Query: 366 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGT-LFRLSKMNLVDLAGSENINRS 424
           +L+K  K R  AST  N+ SSRSH+IF I L   +  T       +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 425 GAINQRAKETGSINQSLLTLGRVINSLADRNN---HIPFRESKLTRLLQDSLGGNTKTAL 481
             +  R +ET +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 482 IATISPAKVTSEETCSTLEYASKA 505
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 17/160 (10%)

Query: 48  EEEELNITVAVRCRGRNE-REIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTY 106
           E +EL   + V CR R   + ++   + ++ V + + ++ V       +  TAQ++   +
Sbjct: 379 ELQELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHE--F 436

Query: 107 TVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 166
             DK+F        +F EV + L    + GYN  +  YG T +GKT+TM          L
Sbjct: 437 KFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------L 485

Query: 167 SESAGIIPRI---LFKLFDTLEMNQEDYVVKCSFIELYNE 203
           +   GIIP     +F   + L+    DY V C FIE+YNE
Sbjct: 486 NPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNE 525

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 102/152 (67%), Gaps = 4/152 (2%)

Query: 358 SNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSK-MNLVDLA 416
           SN +E   L+Q+  K R+ A T MN+ SSRSH++F + +   ++ +  R    +NLVDLA
Sbjct: 543 SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLA 602

Query: 417 GSENINRSGAIN-QRAKETGSINQSLLTLGRVINSLADRNN--HIPFRESKLTRLLQDSL 473
           GSE +NRSG ++ +R +ET  IN+SL ++G VI++L   +   HIPFR +KLT LL+ SL
Sbjct: 603 GSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSL 662

Query: 474 GGNTKTALIATISPAKVTSEETCSTLEYASKA 505
            G++KT ++ T+SP+  +  ET ++L +A+K 
Sbjct: 663 QGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 14/101 (13%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F    + + +F EV E L    + G+N  +  YG T +GKTYTM          
Sbjct: 408 FQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM---------- 456

Query: 166 LSESAGIIPRILFKLFD---TLEMNQEDYVVKCSFIELYNE 203
           L+E  GIIP  L  + D   +++     Y +K  F+E+YN+
Sbjct: 457 LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYND 497

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 102/181 (56%), Gaps = 9/181 (4%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           ++D++  I + NL        +E +  + +G   R  + T  N+ SSRSH +  I + + 
Sbjct: 237 REDSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQT 296

Query: 400 HQGTLF----RLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA--- 452
            +          + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+L    
Sbjct: 297 DRTPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISD 356

Query: 453 --DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 510
              R  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL YA++AK+IK 
Sbjct: 357 GTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKT 416

Query: 511 K 511
           K
Sbjct: 417 K 417

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F  +ANQ  +++     L    + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 180

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
             E  GII   + +LF  +E   + ++  +  S++E+YNE
Sbjct: 181 -PEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNE 219

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 90/151 (59%), Gaps = 16/151 (10%)

Query: 365 ALLQKGLKYRQVASTKMNDFSSRSHTIFTITLY-------KEHQGTLFRLSKMNLVDLAG 417
            LL++  K R  A+T  N+ SSRSH++F I L        +E QGTL      NLVDLAG
Sbjct: 553 TLLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQGTL------NLVDLAG 606

Query: 418 SENINRSGAINQRAKETGSINQSLLTLGRVINSLADRN---NHIPFRESKLTRLLQDSLG 474
           SE IN S     R +ET +IN+SL  LG VI++LA  +    HIPFR SKLT LLQ SL 
Sbjct: 607 SERINASQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLL 666

Query: 475 GNTKTALIATISPAKVTSEETCSTLEYASKA 505
           G++KT +   ISP      ET ++L +ASK 
Sbjct: 667 GDSKTLMFVNISPCLDHFNETLNSLRFASKV 697

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 72/169 (42%), Gaps = 39/169 (23%)

Query: 48  EEEELNITVAVRCRGRNEREIKLKSSVIVTVPDING----SNEVSINTTDD------VGI 97
           E +EL   + V CR R               P + G    S  V IN  +D      + I
Sbjct: 360 ELQELRGNIRVFCRIR---------------PLLQGEGSESCHVHINLFNDDEGTQSMNI 404

Query: 98  TAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTG 157
           T       +  DK+F P  +   IF+E+ + L    + GYN  +  YG T +GKTYTM  
Sbjct: 405 TRDSKKHEFKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-- 461

Query: 158 DEKLYNGELSESAGIIPRILFKLFDTLEMNQE---DYVVKCSFIELYNE 203
                   L    G+IP  L  +F  + + +E   +Y +   FIE+YNE
Sbjct: 462 --------LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNE 502

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 108/189 (57%), Gaps = 13/189 (6%)

Query: 336 ETPPQ-----DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHT 390
           +TP Q     +D +N   + NL      + ++ + L+ KG   R  + T  N+ SSRSH 
Sbjct: 230 DTPSQKLIIREDTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHA 289

Query: 391 IFTITLYKEHQGTLFRLSK----MNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGR 446
           +  I + +  +    +  K    ++++DLAGSE  + +    +R  E  +IN+SLL LG 
Sbjct: 290 VLQIHVVQSSRSVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGN 349

Query: 447 VINSLADRNN----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 502
            IN+L         H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA
Sbjct: 350 CINALCMTGRRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYA 409

Query: 503 SKAKNIKNK 511
           ++AK+IK K
Sbjct: 410 NRAKDIKTK 418

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 52/100 (52%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F   A QQ +F     PL    I G+N TV  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISGT------- 182

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
             E+ GII   + +LF  +E   + + + +  S++E+YNE
Sbjct: 183 -PENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNE 221

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 90/144 (62%), Gaps = 4/144 (2%)

Query: 366 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFR-LSKMNLVDLAGSENINRS 424
           +L+K  K R  AST  N+ SSRSH+IF I L   +  T  +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 425 GAINQRAKETGSINQSLLTLGRVINSLADRNN---HIPFRESKLTRLLQDSLGGNTKTAL 481
             +  R +ET +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 482 IATISPAKVTSEETCSTLEYASKA 505
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 75/163 (46%), Gaps = 23/163 (14%)

Query: 48  EEEELNITVAVRCRGRNEREI--KLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKT 105
           E +EL   + V CR R   E    L +S+I  V + + +  V       +  T Q++   
Sbjct: 379 ELQELRGNIRVYCRIRPPLETLENLDTSLI-RVNEFDDNRGVQSMEVTKIQSTTQVHE-- 435

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTM--TGDEKLYN 163
           +  DK+F      + +F EV + L    + GYN  +  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 164 GELSESAGIIPRI---LFKLFDTLEMNQEDYVVKCSFIELYNE 203
                  GIIP     +F   + L+    DY V C FIE+YNE
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNE 525

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 100/175 (57%), Gaps = 6/175 (3%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
            D    G YI N+    +++  +   +L+K  K R  A+T+ N+ SSRSH++F + +   
Sbjct: 532 HDHEKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGR 591

Query: 400 --HQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRN-- 455
             H G   +  K+NLVDLAGSE IN S    +R +ET +IN+SL  LG VI +L   +  
Sbjct: 592 NLHTGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAG 650

Query: 456 -NHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 509
             +IPFR SKLT LLQ SL G++KT +   I P      ET ++L +ASK  + K
Sbjct: 651 KRYIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 78/163 (47%), Gaps = 24/163 (14%)

Query: 48  EEEELNITVAVRCRGR----NEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNS 103
           E +EL   + V CR R    NE +  +   +I    +  G+  ++IN  +      ++ S
Sbjct: 359 ELQELRGNIRVYCRVRPPLLNEPQ-DMSHILIEKFNEAKGAQSLTINRNE-----GRILS 412

Query: 104 KTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 163
             +  D +F PS   + IF+E+ + L    + GYN  +  YG T +GKTYTM        
Sbjct: 413 YNFQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-------- 463

Query: 164 GELSESAGIIPRIL---FKLFDTLEMNQEDYVVKCSFIELYNE 203
             L+   G+IP  L   FK    L+    +Y ++C +IE+YNE
Sbjct: 464 --LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNE 504

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 90/144 (62%), Gaps = 4/144 (2%)

Query: 366 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFR-LSKMNLVDLAGSENINRS 424
           +L+K  K R  AST  N+ SSRSH+IF I L   +  T  +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 425 GAINQRAKETGSINQSLLTLGRVINSLADRNN---HIPFRESKLTRLLQDSLGGNTKTAL 481
             +  R +ET +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 482 IATISPAKVTSEETCSTLEYASKA 505
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 76/170 (44%), Gaps = 37/170 (21%)

Query: 48  EEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDD-VGI--------- 97
           E +EL   + V CR R           + T+ D + S  +++N  DD  GI         
Sbjct: 379 ELQELRGNIRVYCRIR---------PALETLEDSDTS-LINVNEFDDNCGIQSMEVTKIH 428

Query: 98  -TAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMT 156
            TAQ++   +  DK+F        +F EV + L    + GYN  +  YG T +GKT+TM 
Sbjct: 429 NTAQVHE--FKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM- 484

Query: 157 GDEKLYNGELSESAGIIPRI---LFKLFDTLEMNQEDYVVKCSFIELYNE 203
                    L+   GIIP     +F   + L+    DY V C FIE+YNE
Sbjct: 485 ---------LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNE 525

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 109/195 (55%), Gaps = 18/195 (9%)

Query: 328 PKLPTSSLETPP---QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDF 384
           PK   SS+  P    +DD N G+ +  L E    + +E L  ++ G K+R+ +ST  N  
Sbjct: 209 PKPLRSSIAVPELKIRDDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTR 268

Query: 385 SSRSHTIFTITLYKE--HQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLL 442
           SSRSH I  I L       G +   S ++L DLAGSE   R  A ++R +E   IN+SLL
Sbjct: 269 SSRSHAIILIRLISSDLSSGEVVT-STLSLCDLAGSE---RVTAQHERRQEGSFINKSLL 324

Query: 443 TLGRVINSLADR---------NNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSE 493
            LG VI+ L+           N+HIP+R+SKLTR+LQ +L GN+    I TI  +   + 
Sbjct: 325 ALGTVISKLSAEVNNSTESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATN 384

Query: 494 ETCSTLEYASKAKNI 508
           E+ +TL +AS+AKN+
Sbjct: 385 ESVNTLRFASRAKNV 399

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 69/140 (49%), Gaps = 27/140 (19%)

Query: 82  NGSNEVSINTTDDVGITAQMN------SKT--------YTVDKVFGPSANQQLIFDEVAE 127
           NG+  VSI T   VGI  + N      +KT        YT D VF P A+   ++    +
Sbjct: 67  NGTISVSIRTKP-VGINEKCNWYVETENKTIIHTDIGEYTYDNVFHPDASNFDVYAATCK 125

Query: 128 PLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGIIP----RILFKLFDT 183
           PL      G+N TV  YGMT +GKTYTM+G        +  +AG+IP     +  K+FD+
Sbjct: 126 PLIDKLFDGFNSTVFAYGMTGSGKTYTMSG--------VDGNAGLIPLSVAYMYSKIFDS 177

Query: 184 LEMNQEDYVVKCSFIELYNE 203
                + Y    S++E+YNE
Sbjct: 178 TIHENKKYDTLVSYLEIYNE 197

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 98/174 (56%), Gaps = 4/174 (2%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
            DD +    I N+    +   +    +L +  K R  ASTK N+ SSRSH+IF I L+ +
Sbjct: 529 HDDESQTTSITNVMTVTLDREETVEKVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGK 588

Query: 400 HQGT-LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSL---ADRN 455
           +  T       +NLVDLAGSE IN S    +R +ET  IN+SL  LG VI++L     + 
Sbjct: 589 NSKTNEDSYGILNLVDLAGSERINSSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKE 648

Query: 456 NHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 509
            HIPFR SKLT LL+ SL GN+KT +   IS +     ET ++L +ASK  + K
Sbjct: 649 RHIPFRNSKLTHLLKYSLSGNSKTLMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 74/162 (45%), Gaps = 28/162 (17%)

Query: 50  EELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVG-----ITAQMNSK 104
           +EL   + V CR R           + ++ D N S+    +  +D G     IT   N+ 
Sbjct: 369 QELRGNIRVYCRLR---------PPLKSIEDPNTSHIKVYSLDNDHGTQTMEITKNNNTN 419

Query: 105 TYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 164
            Y  DK+F    +   IF EV + L    + GYN  +  YG T +GKT+TM         
Sbjct: 420 KYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTFTM--------- 469

Query: 165 ELSESAGIIP---RILFKLFDTLEMNQEDYVVKCSFIELYNE 203
            L+ S GIIP   R +F   D L+    +Y + C F+E+YNE
Sbjct: 470 -LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNE 510

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 104/174 (59%), Gaps = 4/174 (2%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
            DD +    ++NL+   +++ +   A+L+  +K R  AST  N+ SSRSH+IF I ++  
Sbjct: 497 HDDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHGI 556

Query: 400 HQGT-LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRN--- 455
           ++G    R   +NL+DLAGSE ++ S   ++R KET  IN+SL  LG V+NSL   +   
Sbjct: 557 NEGLGEERNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDATT 616

Query: 456 NHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 509
            HI FR+SKLT LLQ SL GN+KT ++  IS +     ET  +L +A K  + K
Sbjct: 617 RHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 52/101 (51%), Gaps = 14/101 (13%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           Y+ DKVF  +   Q IF EV+E L    + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 166 LSESAGIIPRILFKLFDTLE---MNQEDYVVKCSFIELYNE 203
           L+   GIIP     +FD ++    N   Y V C F+E+YN+
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYND 472

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  110 bits (274), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 68/148 (45%), Positives = 89/148 (60%), Gaps = 4/148 (2%)

Query: 366 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGT-LFRLSKMNLVDLAGSENINRS 424
           L++K  K R  A+T  N+ SSRSH+IF I L   +  T       +NLVDLAGSE +N S
Sbjct: 539 LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGESSYGILNLVDLAGSERLNSS 598

Query: 425 GAINQRAKETGSINQSLLTLGRVINSLADRN---NHIPFRESKLTRLLQDSLGGNTKTAL 481
                R +ET +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL GN+KT +
Sbjct: 599 QVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKTLM 658

Query: 482 IATISPAKVTSEETCSTLEYASKAKNIK 509
              ISP +   +ET ++L +ASK    K
Sbjct: 659 FVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 53/101 (52%), Gaps = 14/101 (13%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D++F      + +FDE+ + L    + GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 166 LSESAGIIPRILFKLF---DTLEMNQEDYVVKCSFIELYNE 203
           L+ + G+IP  +  +F   D+L+    +Y V C F+E+YNE
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNE 486

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  110 bits (274), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 75/180 (41%), Positives = 99/180 (55%), Gaps = 16/180 (8%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLY-- 397
            D  N    I N+   ++ + +    +L++  K R  AST  N+ SSRSH+IF I L   
Sbjct: 522 HDQENRNTTITNIVTRNLDSEETADNILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGS 581

Query: 398 -----KEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA 452
                +E  G L      NLVDLAGSE IN S     R +ET +IN+SL  LG VI++L 
Sbjct: 582 NSLTGEESYGIL------NLVDLAGSERINSSQVTGDRLRETQNINRSLSCLGDVIHALG 635

Query: 453 DRN---NHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 509
             +    HIPFR SKLT LLQ SL GN+KT +   ISP+     ET ++L +ASK  + K
Sbjct: 636 GPDQGKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 73/164 (44%), Gaps = 19/164 (11%)

Query: 48  EEEELNITVAVRCRGRNERE-IKLKSSVIVTVPDINGSNEV-SINTTDDVGIT---AQMN 102
           E +EL   + V CR R     I+ K +  + V D +  N + S+     + +    A   
Sbjct: 341 ELQELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQSMEVMKGIEVNNNNATQI 400

Query: 103 SKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 162
            + +  DK+F  +     +F EV + L    + GYN  +  YG T +GKTYTM       
Sbjct: 401 PQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM------- 452

Query: 163 NGELSESAGIIPRILFKLFDT---LEMNQEDYVVKCSFIELYNE 203
              L    GIIP  +  +F+    L+     Y + C F+E+YNE
Sbjct: 453 ---LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNE 493

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  110 bits (274), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 90/144 (62%), Gaps = 4/144 (2%)

Query: 366 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFR-LSKMNLVDLAGSENINRS 424
           +L++  K R  AST  N+ SSRSH+IF I L   +  T  +    +NLVDLAGSE IN S
Sbjct: 576 VLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINIS 635

Query: 425 GAINQRAKETGSINQSLLTLGRVINSLADRNN---HIPFRESKLTRLLQDSLGGNTKTAL 481
             +  R +ET +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT +
Sbjct: 636 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLM 695

Query: 482 IATISPAKVTSEETCSTLEYASKA 505
              ISP+     ET ++L +ASK 
Sbjct: 696 FVNISPSSSHINETLNSLRFASKV 719

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 74/160 (46%), Gaps = 17/160 (10%)

Query: 48  EEEELNITVAVRCRGRNERE-IKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTY 106
           E +EL   + V CR R   E ++   + ++ V + + +  V       +  T Q++   +
Sbjct: 379 ELQELRGNIRVYCRIRPPLESLENLDTSLINVNEFDDNRGVQSMEVTKIQNTPQVHE--F 436

Query: 107 TVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 166
             DK+F      + +F EV + L    + GYN  +  YG T +GKT+TM          L
Sbjct: 437 KFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------L 485

Query: 167 SESAGIIPRI---LFKLFDTLEMNQEDYVVKCSFIELYNE 203
           +   GIIP     +F   + L+    DY V C FIE+YNE
Sbjct: 486 NPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNE 525

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  109 bits (273), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 105/185 (56%), Gaps = 20/185 (10%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           +DD+  G+ +  L+E    +++E +  +++G  +R+ A T  N  SSRSH I  I L   
Sbjct: 272 RDDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNT 331

Query: 400 H--QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSL------ 451
           +   GT    S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L      
Sbjct: 332 NVIDGTSIS-STLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTA 387

Query: 452 --------ADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 503
                   A+ N HIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +AS
Sbjct: 388 ASHGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFAS 447

Query: 504 KAKNI 508
           +AKN+
Sbjct: 448 RAKNV 452

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 49/98 (50%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D V+ P  +   I++ + +P+     +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDD 194

Query: 166 LSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
                  +  +  K+ +   + +  + V  S++E+YNE
Sbjct: 195 DGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNE 232

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  110 bits (274), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 99/164 (60%), Gaps = 12/164 (7%)

Query: 366 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFR-LSKMNLVDLAGSENINRS 424
           +L++  K R  AST  N+ SSRSH+IF I L   ++ T  +    +NLVDLAGSE IN S
Sbjct: 603 ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGILNLVDLAGSERINSS 662

Query: 425 GAINQRAKETGSINQSLLTLGRVINSLA----DRNN----HIPFRESKLTRLLQDSLGGN 476
               +R +ET +IN+SL  LG VI++L     D+ N    HIPFR SKLT LLQ SL GN
Sbjct: 663 QVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIGN 722

Query: 477 TKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISK 520
           +KT +   ISP+     ET ++L +ASK  + K     G+ ISK
Sbjct: 723 SKTLMFVNISPSINYVNETLNSLRFASKVNSAK---MGGATISK 763

 Score = 61.6 bits (148), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 49/101 (48%), Gaps = 14/101 (13%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F  +     +F EV + L    + GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 166 LSESAGIIPRILFKLFDT---LEMNQEDYVVKCSFIELYNE 203
           L    GIIP  +  +F+    L+     Y ++C F+E+YNE
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNE 542

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  110 bits (274), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 108/189 (57%), Gaps = 13/189 (6%)

Query: 336 ETPPQ-----DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHT 390
           +TP Q     +D+++   + NL        ++ + L+ +G   R  + T  N+ SSRSH 
Sbjct: 228 DTPSQKLIIREDSDSTTTVANLSYHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHA 287

Query: 391 IFTITLYKEHQGTLFRLSKM----NLVDLAGSENINRSGAINQRAKETGSINQSLLTLGR 446
           +  + + +  +    +  KM    +++DLAGSE  + +    +R  E  +IN+SLL LG 
Sbjct: 288 VLQVHVVQSSRTVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGN 347

Query: 447 VINSLADRNN----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 502
            IN+L         H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA
Sbjct: 348 CINALCMTGRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYA 407

Query: 503 SKAKNIKNK 511
           ++AK+IK K
Sbjct: 408 NRAKDIKTK 416

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 52/100 (52%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  DK+F   A+QQ +F     PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISGT------- 180

Query: 166 LSESAGIIPRILFKLFDTLE--MNQEDYVVKCSFIELYNE 203
             +S GII   + +LF  +    + + + +  S++E+YNE
Sbjct: 181 -PDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNE 219

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  109 bits (273), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 91/149 (61%), Gaps = 4/149 (2%)

Query: 365 ALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSK-MNLVDLAGSENINR 423
            LL+K  + R  AST  N+ SSRSH++F I L   +  T  +    +NLVDLAGSE IN 
Sbjct: 565 GLLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGILNLVDLAGSERINS 624

Query: 424 SGAINQRAKETGSINQSLLTLGRVINSLADRN---NHIPFRESKLTRLLQDSLGGNTKTA 480
           S  + +R +ET +IN+SL  LG V+++L   +    HIPFR SKLT LLQ SL GN+KT 
Sbjct: 625 SQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTL 684

Query: 481 LIATISPAKVTSEETCSTLEYASKAKNIK 509
           +   IS  +    ET ++L +ASK  + K
Sbjct: 685 MFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 80/162 (49%), Gaps = 20/162 (12%)

Query: 48  EEEELNITVAVRCRGRNEREIKLKSSVIVTV---PDINGSNEVSINTTDDVGITAQMNSK 104
           E +EL   + V CR R   + +  ++  +TV    D NG   + I  +++ G +   N  
Sbjct: 370 ELQELRGNIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN-- 427

Query: 105 TYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 164
            +  D++F  +   + +F+E+ + L    + GYN  +  YG T +GKTYTM         
Sbjct: 428 -FKFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 476

Query: 165 ELSESAGIIPRILFKLFDTLEMNQE---DYVVKCSFIELYNE 203
            L+   GIIP  +  +F  +E  +E   +Y + C FIE+YNE
Sbjct: 477 -LNPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNE 517

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 92/291 (31%), Positives = 148/291 (50%), Gaps = 35/291 (12%)

Query: 330 LPTSSL--ETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
           +P+S+L  +   +DD   G+ +  L E ++S+ KE +  +  G   R+   T  N  SSR
Sbjct: 217 VPSSTLTNDLKLRDDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSR 276

Query: 388 SHTIFTITLYKEHQGTLFR-LSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGR 446
           SH +  I ++   + T  + +S ++L DLAGSE   R+    +R KE   IN+SLL LG 
Sbjct: 277 SHAVVLIRVFCTDEITGEQVMSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGT 333

Query: 447 VINSLADRNN-------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 499
           VI+ L+  ++       HIP+R+SKLTR+LQ +L G++  A I T+     TS E+ +T+
Sbjct: 334 VISKLSMESSGLSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTI 393

Query: 500 EYASKAKNIK------------NKPQLGSIISKDILLKNITTE---------LSQVKSDL 538
            +AS+AKNI             +K QL   + K +  + IT +          S + SD 
Sbjct: 394 RFASRAKNISLAVKRNEADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDT 453

Query: 539 LSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLKDK 589
              +  E + M  EHY++L   L+    +  E   II+ L     ++L+ K
Sbjct: 454 SLLRENELLKMKVEHYERL-ETLEPSILKDTELVEIIDMLPQDIGVMLETK 503

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 57/100 (57%), Gaps = 10/100 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D VF P  N   +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 166 LSESAGIIPRILFKLFDTLEMN--QEDYVVKCSFIELYNE 203
                GIIP  +  +FD + +   ++ + V+ S++E+YNE
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNE 197

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 121/243 (49%), Gaps = 40/243 (16%)

Query: 327 PPKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSS 386
           P +L +S L    +DD   G+ I  L E     ++E +  ++ G   R+ + T+ N  SS
Sbjct: 249 PSRLNSSELRI--RDDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSS 306

Query: 387 RSHTIFTITLYKEH--QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTL 444
           RSH +  + L   +   G+    S + L DLAGSE   R+    +R KE   IN+SLL L
Sbjct: 307 RSHAVILVRLVTHNVIDGSKTS-STLTLCDLAGSE---RAAGQQERRKEGAFINKSLLAL 362

Query: 445 GRVINSLA------------------------DRNNHIPFRESKLTRLLQDSLGGNTKTA 480
           G VI+ L+                        + NNHIP+R+SKLTRLLQ +L GN+   
Sbjct: 363 GTVISKLSAESLSNSKHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVT 422

Query: 481 LIATISPAKVTSEETCSTLEYASKAKNIK----NKPQLGSI----ISKDILLKNITTELS 532
            I TI P   T  ET +TL +AS+AKN+      K  L +I    + KD ++K +T  L 
Sbjct: 423 TICTIDPRMETYAETINTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLE 482

Query: 533 QVK 535
           + K
Sbjct: 483 KQK 485

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 54/108 (50%), Gaps = 9/108 (8%)

Query: 98  TAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTG 157
           T   N+  Y  D VF P  +   I+   A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 158 DEKLYNGELSESAGIIPRILFKLFDTL--EMNQEDYVVKCSFIELYNE 203
           D +          GI+P  +  LF+ +    N + Y V  S++E+YNE
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNE 225

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 103/175 (58%), Gaps = 6/175 (3%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITL--Y 397
            D +N+   I N+ +  +++ ++  ++L++  + R  A T+ N+ SSRSH++F + +  +
Sbjct: 534 HDHDNHATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHINGH 593

Query: 398 KEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVI---NSLADR 454
            +  G +    K+NL+DLAGSE IN S     R +ET +IN+SL  LG VI   NS    
Sbjct: 594 NDQTGEVSH-GKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAA 652

Query: 455 NNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 509
             HIPFR SKLT LLQ SL G++KT +   I   +  + ET ++L +ASK  + K
Sbjct: 653 KRHIPFRNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 49/104 (47%), Gaps = 14/104 (13%)

Query: 103 SKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 162
           S  +  DK+F P      +F E+ + L    + GYN  +  YG T +GKTYTM       
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------- 465

Query: 163 NGELSESAGIIPRILFKLFDTLEMNQED---YVVKCSFIELYNE 203
              L+   G+IP  L  +F   E   E    Y + C +IE+YNE
Sbjct: 466 ---LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNE 506

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 114/213 (53%), Gaps = 20/213 (9%)

Query: 336 ETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTIT 395
           E P +DD+ +G+ +  L E  + ++++ L  +  G   R+   T  N  SSRSH I T+ 
Sbjct: 267 ELPVRDDSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLN 326

Query: 396 LY-KEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADR 454
           L   +        S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L+  
Sbjct: 327 LACTDLVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAS 383

Query: 455 ---------NNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 505
                    N+HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +AS+A
Sbjct: 384 SMHTTPSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRA 443

Query: 506 KNI-----KNKPQLGSIISKDILLKNITTELSQ 533
           KN+     +N+ +L     KD L+ N+  +L +
Sbjct: 444 KNVSMTVKRNEAELAH--EKDALIHNLRRQLDE 474

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 68/146 (46%), Gaps = 20/146 (13%)

Query: 61  RGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVFGPSANQQL 120
           RG     I+LK +      D N  N   ++   D    A  +   +  D VF P +N   
Sbjct: 103 RGAISVSIRLKPT------DANAKNPWFVS---DEQTIAHNDVGEFKFDNVFRPQSNNYE 153

Query: 121 IFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGIIPRILFKL 180
           ++ ++ +P+     +GYN  +  YGMT +GKT+TM+G          E AG+I   +  +
Sbjct: 154 VYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT--------PEEAGLISLSVEHI 205

Query: 181 FDTL---EMNQEDYVVKCSFIELYNE 203
           F  +    +  + + V  S++E+YNE
Sbjct: 206 FAQIMSESLANKSFQVTVSYLEIYNE 231

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 105/197 (53%), Gaps = 23/197 (11%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           ++D+  G+ I  L E    ++ E L  ++ G K R+   T  N  SSRSH I  I L K 
Sbjct: 255 REDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKT 314

Query: 400 --HQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLA----- 452
              +GT    S ++L DLAGSE   ++   N+R KE   IN+SLL LG VI+ L+     
Sbjct: 315 DLKEGTSVS-STLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTS 370

Query: 453 DRNN--------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 504
            RN         HIP+R+SKLTR+LQ +L GN     I TI      S ET +TL +AS+
Sbjct: 371 HRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASR 430

Query: 505 AKNIK----NKPQLGSI 517
           AKN+      KP L S+
Sbjct: 431 AKNVSLHIFRKPLLPSM 447

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 60/126 (47%), Gaps = 12/126 (9%)

Query: 82  NGSNEVSINTTDDVGITAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTV 141
           NG  E+      D       +   +  D VF  + N   ++ + ++P+     +G N TV
Sbjct: 98  NGGRELDPWFVRDEHTMQHADYGEFKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATV 157

Query: 142 LVYGMTSTGKTYTMTGDEKLYNGELSESAGIIPRILFKLFDTL--EMNQED--YVVKCSF 197
             YGMT +GKT+TM G E        E+ G+IP  +  L+  +  E  Q D  + +  S+
Sbjct: 158 FAYGMTGSGKTFTMAGTE--------ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSY 209

Query: 198 IELYNE 203
           +E+YNE
Sbjct: 210 LEIYNE 215

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 109/211 (51%), Gaps = 37/211 (17%)

Query: 332 TSSLETPPQ--------------DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVA 377
           +S+L+TPP+              DD   GI +  L E   S+  + +  ++ G K ++++
Sbjct: 220 SSNLQTPPRFGNSFNSAQDLRIRDDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKIS 279

Query: 378 STKMNDFSSRSHTIFTITLYKEHQGT-LFRLSKMNLVDLAGSENINRSGAINQRAKETGS 436
            T+ N  SSRSH+I  + L      T +   S ++L DLAGSE   ++ +  +R KE   
Sbjct: 280 ETEYNSRSSRSHSILLVRLIATDLETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAF 336

Query: 437 INQSLLTLGRVINSLADRNN-------------------HIPFRESKLTRLLQDSLGGNT 477
           IN+SLL LG VI  L+  +N                   HIP+R+SKLTR+LQ +L GN+
Sbjct: 337 INKSLLALGTVIAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNS 396

Query: 478 KTALIATISPAKVTSEETCSTLEYASKAKNI 508
               I T+      S ET +TL +AS+AKN+
Sbjct: 397 IITTICTVDIRSDASSETLNTLRFASRAKNV 427

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 20/115 (17%)

Query: 93  DDVGITAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKT 152
           DDVG         + +D++F    +   I+ E+ +PL      GYN T+  YGMT +GKT
Sbjct: 104 DDVG--------EFRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKT 155

Query: 153 YTMTGDEKLYNGELSESAGIIPRILFKLFDTLE----MNQEDYVVKCSFIELYNE 203
           +TM+G +        E  G+IP  +  LF+T+     + ++ Y +  S++E+YNE
Sbjct: 156 FTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNE 202

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 77/230 (33%), Positives = 122/230 (53%), Gaps = 20/230 (8%)

Query: 332 TSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTI 391
           T+ +E   +DD+  G+ +  L E  +  +++ +  +  G   R+   T  N  SSRSH I
Sbjct: 258 TTGIELKIRDDSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAI 317

Query: 392 FTITL-YKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINS 450
             I L   + +  L   S ++L DLAGSE   R+ A  +R KE   IN+SLL LG VI+ 
Sbjct: 318 VLIRLTCTDLKSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISK 374

Query: 451 LADRN---------NHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEY 501
           L+  +         +HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +
Sbjct: 375 LSAESTQNMGVGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRF 434

Query: 502 ASKAKNI-----KNKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEG 546
           AS+AKNI     +N+  + +   KD +++N+  +L Q    +   KS  G
Sbjct: 435 ASRAKNISLVVKRNEMDISN--EKDHIIENLRRQLEQQNETIAVLKSNNG 482

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 57/101 (56%), Gaps = 11/101 (10%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           ++ D VF P+ +   +++E A P+     +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 166 LSESAGIIPRILFKLFDTL---EMNQEDYVVKCSFIELYNE 203
            S   G+IP  +  +F  +    +N + + VK S++E+YNE
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNE 239

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  103 bits (258), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 64/153 (41%), Positives = 92/153 (60%), Gaps = 14/153 (9%)

Query: 365 ALLQKGLKYRQVASTKMNDFSSRSHTIFTITLY-------KEHQGTLFRLSKMNLVDLAG 417
            +L+   K + +A+T  N+ SSRSH++FTI ++       +   G L      NLVDLAG
Sbjct: 540 TVLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASDGVL------NLVDLAG 593

Query: 418 SENINRSGAINQRAKETGSINQSLLTLGRVINSLADRN-NHIPFRESKLTRLLQDSLGGN 476
           SE I+ S     R +ET +IN+SL  LG VI +L  ++  HIPFR SKLT LLQ SL G+
Sbjct: 594 SERIDTSNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGD 653

Query: 477 TKTALIATISPAKVTSEETCSTLEYASKAKNIK 509
           +KT +   +SP+    +ET ++L +ASK  + K
Sbjct: 654 SKTLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 77/155 (49%), Gaps = 23/155 (14%)

Query: 53  NITVAVRCRGRNEREIKLKSSVIVTVPD-INGSNEVSINTTDDVGITAQMNSKTYTVDKV 111
           NI V  R R   E E++  S + V+  D  NGS  + I+  D        NS+ +  DKV
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNED-------RNSR-FLFDKV 409

Query: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171
           F  +A+ + +F+EV + L    + GYN  +  YG T +GKTYTM  D            G
Sbjct: 410 FSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMMND----------PDG 458

Query: 172 IIPRILFKLFDTLEMNQE---DYVVKCSFIELYNE 203
           +IP  L  +FD   + +E   DY  +  FIE+YNE
Sbjct: 459 VIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNE 493

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 101/198 (51%), Gaps = 33/198 (16%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           +DD+  G+ +  L E    +++E +  + KG K R+ A T  N  SSRSH I  I L   
Sbjct: 274 RDDSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTS 333

Query: 400 HQ--GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNN- 456
               GT    S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+  +N 
Sbjct: 334 DMKDGTSIS-STLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNK 389

Query: 457 --------------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKV 490
                                     HIP+R+SKLTRLLQ +L G++    I TI     
Sbjct: 390 NRSPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNE 449

Query: 491 TSEETCSTLEYASKAKNI 508
           +S ET +TL +AS+AKNI
Sbjct: 450 SSAETLNTLRFASRAKNI 467

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 75/155 (48%), Gaps = 27/155 (17%)

Query: 54  ITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVFG 113
           ITVA+R +  +       SS +VT       +E +I   DDVG         +  D VF 
Sbjct: 101 ITVAIRPKPTSNPSDVSTSSWLVT-------DEKTI-AHDDVG--------EFKFDHVFN 144

Query: 114 PSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGII 173
              +   I+  +  P+     +G+N T+  YGMT +GKTYTM G       E  +  G+I
Sbjct: 145 SFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMG-----CPEREQKDGLI 199

Query: 174 PRILFKLF-----DTLEMNQEDYVVKCSFIELYNE 203
           P  +  LF     +TL+ +++  +V  S++E+YNE
Sbjct: 200 PLSVSYLFTKIMEETLDGDKKFEIV-LSYLEIYNE 233

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 82/260 (31%), Positives = 129/260 (49%), Gaps = 39/260 (15%)

Query: 330 LPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSH 389
           +P +  E P +DD  +G+ +  L E  + ++++ L  ++ G   R+   T  N  SSRSH
Sbjct: 258 VPGAGAELPVRDDARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSH 317

Query: 390 TIFTI--TLYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRV 447
            I TI  T  +   GT    S ++L DLAGSE   R+   ++R KE   IN+SLL LG V
Sbjct: 318 AIVTIKVTCTELLSGT-DTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTV 373

Query: 448 INSLAD----------------RNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 491
           I+ L+                  N+H+P+R+SKLTR+LQ +L G++    I TI      
Sbjct: 374 ISKLSAVSGASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDA 433

Query: 492 SEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQ 551
             ET +T+ +AS+AKN+             + +K    E +  K +LL +  ++      
Sbjct: 434 MSETVNTIRFASRAKNV------------SMTVKRNEAEATHDKDELLHSLRRQ-----L 476

Query: 552 EHYQKLMNELDNHKTEADES 571
           +  Q L+ EL   +  AD+S
Sbjct: 477 DEQQDLICELRRAQPPADQS 496

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 77/148 (52%), Gaps = 20/148 (13%)

Query: 59  RCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKVFGPSANQ 118
           +CRG     I+LK S   T      S++ +I   +D+G         +  DKVF P  N 
Sbjct: 102 QCRGTISVSIRLKPSDTNTRSPWYASDDHTI-VHNDLG--------EFWFDKVFSPQTNN 152

Query: 119 QLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGIIPRILF 178
             +++E+ +P+     +GYN T+  YGMT +GKT+TM+G          + AG+I   + 
Sbjct: 153 YGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR--------DEAGLILLSVE 204

Query: 179 KLFDTL---EMNQEDYVVKCSFIELYNE 203
           ++F  +    +N + Y V+ S++E+YNE
Sbjct: 205 QIFSQIMKESVNNKSYEVRVSYLEIYNE 232

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 103/195 (52%), Gaps = 29/195 (14%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLY-K 398
           +DD+  G+ +  L +     ++E L  + KG K R+ + T+ N  SSRSH I  I L  K
Sbjct: 262 RDDSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISK 321

Query: 399 EHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNN-- 456
           + +     +  ++L DLAGSE   R    N+R KE   IN+SLL LG VI+ L+  NN  
Sbjct: 322 DIRTGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGS 378

Query: 457 -----------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSE 493
                                  HIP+R+SKLTRLLQ +L G++    + TI  A  +S 
Sbjct: 379 HHTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSS 438

Query: 494 ETCSTLEYASKAKNI 508
           ET +TL +AS++KN+
Sbjct: 439 ETLNTLRFASRSKNV 453

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (51%), Gaps = 12/102 (11%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +T D VF    +   I+ +  +PL    I+GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 166 LSESAGIIPRILFKLFDTL----EMNQEDYVVKCSFIELYNE 203
             E  G+IP  +  LF +L        E   V  S++E+YNE
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNE 226

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 91/154 (59%), Gaps = 16/154 (10%)

Query: 366 LLQKGLKYRQVASTKMNDFSSRSHTIFTITL-------YKEHQGTLFRLSKMNLVDLAGS 418
           +L++ LK R  A+T  N  SSRSH++F I L        ++  GTL      NLVDLAGS
Sbjct: 550 MLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEKSTGTL------NLVDLAGS 603

Query: 419 ENINRSGAINQRAKETGSINQSLLTLGRVINSLADRN---NHIPFRESKLTRLLQDSLGG 475
           E I+      +R +ET +IN+SL  LG VI++L   +    HIPFR SKLT LLQ SL G
Sbjct: 604 ERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLMG 663

Query: 476 NTKTALIATISPAKVTSEETCSTLEYASKAKNIK 509
           ++KT +   +SP   +  ET ++L +A+K  + K
Sbjct: 664 DSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 75/161 (46%), Gaps = 23/161 (14%)

Query: 48  EEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSK--T 105
           E +EL   + V CR R   E +  SS  + +     S+E  + +     IT + +SK   
Sbjct: 356 ELQELRGNIRVFCRLRPALENENYSSSSIEIEKF--SDETGMQS-----ITIKRDSKQHK 408

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +T D+ F        +F E+ + L    + GYN  +  YG T +GKT+TM          
Sbjct: 409 FTFDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM---------- 457

Query: 166 LSESAGIIPRILFKLFDTLEMNQE---DYVVKCSFIELYNE 203
           L+ + GIIP  L  +F  +E  +E    Y +   F+E+YNE
Sbjct: 458 LNPNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNE 498

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score =  100 bits (250), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 107/213 (50%), Gaps = 37/213 (17%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           +DD+  G+ +  L E    +++E L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296 RDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 400 H--QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSL-ADR-- 454
           +   GT  R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L AD+  
Sbjct: 356 NVKNGT-SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMN 411

Query: 455 ----------------------------NNHIPFRESKLTRLLQDSLGGNTKTALIATIS 486
                                       +NHIP+R+SKLTRLLQ +L G++    I T+ 
Sbjct: 412 SVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVD 471

Query: 487 PAKVTSEETCSTLEYASKAKNIKNKPQLGSIIS 519
                + ET +TL +AS+AKN+       SIIS
Sbjct: 472 TRNDAAAETMNTLRFASRAKNVALHVSKKSIIS 504

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (54%), Gaps = 12/102 (11%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D VF        +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 166 LSESAGIIPRILFKLFDTL---EMNQE-DYVVKCSFIELYNE 203
           L    G+IP  +  LF  +    MN +  + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNE 256

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 113/213 (53%), Gaps = 25/213 (11%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTI--FTITLY 397
           +DD+  G+ + +L E  +S+ ++ +  +  G + R+   T  N  SSRSH I    +T Y
Sbjct: 268 RDDSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRY 327

Query: 398 KEHQGTLFRLSKMNLVDLAGSENINRSGAINQ--RAKETGSINQSLLTLGRVINSLA--- 452
               G+    S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L+   
Sbjct: 328 DLKTGS-EATSTLSLCDLAGSER-----AVTQIVRRKEGAFINKSLLALGTVIAKLSMLG 381

Query: 453 ---------DRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 503
                        HIP+R+SKLTR+LQ +L G++    I TI     +S ET +T+ +AS
Sbjct: 382 SQANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFAS 441

Query: 504 KAKNIK---NKPQLGSIISKDILLKNITTELSQ 533
           +AKNI     K ++ S   KD +++N+  +L +
Sbjct: 442 RAKNIALNVRKNEMDSHAEKDTIIQNLRKQLDE 474

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (51%), Gaps = 12/102 (11%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D VF      Q ++  +  P+     +GYN T+  YGMT +GKT+TM+G++      
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNK------ 199

Query: 166 LSESAGIIPRILFKLFDTLEMNQED----YVVKCSFIELYNE 203
             +  G+IP+ +  +FD +          Y VK S++E+YNE
Sbjct: 200 --QEPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNE 239

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 102/202 (50%), Gaps = 37/202 (18%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           +DD+  G+ +  L E    + +E L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296 RDDSKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTST 355

Query: 400 --HQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSL-ADR-- 454
             + GT  R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L AD+  
Sbjct: 356 DVNNGT-SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTT 411

Query: 455 ----------------------------NNHIPFRESKLTRLLQDSLGGNTKTALIATIS 486
                                       +NHIP+R+SKLTRLLQ +L G++    I T+ 
Sbjct: 412 SVDSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVD 471

Query: 487 PAKVTSEETCSTLEYASKAKNI 508
                + ET +TL +AS+AKN+
Sbjct: 472 TRNDAAAETMNTLRFASRAKNV 493

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (51%), Gaps = 12/102 (11%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D VF        +++   +P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 166 LSESAGIIPRILFKLFDTLEMNQED----YVVKCSFIELYNE 203
           L    G+IP  +  LF  +     D    + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNE 256

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 102/208 (49%), Gaps = 43/208 (20%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           +DD+  G+ +  L E    ++++ L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296 RDDSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 400 --HQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSL-ADR-- 454
               GT  R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L AD+  
Sbjct: 356 DVRDGT-SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTN 411

Query: 455 ----------------------------------NNHIPFRESKLTRLLQDSLGGNTKTA 480
                                             +NHIP+R+SKLTRLLQ +L G++   
Sbjct: 412 SVGSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVT 471

Query: 481 LIATISPAKVTSEETCSTLEYASKAKNI 508
            I T+      + ET +TL +AS+AKN+
Sbjct: 472 TICTVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 61.6 bits (148), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 57/102 (55%), Gaps = 12/102 (11%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D VF        ++++ ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 166 LSESAGIIPRILFKLFDTL---EMNQE-DYVVKCSFIELYNE 203
           L    G+IP  +  LF  +    MN +  + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNE 256

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 111/216 (51%), Gaps = 27/216 (12%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           +DD+  G+ + +L E  + +  E +  +  G K R+   T  N  SSRSH I  + L + 
Sbjct: 269 RDDSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRC 328

Query: 400 HQGTLFRL-SKMNLVDLAGSENINRSGAINQ--RAKETGSINQSLLTLGRVINSL----- 451
              T   + S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L     
Sbjct: 329 ELKTGTEVTSTLSLCDLAGSER-----AVTQLVRRKEGAFINKSLLALGTVIAKLSANSA 383

Query: 452 -----------ADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 500
                      +    HIP+R+SKLTR+LQ +L G++    I TI     ++ ET +T+ 
Sbjct: 384 GSGSGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVR 443

Query: 501 YASKAKNIK---NKPQLGSIISKDILLKNITTELSQ 533
           +AS+AKNI     K ++ +   KD +++N+  +L +
Sbjct: 444 FASRAKNISLNVRKNEMDTSNEKDSIIQNLRKQLDE 479

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 13/103 (12%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D VF        ++  + +P+     +GYN T+  YGMT +GKT+TM+G +      
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTK------ 198

Query: 166 LSESAGIIPRILFKLFD-----TLEMNQEDYVVKCSFIELYNE 203
             +  G+IP  +  +FD     T +  +  Y VK S++E+YNE
Sbjct: 199 --QDPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNE 239

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 96/186 (51%), Gaps = 21/186 (11%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKE 399
           +DD   G+ +  + E     A+E +  +  G   R+   T  N  SSRSH I  + L   
Sbjct: 236 RDDPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITT 295

Query: 400 H--QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNN- 456
           +   GT    + ++L DLAGSE   ++    +R KE   IN+SLL LG VI+ L+  +N 
Sbjct: 296 NLLNGTTH-FNTLSLCDLAGSE---KASEQLERRKEGSFINKSLLALGTVISKLSAESNA 351

Query: 457 --------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 502
                         HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +A
Sbjct: 352 HDSSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFA 411

Query: 503 SKAKNI 508
           S+AKN+
Sbjct: 412 SRAKNV 417

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 6/105 (5%)

Query: 99  AQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGD 158
           A  +   +  D VFGP+A  + +F E+   L      G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG- 178

Query: 159 EKLYNGELSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNE 203
              +N  + +  G    +  ++ +  +  Q    V  S++E+YNE
Sbjct: 179 ---HNDGIVKMCGDC--VFTRMLNAADERQVKRSVTVSYLEIYNE 218

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 88/152 (57%), Gaps = 3/152 (1%)

Query: 357 ISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTL-FRLSKMNLVDL 415
           I+ + +   L++ G   R   ST MN+ SSRSH++F + +   ++ T      ++NLVDL
Sbjct: 518 IAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEHSTGRLNLVDL 577

Query: 416 AGSENINRSGAINQRA--KETGSINQSLLTLGRVINSLADRNNHIPFRESKLTRLLQDSL 473
           AGSE + +   I  +   KET SIN+SL  L  VI+S+  R  +IPFR SKLT LL++SL
Sbjct: 578 AGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSL 637

Query: 474 GGNTKTALIATISPAKVTSEETCSTLEYASKA 505
              +KT +   ISP   +  ET ++L  A K 
Sbjct: 638 INKSKTLMYVNISPNINSIRETINSLRLARKV 669

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 14/102 (13%)

Query: 105 TYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 164
            +T DK+FG   +   +FD++ + L    + GYN  +  YG T +GKTYTM         
Sbjct: 383 AFTFDKIFGMQDDNYEVFDDI-KNLVQSSLDGYNVCIFTYGQTGSGKTYTM--------- 432

Query: 165 ELSESAGIIPR---ILFKLFDTLEMNQEDYVVKCSFIELYNE 203
            L+E  GII +    +      L     +Y ++  FIE+YNE
Sbjct: 433 -LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNE 473

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 88/150 (58%), Gaps = 12/150 (8%)

Query: 364 LALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSKMNLVDLAGSENINR 423
           L L+ +G + R+V ST+ N  SSRSH +  + +  +  G+  R+  + L DLAGSE    
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI-TDSMGSKARV--LTLCDLAGSER--- 294

Query: 424 SGAINQRA--KETGSINQSLLTLG---RVINSLADRNNHIPFRESKLTRLLQDSLGGNTK 478
             +++ R    E G+IN+SL+ LG   R++N     + H+P+R+SKLTRLL+ SL GN  
Sbjct: 295 -ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGL 353

Query: 479 TALIATISPAKVTSEETCSTLEYASKAKNI 508
             ++ T+S +    E++  TL +A +A  +
Sbjct: 354 VTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 38.9 bits (89), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 18/87 (20%)

Query: 121 IFDEVAEPLF----LDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGIIPRI 176
           IF    +PL      D I G   T++ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIVQLS 170

Query: 177 LFKLFDTLEMNQEDYVVKCSFIELYNE 203
           +  L   L  N +   +  S++E+YNE
Sbjct: 171 IRDLLTQLSKNCQ---ITISYLEIYNE 194

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 129/268 (48%), Gaps = 48/268 (17%)

Query: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITL-YKE 399
           D   + I I+NL+  ++++  E L+  +KG   R +AS       SRS  I  IT+  ++
Sbjct: 183 DSKKSSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRD 232

Query: 400 HQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADR----- 454
           +   +F+     LVDL  S+ I++   +    + T  INQS++TL  V  SLA       
Sbjct: 233 NVKEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVK 292

Query: 455 -------NNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 507
                  N +IP++ES LT+LLQ+++GGN KT L+   S AK   EET +TL + +  K 
Sbjct: 293 NGRPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKL 352

Query: 508 IK-----NKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELD 562
           +K     NK    S    D+L+K+                +KE  Y  Q H Q L  EL 
Sbjct: 353 VKNLFQQNKAGTNSKAMLDLLMKDF--------------DAKEKNY--QSHIQLLEKELM 396

Query: 563 NHKTEADESKRIIERLSSQNALLLKDKR 590
           N K     S    E    QN ++L++K+
Sbjct: 397 NLKKLQYGS----ETADKQNEIMLENKK 420

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 21/110 (19%)

Query: 99  AQMNSKTYTVDKVFGPSANQQ-----LIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTY 153
           A  N K + VD++F P A  +     +I D VA+        GYN  ++ YG T +GKT 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQ-----LFNGYNVAIMAYGQTDSGKTS 118

Query: 154 TMTGDEKLYNGELSESAGIIPRILFKLFDTLEMNQE---DYVVKCSFIEL 200
           TM G    YN    +  G+I  +  ++F T+E   E   DY +  S IE+
Sbjct: 119 TMFG----YN----KGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEV 160

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 116/235 (49%), Gaps = 40/235 (17%)

Query: 328 PKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSR 387
           P+     +E   +DD   G+ I  L E    +++E    +Q G K R+ + T  N  SSR
Sbjct: 232 PRSSGGPVELRIRDDLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSR 291

Query: 388 SHTIFTITLYKEHQGTLFRL-----SKMNLVDLAGSENINRSGAINQ--RAKETGSINQS 440
           SH I  + L      T  R      S ++L DLAGSE      A++Q  R KE   IN+S
Sbjct: 292 SHAIVLVRL----NNTDLRSGETVSSTLSLCDLAGSEK-----AVSQYERRKEGAFINKS 342

Query: 441 LLTLGRVINSL------------------ADRNNHIPFRESKLTRLLQDSLGGNTKTALI 482
           LL LG VI+ L                   + N HIP+R+SKLTR+LQ +L GN+    I
Sbjct: 343 LLALGTVISKLSSESLSKNGPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTI 402

Query: 483 ATISPAKVTSEETCSTLEYASKAKN----IKNKPQL--GSIISKDILLKNITTEL 531
            TI      + ET +T+ +AS+AKN    +  +P +  GS   KD  ++N+T +L
Sbjct: 403 CTIDTRNEAASETVNTIRFASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQL 457

 Score = 68.2 bits (165), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (54%), Gaps = 12/102 (11%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +T D+VF  +     I++  + P+    ++G+N TV  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 166 LSESAGIIPRILFKLFD-TLEMNQED---YVVKCSFIELYNE 203
             + AG+IP  +  LF   LE +      Y V  S++E+YNE
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNE 205

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 102/212 (48%), Gaps = 35/212 (16%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYK- 398
           +DD   G+ +  L E    +++E L  +  G K R++  T  N  SSRSH I  I L   
Sbjct: 296 RDDTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTST 355

Query: 399 EHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSL-ADRNNH 457
           + +    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L AD+ N 
Sbjct: 356 DLESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINP 412

Query: 458 I------------------------------PFRESKLTRLLQDSLGGNTKTALIATISP 487
                                          P+R+SKLTRLLQ +L G++    I T+  
Sbjct: 413 TGSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDT 472

Query: 488 AKVTSEETCSTLEYASKAKNIKNKPQLGSIIS 519
               + ET +TL +AS+AKN+       SIIS
Sbjct: 473 RNDAAAETINTLRFASRAKNVALHVSKKSIIS 504

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (54%), Gaps = 12/102 (11%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  D VF        +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 166 LSESAGIIPRILFKLFDT---LEMNQE-DYVVKCSFIELYNE 203
           L    G+IP  +  LF     L MN +  + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNE 256

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 97/202 (48%), Gaps = 22/202 (10%)

Query: 345 NGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQ-GT 403
           NG  ++NL+   +   +E   L+   L  ++    + N+   RSHTI  +++ K ++   
Sbjct: 191 NGFQVENLRTTQVLTLEELKILINICLLNQK---ERHNNLIQRSHTIMEVSIEKRNKLDE 247

Query: 404 LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRN-------- 455
              +S + +VDLAGS+ I ++ +     ++   IN  + ++  VIN L   N        
Sbjct: 248 SITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTD 307

Query: 456 -----NHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 510
                + +P++ S LTRLL D LGGN KT  + T S  K    ET STL++    K+   
Sbjct: 308 ISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANT 367

Query: 511 KPQ-----LGSIISKDILLKNI 527
            P+     L S  + DI L ++
Sbjct: 368 NPRINRFGLNSKATMDIFLTDM 389

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 65/125 (52%), Gaps = 19/125 (15%)

Query: 88  SINTTDD--VGITA-QMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVY 144
           SIN TD    G +  Q+ +  Y  DKVF  S +  +   E  E      ++GYN +++ Y
Sbjct: 52  SINFTDTQLTGFSKDQVVNTQYKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTY 110

Query: 145 GMTSTGKTYTMTGDEKLYNGELSESAGIIPRILFKLFDTL--EMNQED----YVVKCSFI 198
           G + TGK++ + G+++          G+I ++L KLF+ +  EM   +    Y VK SF+
Sbjct: 111 GQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFL 161

Query: 199 ELYNE 203
           E+Y E
Sbjct: 162 EVYQE 166

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 12/123 (9%)

Query: 85  NEVSINTTDDVGITAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVY 144
           N V   T + +  T +    T+  DKVF  +A Q+ +   +  P+  D + GYN TV+ Y
Sbjct: 54  NTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITY 113

Query: 145 GMTSTGKTYTMTGDEKLYNGELSESAGIIPRILFKLFDTLEMNQE----DYVVKCSFIEL 200
           G + +GK+Y++ G +        ES GI+P I   LFDTLE N+E     + V     E+
Sbjct: 114 GPSFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEI 165

Query: 201 YNE 203
           Y E
Sbjct: 166 YME 168

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 386 SRSHTIFTITL-YKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTL 444
           SRSH +F + +  +  +  + + S + LVDL G+E  ++             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 445 GRVINSL----------ADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 494
              + SL          A  ++   +RES+LT +L+DSLGGN KT +I T   + V +  
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 350

Query: 495 TCSTLEYASKAKNIKNK 511
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGDSIRQINNK 367

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 96/187 (51%), Gaps = 26/187 (13%)

Query: 346 GIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLF 405
           G+ + NL++ H+++ KE L    + +    V ++K ++   R++TIF I + K     L 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEK-----LD 259

Query: 406 RL------SKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRN---- 455
           +L      S + LVDLAGS+ I+R  +    +++   IN S+ ++  +I SL+  +    
Sbjct: 260 KLDESTTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDY 319

Query: 456 --------NHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 507
                   N +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++
Sbjct: 320 KNYEFSLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQD 379

Query: 508 IKNKPQL 514
            K  PQ+
Sbjct: 380 SKTVPQI 386

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 55/104 (52%), Gaps = 14/104 (13%)

Query: 105 TYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 164
           ++    +F   +N  LI + +   +  + ++GYN  ++ YG   +GKTY+      LY  
Sbjct: 83  SFEFTHIFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGN 136

Query: 165 ELSESAGIIPRILFK-LFDTLEMNQED------YVVKCSFIELY 201
           ++ +S G + +I+FK LF  +  +  D      ++VK SF+E++
Sbjct: 137 DVDDSFG-LGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVW 179

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 57/103 (55%), Gaps = 12/103 (11%)

Query: 105 TYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 164
           T+  DKVF  +A Q+ + D +  P   D + GYN T+L YG + +GK+Y++ G +  YN 
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN- 130

Query: 165 ELSESAGIIPRILFKLFDTLEMNQE----DYVVKCSFIELYNE 203
                 G++P I   LF+TLE N+E    ++ V     E+Y E
Sbjct: 131 -----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYME 168

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 13/137 (9%)

Query: 386 SRSHTIFTITL-YKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTL 444
           S+SH +F + +  +  +  + + S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 445 GRVINSLADRN----------NHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 494
             ++  LA +N          +   +RES+LT +L+DSLGGN K  +I T   + V +  
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT-- 350

Query: 495 TCSTLEYASKAKNIKNK 511
           T STLE+    + I NK
Sbjct: 351 TISTLEFGDNIRQIINK 367

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 78/164 (47%), Gaps = 29/164 (17%)

Query: 48  EEEELNITVAVRCRGR----NEREIKLKSSVIVTVPDING-SNEVSINTTDDVGITAQMN 102
           E +EL   + V CR R    NE+E    SS I     I+G S+E   N T  + I  +  
Sbjct: 355 ELQELRGNIRVFCRLRPHLDNEKE---DSSSI----SIDGFSDE---NGTQCITIKREAK 404

Query: 103 SKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 162
              +T D+ FG   + + IF E+ + L    + GYN  +  YG T +GKTYTM       
Sbjct: 405 YHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------- 456

Query: 163 NGELSESAGIIPRILFKLFDTLEMNQE---DYVVKCSFIELYNE 203
              L+   GIIP  L  +F  +E  +E    Y +   FIE+YNE
Sbjct: 457 ---LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNE 497

 Score = 35.4 bits (80), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITL 396
            D ++   +I N+    ++N +   ++L + +K R  A+T  N  SSRSH++F I L
Sbjct: 523 HDSDSQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 78/164 (47%), Gaps = 29/164 (17%)

Query: 48  EEEELNITVAVRCRGR----NEREIKLKSSVIVTVPDING-SNEVSINTTDDVGITAQMN 102
           E +EL   + V CR R    NE+E    SS I     I+G S+E   N T  + I  +  
Sbjct: 355 ELQELRGNIRVFCRLRPHLDNEKE---DSSSI----SIDGFSDE---NGTQCITIKREAK 404

Query: 103 SKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 162
              +T D+ FG   + + IF E+ + L    + GYN  +  YG T +GKTYTM       
Sbjct: 405 YHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------- 456

Query: 163 NGELSESAGIIPRILFKLFDTLEMNQE---DYVVKCSFIELYNE 203
              L+   GIIP  L  +F  +E  +E    Y +   FIE+YNE
Sbjct: 457 ---LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNE 497

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 340 QDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITL 396
            D ++   +I N+    ++N +   ++L + +K R  A+T  N  SSRSH++F I L
Sbjct: 523 HDSDSQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 49/85 (57%), Gaps = 8/85 (9%)

Query: 105 TYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 164
           T+  DKVF  +A Q+ + D +  P   D + GYN T++ YG + +GK+Y++ G +     
Sbjct: 74  TFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQ----- 128

Query: 165 ELSESAGIIPRILFKLFDTLEMNQE 189
              E  GI+P I   LF+TLE N+E
Sbjct: 129 ---EGEGILPNICKVLFETLEKNKE 150

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 74/137 (54%), Gaps = 13/137 (9%)

Query: 386 SRSHTIFTITLYKEHQ-GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTL 444
           S+SH +F + + + ++   + R S + L+DL G+E  ++   +         +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 445 GRVIN--SLADRNNHIP--------FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 494
             ++   S+ DR++           +RES+LT +L+DSLGGN KT +I T   + V++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 495 TCSTLEYASKAKNIKNK 511
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 12/103 (11%)

Query: 105 TYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 164
           T+  DKVF  +A Q+ + D + +P   D + GYN T+L YG + +GK+Y++ G +     
Sbjct: 75  TFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQ----- 129

Query: 165 ELSESAGIIPRILFKLFDTLEMNQE----DYVVKCSFIELYNE 203
              +  GI+P I   LF TLE  ++    ++ V     E+Y E
Sbjct: 130 ---DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYME 169

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 386 SRSHTIFTITL-YKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTL 444
           SRSH +F + +  +  +  + + S + L+DL G+E  ++             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 445 GRVINSL----------ADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 494
              + SL          A  ++   +RES+LT +L+DSLGGN KT +I T   + V +  
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 495 TCSTLEYASKAKNIKNK 511
           T STL++    + I N+
Sbjct: 352 TLSTLKFGDSIRQINNR 368

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 84/171 (49%), Gaps = 22/171 (12%)

Query: 343 NNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITL---YKE 399
           NN+ + I+NL++ ++ + +E  + L +G   R      M   +SRS+ +  I L   + E
Sbjct: 233 NNSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLE 287

Query: 400 HQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIP 459
            Q  L + S + L+D+A S+ I+++ ++   AKE   +N  + +    IN LA+     P
Sbjct: 288 DQ--LMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS-P 344

Query: 460 FRE-----------SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 499
           + +           S L  ++   +GGN KT  I+TISP      ET  TL
Sbjct: 345 YDQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 106 YTVDKVFGPSANQQ-LIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 161
           + VDKVF     Q  L+  ++ +    +   G+N +++ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 97/194 (50%), Gaps = 23/194 (11%)

Query: 334 SLETPPQDDNNNGI----YIQNLQEFHISNAKEGLALLQKGLKYR-QVASTKMNDFSS-- 386
           SL+    D   NGI    +++NL    I++  +    LQK  K   Q +S  +N  ++  
Sbjct: 187 SLKVHQHDIIENGIKGDKHVKNLSHIQIASLDD----LQKWFKIGCQRSSAIINAGTAKE 242

Query: 387 -RSHTIFTITLYKEH---QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLL 442
            RS++I    ++ E    +  L++LS ++ +DL G +   +   I     E   +N  + 
Sbjct: 243 KRSNSIIISKIHLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMS 301

Query: 443 TLGRVINSLADRNNHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKVTSEETC 496
           +   +I +L+D  + +P+     ++S L ++LQD +GGN+KT  I    SP+ +  EE  
Sbjct: 302 SFQNLITTLSDPKS-LPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELI 360

Query: 497 STLEYASKAKNIKN 510
             L++A   K+IKN
Sbjct: 361 EMLKFAMGLKSIKN 374

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 85/175 (48%), Gaps = 10/175 (5%)

Query: 345 NGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTL 404
           +G +I++L + H+++  E    L+ G  Y+ ++   ++   S+    F +    + +  +
Sbjct: 195 HGDHIRDLHQIHVTSPIEIKDTLKNG--YKNISP--LHHSKSQIFVRFEVQCI-DRKDDV 249

Query: 405 FRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADR--NNHIPFRE 462
            R S +  +DL GS+ + +  A    + +    NQ +  L  +I +L +    N   F++
Sbjct: 250 TRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSHFKD 309

Query: 463 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSI 517
           S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P +  I
Sbjct: 310 SSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKI 361

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           Y  D +F   + +   +D + + L  D  KGYN T++ YG TS+GK++ + GD    N  
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 166 LSESAGIIPRILF 178
           L     I  R+LF
Sbjct: 146 LINH--IADRLLF 156

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 96/203 (47%), Gaps = 16/203 (7%)

Query: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEH 400
           D   + + ++ L+   +++  E LA + +G   R  + +      SRS     IT+ + +
Sbjct: 181 DTKTHTLSVKGLRTVSVNSVYELLAYINEGHLRRCHSDSHYR--KSRSSAFLNITVEQRN 238

Query: 401 QGT-LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLAD-----R 454
           +     + S + L+DLA S+ ++++   +    E  S N S+  L +V+  L++      
Sbjct: 239 KKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNLHQVVYGLSELESPSS 298

Query: 455 NNHIP---FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 511
            NH      R S+L + LQ ++GG++KT  +   S  K   E T  TL   S+ ++I N 
Sbjct: 299 KNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTVITLSLGSRLRSIHNF 358

Query: 512 P-----QLGSIISKDILLKNITT 529
           P      L S    D+ LKN++T
Sbjct: 359 PVQNKMGLNSKALLDLRLKNMST 381

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 51/102 (50%), Gaps = 12/102 (11%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           +  +KV+     QQ + +++     ++ + G+N +++ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGND------ 121

Query: 166 LSESAGIIPRILFKLFDTLEMNQED----YVVKCSFIELYNE 203
                GI+ R+   +FD L+   ED      +  +F EL+ E
Sbjct: 122 --HEEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAE 161

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 104 KTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 163
           +T+++DKVF PSA+Q  +   +  P+  +   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 164 GELSESAGIIPRILFKLFDTLEMNQEDYV-VKCSFIELYNE 203
                S G++ RIL K+F  +  N+   V    S +EL N+
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVND 135

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 87/188 (46%), Gaps = 25/188 (13%)

Query: 346 GIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTIT---LYKEHQG 402
           G+Y Q     +I++ KE   +++     ++ +  KM+   S SH +   +   L + H G
Sbjct: 205 GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRVH-G 263

Query: 403 TLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLAD--RNNH--- 457
           T+   S +   DL GS    +        +    +N S+  L  V+NS+    + NH   
Sbjct: 264 TITS-SNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYI 322

Query: 458 ---------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 502
                          +P+++S+LT L+Q++LGGN++T ++      K   EET +TL + 
Sbjct: 323 ENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFG 382

Query: 503 SKAKNIKN 510
            + +NI N
Sbjct: 383 VQLQNILN 390

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 8/84 (9%)

Query: 90  NTTDDVGITAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTST 149
           NT     IT   +   +  +KV+        I   ++E +  D   GY+ +++ YG   +
Sbjct: 71  NTIIHYPITNFADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGS 130

Query: 150 GKTYTMTGDEKLYNGELSESAGII 173
           GK++T+ G+E        +S GII
Sbjct: 131 GKSFTLFGNE--------DSDGII 146

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 5/133 (3%)

Query: 387 RSHTIFTITLYK-EHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLG 445
           RS TI  I L + +    L   S +  VDLAGS+  ++        +     N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 446 RVINSLADRN----NHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEY 501
            ++ +LA+      N   +R S LTR+L D L GN KT LI + S  K    ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 502 ASKAKNIKNKPQL 514
           +S A ++ N+ ++
Sbjct: 385 SSYASSMSNQIKI 397

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 28/55 (50%)

Query: 103 SKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTG 157
           S  Y  DK+F P      I   ++     D  KGYN T + YG T TGKTYT+ G
Sbjct: 55  SNQYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQTGTGKTYTLYG 109

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 81/178 (45%), Gaps = 26/178 (14%)

Query: 386 SRSHTIFTITLYKEHQGT-LFRLSKMNLVDLAGSENINRSG--AINQRAKETGSINQSLL 442
           S+SH I  I + + +    + +   ++  DLA  + I++    ++   + E   +N    
Sbjct: 219 SKSHLITKINVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLEST 278

Query: 443 TLGRVINSLADR----NNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCST 498
           TL   I S+++     N  IP++ S LT+LL     GN KT +I T S  K    ET  T
Sbjct: 279 TLKNSIISMSELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLET 338

Query: 499 LEYASKAKNIK-----NKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQ 551
           L+   K ++I      NK  L S    D++++++              KSKE  YM++
Sbjct: 339 LKMGLKLESISSNVHMNKHALNSKKKLDLIVEDM--------------KSKEANYMNR 382

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 44/100 (44%), Gaps = 11/100 (11%)

Query: 106 YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165
           Y  D V   S     +++ +   L  +  +GY+  V+ YG   TGK+    G +  Y G 
Sbjct: 63  YQFDSVHEKSTE---LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG- 118

Query: 166 LSESAGIIPRILFKLFDTLEM--NQEDYVVKCSFIELYNE 203
                G++   +  L+D ++   N   + V  S IE++ E
Sbjct: 119 -----GVVLMFVQDLYDKIDSIGNDTHFTVSLSTIEIHLE 153

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 38.9 bits (89), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 14/63 (22%)

Query: 127 EPLFLDFI----KGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAGIIPRILFKLFD 182
           EPL +D I    +G +C+++ YG ++TGKT+ +            +  GIIP  + +L+ 
Sbjct: 66  EPLVIDNINELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFIEQLYI 115

Query: 183 TLE 185
            LE
Sbjct: 116 YLE 118

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 67/153 (43%), Gaps = 30/153 (19%)

Query: 369 KGLKYRQVAS-TKMNDF--------SSRSHTIFTITL--YKEHQGTLFRLSKMNLVDLAG 417
           KGLK   V+S  ++ D+        +S  HT   I+L     H+ + FR   +  VDL  
Sbjct: 166 KGLKEVFVSSRCELQDYLNAACDLQNSTFHTFVKISLQLVNCHEDS-FRKCCIEFVDLCA 224

Query: 418 SENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTRLLQDSLGGNT 477
            E++                 Q + +L  V+++  D +  I   +S+  +LL +S+GGN 
Sbjct: 225 QEDVL----------------QLVCSLVAVLSN--DNDKKIGKEKSQFCKLLSNSIGGNR 266

Query: 478 KTALIATISPAKVTSEETCSTLEYASKAKNIKN 510
           KT  I   S  +   + +  TLE+  K   + N
Sbjct: 267 KTTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 54/117 (46%), Gaps = 6/117 (5%)

Query: 89  INTTDDVGITAQMNSKTYTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTS 148
           + T +D  +  ++  ++++  KV    A +   F E+A  +  D + G NC V  YG   
Sbjct: 75  VQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGL 132

Query: 149 TGKTYTMTGDEKLYNGELSES---AGIIPRILFKLFDTLEMNQ-EDYVVKCSFIELY 201
              +  M G +   + E  +S   +G++ +    +F+ ++ +   +Y V  S  E+Y
Sbjct: 133 AADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVY 189

>Skud_12.142 Chr12 complement(270459..271190,271280..271282) [735
           bp, 244 aa] {ON} YLR078C (REAL)
          Length = 244

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 49/89 (55%), Gaps = 8/89 (8%)

Query: 722 IEGFLKQTPENFKKIGEDIN--DINIKIQNHHAAVAQNLSDISEEYNNLKQYLNEN---- 775
           +E  +KQ  E+ K+  ED N  +I+ K  N  A + Q+L D +  + +LKQ  NE+    
Sbjct: 44  LEKTIKQYAEHLKRYKEDTNAEEIDPKFANRLATLTQDLDDFTSRFKDLKQSYNESNSRT 103

Query: 776 -LFQNNHEDLINA-HINSTSQTLTNSADV 802
            LF +    ++++ +  STS+T+ N  +V
Sbjct: 104 QLFGSGASHVMDSDNPFSTSETIMNKRNV 132

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 4/104 (3%)

Query: 695 NLDMIQNEVIKMLGTTQEKAEKT---YKQFIEGFLKQTPENFKKIGEDINDINIKIQNHH 751
           N D++ + VI ++      A +    YK    GF K       K+ +  N+I + I  HH
Sbjct: 5   NPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSIDEHH 64

Query: 752 AAVAQNLSDISEEYNNLKQYLNENLFQNNHE-DLINAHINSTSQ 794
            +      DIS+ +NN    ++  L  ++H  D +N  INS S+
Sbjct: 65  ESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSR 108

>YLR078C Chr12 complement(285736..286467,286557..286559) [735 bp,
           244 aa] {ON}  BOS1v-SNARE (vesicle specific SNAP
           receptor), localized to the endoplasmic reticulum
           membrane and necessary for vesicular transport from the
           ER to the Golgi
          Length = 244

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 49/89 (55%), Gaps = 8/89 (8%)

Query: 722 IEGFLKQTPENFKKIGEDIN--DINIKIQNHHAAVAQNLSDISEEYNNLKQYLNEN---- 775
           +E  +KQ  E+  +  ED N  +I+ K  N  A + Q+L D + ++ +LKQ  NEN    
Sbjct: 44  LEKTVKQYAEHLNRYKEDTNAEEIDPKFANRLATLTQDLHDFTAKFKDLKQSYNENNSRT 103

Query: 776 -LFQNNHEDLINA-HINSTSQTLTNSADV 802
            LF +    ++++ +  STS+T+ N  +V
Sbjct: 104 QLFGSGASHVMDSDNPFSTSETIMNKRNV 132

>ZYRO0B11220g Chr2 (886235..888502) [2268 bp, 755 aa] {ON} similar
           to uniprot|P40094 Saccharomyces cerevisiae YER157W COG3
           Essential component of the conserved oligomeric Golgi
           complex (Cog1p through Cog8p) a cytosolic tethering
           complex that functions in protein trafficking to mediate
           fusion of transport vesicles to Golgi compartments
          Length = 755

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 50/120 (41%), Gaps = 20/120 (16%)

Query: 864 GFQKEVTDG-----------LSYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKN 912
            F K VT+G           LS  R  +   +N + D  T L T        +     KN
Sbjct: 585 SFFKSVTEGARTLRFRDSSVLSLARGLVPKVVNNLVDARTELMTHFRNIIKDFTEAAAKN 644

Query: 913 VVEDNQIIRTQ--FNELARKNSIFQDNVENSLKCAVASVNN-------LNHLEDSIKMAV 963
           ++ED  +I ++   + L  KN+  + NVE+ L    A + N       + HL D+++  V
Sbjct: 645 IIEDTLVIDSKEDLSSLVEKNARLRQNVEDKLPRIHAQICNFINDEVIVAHLMDAVQETV 704

>YKR054C Chr11 complement(535647..547925) [12279 bp, 4092 aa] {ON}
            DYN1Cytoplasmic heavy chain dynein, microtubule motor
            protein, required for anaphase spindle elongation;
            involved in spindle assembly, chromosome movement, and
            spindle orientation during cell division, targeted to
            microtubule tips by Pac1p
          Length = 4092

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 704  IKMLGTTQEKAEKTYKQFIEGF--LKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDI 761
            IK+LG+      K   +F   F  + Q   +F  + + ++ +  ++Q H   +A++L + 
Sbjct: 1094 IKLLGSVMRALTKLKVRFPSHFVYIDQLDNDFSSLRQSLSYVEQELQKHRVVIAKSLEEG 1153

Query: 762  SEEYNNLKQYLNEN 775
             E  NNL Q LNE+
Sbjct: 1154 VENINNLSQSLNES 1167

>TPHA0C00260 Chr3 complement(40434..41582) [1149 bp, 382 aa] {ON}
           Anc_5.638 YDR273W
          Length = 382

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 712 EKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEYNNLKQY 771
           ++ + ++ QF+E   K  PE      + I +   K+ N    V +NLS++S+EY N   Y
Sbjct: 202 DEGDDSWSQFLE---KDLPEIKDMANKQIQETAQKLNNWFGGVKKNLSNMSDEYGNPDSY 258

Query: 772 LNENL 776
            +E++
Sbjct: 259 YDEDV 263

>Skud_7.70 Chr7 complement(122463..125522) [3060 bp, 1019 aa] {ON}
           YGL201C (REAL)
          Length = 1019

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 18/91 (19%)

Query: 701 NEVIKMLGTTQEKAEKTYKQFIEGFLKQTPEN------------FKKIGEDINDINIKIQ 748
           N V K+   T EK  + ++QF+E F  Q+P+             F KI  D+N I I  Q
Sbjct: 98  NHVKKVDDVTGEKVREAFEQFLEDFSVQSPDTDEIEKVYRAQIEFMKI-YDLNTIYIDYQ 156

Query: 749 NHHAAVAQNLS---DISEEYNNLKQYLNENL 776
             H ++ +N +    ISE+Y     +L++ L
Sbjct: 157 --HLSIRENGALAMAISEQYYRFLPFLHKGL 185

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] {ON}
            similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 71/142 (50%), Gaps = 7/142 (4%)

Query: 524  LKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNA 583
            L +I  E+ +++S L+  K  E +  S+   QKL +EL+  K+  D+ ++ IE L   N 
Sbjct: 884  LLDIDDEIRELESLLM--KKNEQLSNSELELQKLTHELNKFKSSTDKIEQRIESLLEDNR 941

Query: 584  LLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQM---LVSSVSKLQTSCDT 640
             L       N +N+ + I L +++   N LQEK   Q  K ++   ++S +  ++     
Sbjct: 942  WLNDKGLVLNIINQNEGINLEEYRQRGNQLQEK--FQGMKRKVNPNIMSMIENVEKKETA 999

Query: 641  FKKMIENYECQQIDVKSKIEQI 662
             K MI+  E  +  ++  IE++
Sbjct: 1000 LKTMIKTIEKDKTKIQETIEKL 1021

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 56/127 (44%), Gaps = 15/127 (11%)

Query: 362 EGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRL---------SKMNL 412
           + + LL    K   V S  +N     S T   + L +  Q   F           S+  +
Sbjct: 372 DAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTNSEFTI 431

Query: 413 VDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHI---PFRESKLTRLL 469
           VD+ G++++ +S  +  +  E   +N SLLTLG+ IN+L      I   P  E  + R L
Sbjct: 432 VDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLAEFLIRRAL 488

Query: 470 QDSLGGN 476
           ++S  GN
Sbjct: 489 KNSRLGN 495

>KAFR0D01930 Chr4 complement(389972..392086) [2115 bp, 704 aa] {ON}
           Anc_5.39 YGR266W
          Length = 704

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 13/102 (12%)

Query: 765 YNNLKQYLNENLFQNNHEDLI---NAHINSTSQTLTN-SADVLFNTFK-----DMMNKHL 815
           Y  + +Y  +  FQ  +   I   N + NS + +    S  V   TFK     D++ KH 
Sbjct: 123 YEQMVKYEIDGKFQPQYRFFIPADNTNFNSIAYSCNGFSLSVNTTTFKGSLWYDILRKHT 182

Query: 816 ESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQ 857
           + + N+ML       D++ +  ++L+  + KKW E+ DL+ +
Sbjct: 183 KIHYNVML----GGGDQIYSDSIKLYSAKVKKWAETKDLVKK 220

>Smik_11.316 Chr11 complement(525589..537861) [12273 bp, 4090 aa] {ON}
            YKR054C (REAL)
          Length = 4090

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 704  IKMLGTTQEKAEKTYKQFIEGF--LKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDI 761
            IK+LG+  +   +   +F   F  ++Q   +F  + E +  +  ++QNH   +AQ L   
Sbjct: 1094 IKLLGSVIKLLRRLKVKFSSHFVYIEQLDTDFCSLRECLCYVEQEVQNHRVVIAQKLEQE 1153

Query: 762  SEEYNNLKQYLNEN 775
             +  N+L Q LNE+
Sbjct: 1154 VKNINDLSQSLNES 1167

>Smik_12.137 Chr12 complement(265551..266252,266370..266372) [705
           bp, 234 aa] {ON} YLR078C (REAL)
          Length = 234

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 722 IEGFLKQTPENFKKIGEDIN--DINIKIQNHHAAVAQNLSDISEEYNNLKQYLNEN 775
           +E  +KQ  E+  +  ED N  +I+ K  N  A + Q+L D + ++ +LKQ  NE+
Sbjct: 34  LEKTVKQYAEHLNRYKEDTNTGEIDPKFANRLATLTQDLQDFNIKFKSLKQSYNES 89

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.127    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 108,943,678
Number of extensions: 5106043
Number of successful extensions: 38038
Number of sequences better than 10.0: 1069
Number of HSP's gapped: 37972
Number of HSP's successfully gapped: 1483
Length of query: 1069
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 949
Effective length of database: 39,721,479
Effective search space: 37695683571
Effective search space used: 37695683571
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)