Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0D008606.17ON66666629800.0
NCAS0H008706.17ON61266915060.0
ZYRO0C07876g6.17ON68171012611e-165
Kpol_1045.726.17ON69571011861e-153
TDEL0G045206.17ON67952011791e-152
TPHA0J003106.17ON67569311371e-146
CAGL0L13288g6.17ON64669811221e-144
Kwal_56.224116.17ON68972811161e-143
SAKL0E01100g6.17ON71053811111e-142
TBLA0G010106.17ON71051211011e-140
KLLA0D01067g6.17ON66071610711e-137
ACR009W6.17ON68051110161e-128
KNAG0M011406.17ON5944528161e-99
KAFR0L003806.17ON5404437588e-92
Suva_5.56.17ON6194557343e-87
Skud_5.276.17ON6154617142e-84
YEL062W (NPR2)6.17ON6154557142e-84
Smik_5.256.17ON6154557081e-83
Ecym_30216.17ON6745036526e-75
KLTH0C11308g6.17ON6905026194e-70
ZYRO0C06732g5.593ON218127870.043
NCAS0D044606.323ON51346752.0
ZYRO0F04554g8.97ON45949716.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0D00860
         (666 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...  1152   0.0  
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   584   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   490   e-165
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   461   e-153
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   458   e-152
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   442   e-146
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   436   e-144
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   434   e-143
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   432   e-142
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   428   e-140
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   417   e-137
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   395   e-128
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   318   1e-99
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   296   8e-92
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    287   3e-87
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   279   2e-84
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   279   2e-84
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   277   1e-83
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   255   6e-75
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   243   4e-70
ZYRO0C06732g Chr3 (505681..506337) [657 bp, 218 aa] {ON} similar...    38   0.043
NCAS0D04460 Chr4 (847921..849462) [1542 bp, 513 aa] {ON} Anc_6.3...    33   2.0  
ZYRO0F04554g Chr6 complement(382457..383836) [1380 bp, 459 aa] {...    32   6.0  

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score = 1152 bits (2980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/666 (86%), Positives = 576/666 (86%)

Query: 1   MHNISNLNSINHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIP 60
           MHNISNLNSINHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIP
Sbjct: 1   MHNISNLNSINHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIP 60

Query: 61  KKQLCNKLLTFKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLG 120
           KKQLCNKLLTFKYANYRIVSYPITINSDFYAR           PYDCETSPYEPAIARLG
Sbjct: 61  KKQLCNKLLTFKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLG 120

Query: 121 KMFKVLEEQNQILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFST 180
           KMFKVLEEQNQILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFST
Sbjct: 121 KMFKVLEEQNQILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFST 180

Query: 181 RQQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIEQYLNNNSRISVQDLIMRIYQDL 240
           RQQR                               TIEQYLNNNSRISVQDLIMRIYQDL
Sbjct: 181 RQQRSNSNRILEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSRISVQDLIMRIYQDL 240

Query: 241 NNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLI 300
           NNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLI
Sbjct: 241 NNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLI 300

Query: 301 PFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTD 360
           PFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTD
Sbjct: 301 PFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTD 360

Query: 361 PNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNG 420
           PNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNG
Sbjct: 361 PNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNG 420

Query: 421 RSSFSADDRKQSETXXXXXXXXXXXXXXXTAHLPTKMSLFELYRSLNQRTDLKNWYKLNY 480
           RSSFSADDRKQSET               TAHLPTKMSLFELYRSLNQRTDLKNWYKLNY
Sbjct: 421 RSSFSADDRKQSETSLNSSNDPSNSNLISTAHLPTKMSLFELYRSLNQRTDLKNWYKLNY 480

Query: 481 TTIIENNXXXXXXXXXXXXXXXXYRCHSYPIVITPVVSAPESAKXXXXXXXXXXXXXXXX 540
           TTIIENN                YRCHSYPIVITPVVSAPESAK                
Sbjct: 481 TTIIENNIDIRKFIKFGIIKGLIYRCHSYPIVITPVVSAPESAKSTSPFVSSSGISSSVD 540

Query: 541 XKQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSFYEKLEKGKNHSKVSFSDKIAFQND 600
            KQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSFYEKLEKGKNHSKVSFSDKIAFQND
Sbjct: 541 SKQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSFYEKLEKGKNHSKVSFSDKIAFQND 600

Query: 601 ENDHSATSSDNDDKSKSQLTLKQRNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGD 660
           ENDHSATSSDNDDKSKSQLTLKQRNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGD
Sbjct: 601 ENDHSATSSDNDDKSKSQLTLKQRNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGD 660

Query: 661 YKVINC 666
           YKVINC
Sbjct: 661 YKVINC 666

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/669 (50%), Positives = 419/669 (62%), Gaps = 67/669 (10%)

Query: 5   SNLNSINHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQL 64
           SNLN++NHFEGFMPIHTIFYSIFHPTEGTKV YEFPP NL+   I+FD IKNYIIPK QL
Sbjct: 4   SNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQL 63

Query: 65  CNKLLTFKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFK 124
           CN+LLTFKY NYRIVSYPITIN+ +YAR           PY+CETSPYEP+IARLGKMFK
Sbjct: 64  CNRLLTFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFK 123

Query: 125 VLEEQNQILSKAENDPIYFKSDYTPYQPTL-IIPTNNDNDGKRNKKLMKKENTIFSTRQQ 183
           +LEEQ+QILSKAENDPIYFKSDY P +PT  IIP    +   RNK+     +    +R +
Sbjct: 124 ILEEQSQILSKAENDPIYFKSDYVPTEPTTTIIP--QISPSHRNKRNNDHNDNNDGSRFE 181

Query: 184 RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIEQYLNNNSRISVQDLIMRIYQDLNNY 243
                                              +  +  ++ SVQDLIMRIYQDLNNY
Sbjct: 182 ------------------------------TDFFGEEEDGVTKFSVQDLIMRIYQDLNNY 211

Query: 244 SECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFI 303
           SECLIPID GN+++IK+FPLLKPPP + +S+EDVPMSL++L  + DVNWDPTML ++P+I
Sbjct: 212 SECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYI 271

Query: 304 NGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNM 363
           NG+NDISKI+KL+ + P+LVIECIKHL+YYNCVIITDIFQFSN Y+ TSLI +FLTD  M
Sbjct: 272 NGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEM 331

Query: 364 ATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNGRSS 423
           AT CQNYVVLP+GSKL+ LPF  E   + Q S+       +H +T S  SS++ +     
Sbjct: 332 ATQCQNYVVLPIGSKLSHLPF--ENNGNKQPSTP------KHSRTTSLSSSMSGSVNSHE 383

Query: 424 FS-ADDRKQSETXXXXXXXXXXXXXXXTAHLPTKMSLFELYRSLNQRTDLKNWYKLNYTT 482
            S  D  ++SET                AHLPTK  LF+LYRSL+    L++WY+ N T 
Sbjct: 384 HSYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATI 443

Query: 483 IIENNXXXXXXXXXXXXXXXXYRCHSYPIVITPVVSAPESAKXXXXXXXXXXXXXXXXXK 542
           I ENN                YRCHSYPI        P+                     
Sbjct: 444 ITENNVDVRKFIKFGIIRGLIYRCHSYPI--------PQRPSNEGIQRIERLNDIDAHRL 495

Query: 543 QHTQKGPISRFPGLGSHVPSSGVR----DTRDKLMKSFYEKLEKGKNHSKVSFSDKIAFQ 598
           Q    G  +R         S+       D  D+L+K+ Y+KLE+   HSKVSF DK    
Sbjct: 496 QIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNVYKKLER---HSKVSFMDK---- 548

Query: 599 NDENDHSATSSDNDDKSK-SQLTLKQRNILLDSISNMDNMDKICVKLGRPRSQIEEWLSE 657
            ++N+   T    D+K + S +T ++R++LL SI +++N+DKICVKLG+ R Q+E WL E
Sbjct: 549 -EKNESMKT----DEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERWLDE 603

Query: 658 FGDYKVINC 666
            G+YK+I C
Sbjct: 604 LGNYKIITC 612

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  490 bits (1261), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 291/710 (40%), Positives = 388/710 (54%), Gaps = 101/710 (14%)

Query: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70
           + FEGF+PIHT+FY++FHPT+GT+VRYE+PP NL  ++I+FDAIKNYIIPK QLC+KLLT
Sbjct: 17  DQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKLLT 76

Query: 71  FKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQN 130
            KY  YRIV YP+T+NS +YAR           PYDCETS YEPAIARLGKMF+VLEEQN
Sbjct: 77  LKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEEQN 136

Query: 131 QILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRN-----KKLMKKENTIFSTRQQRX 185
           QILSKAENDPIYF  D+       +     + DGK N     K L K +    +   +  
Sbjct: 137 QILSKAENDPIYF--DFK------LADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNE-- 186

Query: 186 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIEQYLNNNSRISVQDLIMRIYQDLNNYSE 245
                                          ++   +  S  SVQDL+MRI+QDLNNYSE
Sbjct: 187 ------------------------------IMKDLESEKSDFSVQDLVMRIFQDLNNYSE 216

Query: 246 CLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFING 305
           CLIPID+GN VDIKIFPL K PP + +SIEDVP+S V+L  I DVNWDPTMLK++P+I+G
Sbjct: 217 CLIPIDEGNAVDIKIFPL-KTPPNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDG 275

Query: 306 INDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMAT 365
           +N ISKI+KLS+S   LV+EC+KHL+YYNCVI+ DIFQFSN Y+ TSLI  FLTDP +A+
Sbjct: 276 LNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLAS 335

Query: 366 LCQNYVVLPLGSKLTRLPFHI-------ETETSVQSSSAYRHHHNRHEKTPSFGSSITSN 418
            CQ++V L   S L+ +PF         + + S    S  R      +           +
Sbjct: 336 ECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQSKNQESGSRTTSMSSKSDSKSKRPFFYS 395

Query: 419 NGRSSFSADDRKQSETXXXXXXXXXXXXXXXTAHLPTKMSLFELYRSLNQRTDLKNWYKL 478
             R+ +  + R QS                   HLPTK  LF+LYR+L+Q   ++ WY L
Sbjct: 396 APRNPYRFNQRSQSS----FSSTNTNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNL 451

Query: 479 NYTTIIENNXXXXXXXXXXXXXXXXYRCHSYPIV----ITPVVSAPESAKXXXXXXXXXX 534
           NY TI +N+                YRC S+P++    I  +     +A           
Sbjct: 452 NYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGK 511

Query: 535 XXXXXXXKQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSFYEKL----EKG------- 583
                   ++       +  G GS +  +   D  D+++++ Y+KL    E G       
Sbjct: 512 GQKNLAESKYVFSTSDMKL-GEGSKMHQNFSVDIADEVLRNVYKKLSNTNEPGSRDDYPL 570

Query: 584 ----KNHSKVSFS----------------DKIAFQNDEND---HSATSSDNDDKSKSQLT 620
               +  S VS S                 K+AF  +++D   +S +     +K +    
Sbjct: 571 SRIYREESHVSLSALSGDNVSHPKKPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAK 630

Query: 621 L-----KQRNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665
           L      Q+ ILL+SI+  D +DKICVKL +PR ++EE L E GDYK+IN
Sbjct: 631 LDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIIN 680

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  461 bits (1186), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 290/710 (40%), Positives = 386/710 (54%), Gaps = 76/710 (10%)

Query: 13  FEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLTFK 72
           F+GF PIHTIFYS+FHPTEG KV Y+FPP+NL    I+FD+I++Y+IPK QLCNKLLT K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 73  YANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQNQI 132
           Y NYRI+ YPITIN   YAR           PY+C+TSPYE  I +LGKMF+VLEEQ+Q 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 133 LSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRXXXXXXXX 192
           LSKAE D  YF  D+       I+ ++ D D K     +K E    S+            
Sbjct: 124 LSKAEKDLAYF--DFKA-----ILHSSLDQDSK-----LKPEKD--SSGNNNGNSNNSNN 169

Query: 193 XXXXXXXXXXXXXXXXXXXXXXXTIEQYLNNN-SRISVQDLIMRIYQDLNNYSECLIPID 251
                                   I+++++N+ S  S+QD IMR+YQDLNNYSECLIPID
Sbjct: 170 DQSNSANATDSKKNSSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPID 229

Query: 252 DGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDISK 311
            GN VDIK+FPLL+PPPA ++SIEDVP+S V+L +I DVNWDPTMLK++P I+G+N I+K
Sbjct: 230 AGNAVDIKLFPLLRPPPA-TISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAK 288

Query: 312 ISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQNYV 371
           I+KLS+S  +LVIECIKH IYY CV+I+DIFQFSN Y+ TSL+  FLTDP MAT CQ YV
Sbjct: 289 IAKLSDSDTVLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYV 348

Query: 372 VLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEK-TPSFGSSITSNNGRSS------- 423
            +P  S L +LP    ++  + S  +   +  + +    S  +S  S+ G SS       
Sbjct: 349 TVPESSTLHQLPLESLSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSL 408

Query: 424 FSADD----RKQSETXXXXXXXXXXXXXXXTAHLPTKMSLFELYRSLNQRTDLKNWYKLN 479
           +S  D    R +SE+                  LPT+ +LF+LYRSL+Q   LK WYK N
Sbjct: 409 YSRSDLYLNRHRSES--SISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKEN 466

Query: 480 YTTIIENNXXXXXXXXXXXXXXXXYRCHSYPIVITPVVSAPESAKXXXXXXXXXXXXXXX 539
           +  I  N                 YRC S+P  +T         K               
Sbjct: 467 FFEIRNNGIDIRKFIIFGIINGLLYRCQSFP--VTANFEEINKVKKFKDIQNRKETRKDK 524

Query: 540 XXKQHTQKGPISRFPGLGSHVPSSGVR-------DTRDKLMKSFYEKL------------ 580
             KQ +Q    +    +G  + S   R       D  D ++K+ Y+KL            
Sbjct: 525 LQKQLSQDIFSTSDIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNR 584

Query: 581 ----------------EKGKNHSKV----SFSDKIAFQNDEN-DHSATSSD---NDDKSK 616
                           E    +SKV        K++FQ + N  +SA+S D   N+D + 
Sbjct: 585 ALNSQELEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINN 644

Query: 617 SQLTLKQ-RNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665
            +   KQ   ILL+++ + +N+DKICV L +PRS++EE L    D+KVIN
Sbjct: 645 LEKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVIN 694

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  458 bits (1179), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 249/520 (47%), Positives = 316/520 (60%), Gaps = 60/520 (11%)

Query: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70
           + FEGF+PIHTIFY++FHPTEGTKVRYEFPP NL + +I+FDAIKNYIIPK QLC+KLLT
Sbjct: 3   DQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKLLT 62

Query: 71  FKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQN 130
            KY NYRI SYP+T+NS  YAR           PYDC+TSPYEPAIARLGKMFKVLEEQN
Sbjct: 63  LKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEEQN 122

Query: 131 QILSKAENDPIY--FKSDYTPYQPTLIIPTNNDNDGK----RNKKLMKKENTIFSTRQQR 184
            ILSKAE DPI+  FK           +   +D D K    +    + K     S +  +
Sbjct: 123 LILSKAEKDPIFYHFKQ----------VEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHK 172

Query: 185 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIEQYLNNNSRISVQDLIMRIYQDLNNYS 244
                                           IE   + +S  S++DL++R+YQDLNNYS
Sbjct: 173 IMTD----------------------------IE---SADSTFSLKDLVLRVYQDLNNYS 201

Query: 245 ECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFIN 304
           ECLIPID+GN VDIKIFP++ PP +N +SIEDVP+S V+L K+ DVNWDPTMLK++P+IN
Sbjct: 202 ECLIPIDEGNAVDIKIFPMMTPPNSN-ISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYIN 260

Query: 305 GINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMA 364
           G+N ISKI+KLS S P LVIECIKHLIYYNCV++ DIFQFSN Y+ TS + TFLTD  ++
Sbjct: 261 GLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLS 320

Query: 365 TLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNGRSSF 424
           T CQ+YVV    S L RLPF     ++ +S        +R ++T    ++  S+NG+   
Sbjct: 321 TECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELADSHRSQRTSGSRTTSMSSNGKFFP 380

Query: 425 SADD------------RKQSETXXXXXXXXXXXXXXXTAHLPTKMSLFELYRSLNQRTDL 472
           S+++            R    +                 +LPTK  LF+LYRSL+Q T L
Sbjct: 381 SSNNEMPALISEESLYRTGKHSQSSFSSNNTNPSNMLARYLPTKSCLFDLYRSLSQGTSL 440

Query: 473 KNWYKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYPIV 512
           + WY ++Y TI  N                 YRC+SYPI+
Sbjct: 441 REWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYPIM 480

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 52/92 (56%), Gaps = 9/92 (9%)

Query: 579 KLEKGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSK----SQLTLKQRN-ILLDSISN 633
           +L+     SKVSF DK   Q +    S   S ++DK K    ++L  ++R+ ILL+S+  
Sbjct: 591 RLQNSDRPSKVSF-DK---QQEIGHISKGMSSSNDKVKMDEEAKLERRERDLILLESVEA 646

Query: 634 MDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665
            D++D ICVKL   R  +E  +   G+YK+IN
Sbjct: 647 ADSLDTICVKLEMSRYDVEALIQNLGEYKIIN 678

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  442 bits (1137), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 268/693 (38%), Positives = 368/693 (53%), Gaps = 57/693 (8%)

Query: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70
           N F+GF+PIH IFYS+FHPTEGTKV YEFPPSNL  S I+FDAIKNY+IPK QLC+KLLT
Sbjct: 3   NSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKLLT 62

Query: 71  FKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQN 130
            KY NYRIV YPI INS  YAR           PY+CETSPYEP + RLGKMF  LE Q 
Sbjct: 63  LKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEGQC 122

Query: 131 QILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRXXXXXX 190
           Q LSK E D  YF         + +I  +  N    N  L K  + I  T          
Sbjct: 123 QFLSKCEKDMAYFDFKLI----SNLIDQDKSNTEPDNNILSKTNSMILPT-----ISNID 173

Query: 191 XXXXXXXXXXXXXXXXXXXXXXXXXTIEQYLNNNS-RISVQDLIMRIYQDLNNYSECLIP 249
                                     I+ Y+ N+  ++S+ D++MR++QDLN+YSEC IP
Sbjct: 174 TTVGSTNTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIP 233

Query: 250 IDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDI 309
           IDDGN +DIK+FP L PP  +S+S+EDVP+  V+L KI DVNWDPTMLK++P+I+G+N I
Sbjct: 234 IDDGNAIDIKLFPTLMPP-IDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSI 292

Query: 310 SKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQN 369
            KI+ LSNS  MLVIECI+H +YY CVI++DIFQFSN Y+ TS I+ FLTDP +AT CQ 
Sbjct: 293 FKIANLSNSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQI 352

Query: 370 YVVLPLGSKLTRLPFH-----------IETETSVQSSSAYRHHHNRHEKTPSFGSSITSN 418
           YV  P  S L+ LPF                +   SSS+ R   N + K  SF S    +
Sbjct: 353 YVTSPEDSLLSALPFKKGRKMVKNRRSASIASHFTSSSSLR--QNLNSKASSFISDEGHH 410

Query: 419 NGRSSFSADD---RKQSETXXXXXXXXXXXXXXXTAHLPTKMSLFELYRSLNQRTDLKNW 475
           N  +++   D     +  +                 +LPTK +LF+LYRSL+Q   L+ W
Sbjct: 411 NDDTAYPNHDSIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEW 470

Query: 476 YKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYPIV-----------ITPVVSAPESAK 524
           Y++N+ +I +N                 YRCHSYP+            +  + + P+  K
Sbjct: 471 YQINFNSIRDNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQNGPKIVK 530

Query: 525 XXXXXXXXXXXXXXXXXKQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSFYEKLE--- 581
                                 K  +  +      + +  V D  D+++ + Y+KL    
Sbjct: 531 NKSQSYTYNIFSTSDI------KFGVDLYTDTKKKLHTLDV-DVADRVLNNVYKKLSTNG 583

Query: 582 --------KGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDSISN 633
                   +G++ SKV+F ++ ++ ND             K   ++ +  +  LLD++ +
Sbjct: 584 RPTTSINGQGQHPSKVAFKNQ-SYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQS 642

Query: 634 MDNMDKICVKLGRPRSQIEEWLSEFGDYKVINC 666
            +N+D IC  L   R ++E  L+E  +Y++INC
Sbjct: 643 AENLDNICSNLELSREEVETLLNELTEYRIINC 675

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  436 bits (1122), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 278/698 (39%), Positives = 369/698 (52%), Gaps = 98/698 (14%)

Query: 12  HFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLTF 71
            FEGF+ IH+IFYS FHPTEG+KV+++FPP +L  S I+FD+IKNY+IPK+ LC++L+TF
Sbjct: 4   QFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRLITF 63

Query: 72  KYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQNQ 131
           KY NYRI  YP+T+NS  YAR           P++CETSPYEPAI RLGKMF+VLE QNQ
Sbjct: 64  KYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEIQNQ 123

Query: 132 ILSKAENDPIYF--KSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRXXXXX 189
           ILSK+END I F  KS    +        N DND   N  L    ++I +T+Q+      
Sbjct: 124 ILSKSENDTIMFNLKSADKNF--------NIDNDSS-NYILGDDISSIMTTQQK------ 168

Query: 190 XXXXXXXXXXXXXXXXXXXXXXXXXXTIEQYLNNNSRISVQDLIMRIYQDLNNYSECLIP 249
                                      I       S  ++ DL+MR+YQDLN YSECLIP
Sbjct: 169 ------------------DKYERLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIP 210

Query: 250 IDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDI 309
           IDDGN VDIK+FPLL PP    +SIE VP+SLV+L KI DVNWDP ML +IP+INGIN+I
Sbjct: 211 IDDGNAVDIKLFPLLTPPTP-YISIEHVPISLVNLFKIVDVNWDPIMLTIIPYINGINNI 269

Query: 310 SKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQN 369
            +IS+LS++   LVIECI+HL+YY C+++TDIF+FSN Y+ TS +  FL DPNMAT CQ+
Sbjct: 270 YRISQLSHNEESLVIECIRHLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQS 329

Query: 370 YVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRH--------EKTPSFGSSITSNNG- 420
           YV+LP+ SK+  L  +               HH +H         +  S  +S+ S NG 
Sbjct: 330 YVMLPINSKMNDLSLY--------------PHHGKHSAFNGDIGSRNNSVSTSLYSFNGN 375

Query: 421 ------RSSFSAD--------DRKQSETXXXXXXXXXXXXXXXTAHLPTKMSLFELYRSL 466
                 RSS S D        ++KQSE+                 HLPT+  LF+LYRSL
Sbjct: 376 DSRPQSRSS-SVDQSQTNFYKNKKQSESSISTGNSNNGQNIH--KHLPTRSLLFDLYRSL 432

Query: 467 NQRTDLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYPIVITPVVSAPESAKXX 526
           +Q   LK WY  N+  I +N                 YRC +Y  VI          K  
Sbjct: 433 SQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYS-VINSTDHLQNLWKLN 491

Query: 527 XXXXXXXXXXXXXXXKQH-----TQKGPISRFPGLGSHVPSSGVRDTRDKLMKSFY---- 577
                            H       +  ++ +  L   VPS G   + +    SF     
Sbjct: 492 ELENPISMENISKLQSNHIDSLAADEALMNAYKKLSLKVPSKGALKSHNTSHSSFSLTPT 551

Query: 578 ------EKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDN---DDKSKSQLTLKQRNILL 628
                  + ++ K  SKVSF    A   D N     S+      + +  +L+  QR I+L
Sbjct: 552 APEMENSQAKRNKRLSKVSFE---ALPEDRNGFRWGSNIKTPIQETTWKKLSKMQRRIML 608

Query: 629 DSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVINC 666
            ++++ + +DKICV L  PR  +   L E G+ K+INC
Sbjct: 609 KALADAETLDKICVLLEMPRQNVVNILHELGELKLINC 646

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  434 bits (1116), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 270/728 (37%), Positives = 370/728 (50%), Gaps = 113/728 (15%)

Query: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70
            HF+GF+P+H I Y+IFHPTEGTKVR++FPP  L ASDI FD IKNY+IPK QLCNKLLT
Sbjct: 3   GHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKLLT 62

Query: 71  FKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQN 130
           FKY ++R+V YP+ + + +YAR           PYDC TSPYE AIARLGKMF VLEEQ+
Sbjct: 63  FKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEEQS 122

Query: 131 QILSKAENDPIYFK------SDYTPYQPTLIIPTNNDNDGK---RNKKLMKKENTIFSTR 181
           QILSKAEN  +YF+        +T  +P       NDN+ +   +N +  + E+  ++  
Sbjct: 123 QILSKAENSHVYFQLKTRDSHKHTNQEPV------NDNELQGTLKNNEASQSESHGYAFE 176

Query: 182 QQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIEQYLNN-NSRISVQDLIMRIYQDL 240
           +                                  I + LN  N RISV+DLI +IY+DL
Sbjct: 177 KYHE-------------------------------ILKDLNGPNKRISVEDLITKIYRDL 205

Query: 241 NNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLI 300
           NNYSECLIPID GN VDIK+FPLL PP ++ LS EDVPM  V+L K+ DVNWDPTMLK++
Sbjct: 206 NNYSECLIPIDSGNAVDIKLFPLLSPP-SSCLSFEDVPMPTVNLAKLIDVNWDPTMLKIV 264

Query: 301 PFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTD 360
           P+ING N I+K++KLS+S   LV+ECI+HL+YYNCVI+ DIFQF N Y+ TS +S FLT+
Sbjct: 265 PYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCVILADIFQFQNIYAPTSELSRFLTN 324

Query: 361 PNMATLCQNYVVLPLGSKLTRLPF----------HIETETSVQSSSAYRHHHNRHEKTPS 410
           P +AT CQ YV L   + ++ LPF          +I    S  +    R       K  S
Sbjct: 325 PALATECQIYVTLDESTHISDLPFERKPSRTTYNNIPVRNSSSTLDVQRKGREMSIKESS 384

Query: 411 FGSSITSNNGRSSFSADDRK---QSETXXXXXXXXXXXXXXXTAHLPTKMSLFELYRSLN 467
           F + I   +GR+ ++        Q                       +K  LF++YRSL+
Sbjct: 385 FTAGI-DQSGRNQYTPQSHTSSIQCHNVSDASLGNSEGGFNNKVFFTSKSCLFDMYRSLS 443

Query: 468 QRTDLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYPIVITPVVSAPESAKXXX 527
           Q   +K WYK ++  I                    YRC+S+PI+          A    
Sbjct: 444 QGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLS 503

Query: 528 XXXXXXXXXXXXXXKQHTQKGPISRFPGLGSHVPSSGVR----------DTRDKLMKSFY 577
                          + T     +    +G    SS +R          DT + ++   Y
Sbjct: 504 DGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLESSSSKLRERRFNHFSNADTAEDILNDVY 563

Query: 578 EKLEKGKNHSKVSFSDKIA------FQNDENDHSATSSDND------------------- 612
            KL    N +KV  S +        F N  +D S  +S  D                   
Sbjct: 564 RKL--ALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSVKDVVSTAGSDTRNTVAFDVRR 621

Query: 613 --------DKSKSQLTLKQRN------ILLDSISNMDNMDKICVKLGRPRSQIEEWLSEF 658
                   D+ K ++   + +      +LL S+ +++N DKIC +LGR R ++E+ L + 
Sbjct: 622 LVNSATAEDRKKGEVMRLEEDKRKDELLLLKSVRDVENFDKICTRLGRDREEVEKMLEDL 681

Query: 659 GDYKVINC 666
           G Y V++C
Sbjct: 682 GPYNVVHC 689

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  432 bits (1111), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 236/538 (43%), Positives = 305/538 (56%), Gaps = 76/538 (14%)

Query: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70
           +HF+GF+PIHT+FYS+FHPTEGTKVRY+FPP+NL  +DI+FD IKNY+IPK QLCNKLLT
Sbjct: 3   SHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKLLT 62

Query: 71  FKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQN 130
           FKY  YR+  YP+ +N+ +YAR           PY+C TSPYEPA+ARLGKMF+VLEEQ+
Sbjct: 63  FKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEEQS 122

Query: 131 QILSKAEND------------------PIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMK 172
           QILSKAEND                  P+       P         NN  D K   K+  
Sbjct: 123 QILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKIEG 182

Query: 173 KENTIFSTRQQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIEQYLNNNSRISVQDL 232
           +   I    +                                  ++       R+S++DL
Sbjct: 183 QGAAIEKYHE---------------------------------IMDDLEKGKKRLSIEDL 209

Query: 233 IMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNW 292
           I ++YQDLNNYSEC IPID GN+VDIK+FPLL PP +  LS EDVP+S V+L K+ DVNW
Sbjct: 210 ITKLYQDLNNYSECFIPIDSGNSVDIKLFPLLAPPNS-CLSFEDVPISTVNLAKLIDVNW 268

Query: 293 DPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTS 352
           DPTMLK++PFING+N I+KI+K S+S   LVIEC+KHLIYYNCV++ DIFQFSN Y++TS
Sbjct: 269 DPTMLKIVPFINGVNSIAKIAKFSSSDTDLVIECVKHLIYYNCVVLADIFQFSNIYASTS 328

Query: 353 LISTFLTDPNMATLCQNYVV--------LPLGSKLTRLPFHIETETSVQSSSAYRHHHNR 404
           LIS FLTDP +A+ CQ YV         LP  S+   L  H   + +  S+       N 
Sbjct: 329 LISEFLTDPTLASECQTYVTSSDLELYRLPFESRPNLLSMHSSRKQNSSSTIHTVGVRNS 388

Query: 405 HEKTPSFGSSITSNNGRSSFSA----------DDRKQSETXXXXXXXXXXXXXXXTAHLP 454
             +T S       +  R++FS+          D   QS T                  LP
Sbjct: 389 PNRTNSLDYPSELSTRRNNFSSSSASSLMRVRDRSGQSTTGSAVDEQESRLL------LP 442

Query: 455 TKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYPIV 512
           TK  LF+LYRSL+Q   +K WYK+N+  I +N+                YRC++YP++
Sbjct: 443 TKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVRRFITFGIVRGLIYRCYAYPVM 500

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 62/121 (51%), Gaps = 12/121 (9%)

Query: 549 PISRFPGLGSHVPSSGVRDTRDKLMKSFYEKLEKGKNHSKVSFS-DKIAFQNDENDHSAT 607
           P+SR  G  S    S  + +R    K     +E  +  SKV+F   +  +Q +E++    
Sbjct: 597 PMSRLYGHDSG--ESSTKGSRKGSRKGSSSTME-SETRSKVAFEKGRSPWQVEEDEKKER 653

Query: 608 SSDNDDKSKSQLTLKQRN---ILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVI 664
           + +      S L  ++R+   +LL S+ ++D  DKIC++L + R ++E+ L E G Y +I
Sbjct: 654 TEE-----VSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNII 708

Query: 665 N 665
           N
Sbjct: 709 N 709

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  428 bits (1101), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 238/512 (46%), Positives = 307/512 (59%), Gaps = 57/512 (11%)

Query: 10  INHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLL 69
           I+HFEGF+PIHT+FYSIFHPTEGTKVRYEFPP NL   +I+FD IKNYIIPK QLC+KLL
Sbjct: 2   IDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKLL 61

Query: 70  TFKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQ 129
           T KY +YR+VSYP+TINS  YAR           P +CETSPYEP IARLGKMF+VLEEQ
Sbjct: 62  TLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEEQ 121

Query: 130 NQILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRXXXXX 189
           NQ+LS+AEND +YF + ++      ++ +  D+   ++K       +I    ++R     
Sbjct: 122 NQLLSRAENDSVYFDNSHS------LLSSEQDSIMHQDKN-----TSILGFSRKRFSFSK 170

Query: 190 XXXXXXXXXXXXXXXXXXXXXXXXXXTIEQYLNN--NSRISVQDLIMRIYQDLNNYSECL 247
                                     ++ +Y +N   S  SVQDLIMRI+QDLNNYSECL
Sbjct: 171 RPTDL---------------------SLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECL 209

Query: 248 IPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGIN 307
           IPID+GN+VDIKIFP + PP   S+S EDVP+++VDL+ + DVNWDPTMLK++PFI+ IN
Sbjct: 210 IPIDEGNSVDIKIFPSMVPPSI-SISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSIN 268

Query: 308 DISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLC 367
            IS+I+ LSNS    V+ECI+HL+YY  VI++DIFQF+N Y+ TS +  FLTD N+AT C
Sbjct: 269 SISRIAALSNSDVDFVVECIRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDC 328

Query: 368 QNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNGRSSFSAD 427
           Q YV LP  S   +LP      T +   S             + GS+I  NN       D
Sbjct: 329 QTYVCLPKNSNFGKLPLEKSINTDLDEYS-------------NSGSAIYPNN--EILEND 373

Query: 428 DR-------KQSETXXXXXXXXXXXXXXXTAHLPTKMSLFELYRSLNQRTDLKNWYKLNY 480
           DR       K   +               + +LPTK  LF+LYRSL+Q T L +WY  +Y
Sbjct: 374 DRLRWPMYYKPRNSQSSLSSGISSGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHY 433

Query: 481 TTIIENNXXXXXXXXXXXXXXXXYRCHSYPIV 512
           + I  N                 YRC++ PI+
Sbjct: 434 SLIHFNKIDIRRFITFGLVRGLLYRCYAIPIM 465

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 40/59 (67%), Gaps = 5/59 (8%)

Query: 613 DKSKSQLTLKQ-----RNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVINC 666
           D SK  +  +Q     R +LL+S+   DNMDKIC+KL +PR ++EE LSE GDY +INC
Sbjct: 652 DSSKDIIAQQQEKNHIRRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIINC 710

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  417 bits (1071), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 254/716 (35%), Positives = 364/716 (50%), Gaps = 124/716 (17%)

Query: 13  FEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLTFK 72
           F+GF+PIHT+FY++FHPTEG+KVR++FPP++L    I FD IKNYIIPK QLCNKLLTFK
Sbjct: 5   FDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKLLTFK 64

Query: 73  YANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQNQI 132
           Y  YRIV YP+ +N+ +YAR           PYDC TSPYEPAIARLGKMFKVLEEQ+QI
Sbjct: 65  YGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEEQSQI 124

Query: 133 LSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKL----MKKENTIFSTRQQRXXXX 188
           LSK+E +P+YF+           + +N+ N   ++ ++    + +   I ST        
Sbjct: 125 LSKSEQNPVYFQ-----------LKSNDSNAADQSTEMGSITISEHTDIKSTGDD----- 168

Query: 189 XXXXXXXXXXXXXXXXXXXXXXXXXXXTIEQYLNNNSRISVQDLIMRIYQDLNNYSECLI 248
                                       I++   N   + ++DL+M+++ DLNNYSECLI
Sbjct: 169 ---------------------GEKYLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLI 207

Query: 249 PIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGIND 308
           PID+GN++DIK+FP+  PP +N +S+EDVP+++V+L+ I DVNWDPTM+K++P+INGIN 
Sbjct: 208 PIDEGNSIDIKLFPVRTPPSSN-ISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINS 266

Query: 309 ISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQ 368
           +++I+  + S   LV ECIKHL+YYNCVI++DIFQFSN Y+ TS I  FLT+P +A  CQ
Sbjct: 267 VAQIAVSARSDVELVQECIKHLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQ 326

Query: 369 NYV--------VLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNG 420
            +V        +LP   +    P +I      Q+S++  H   R        S+ T+  G
Sbjct: 327 LFVQGDSLKQSLLPFEGR----PNNIYPTGRKQASTSTVHSRRRD-------SNDTATTG 375

Query: 421 RSSFSADDRKQSETXXXXXXXXXXXXXXXTAH----------LPTKMSLFELYRSLNQRT 470
            +S   D  +   +               T+           LPT+  LF+LY+SL+Q  
Sbjct: 376 STSSVRDTHRNYLSSSSTSSYFRAHASENTSLATGENQMKRILPTRSCLFDLYKSLSQGK 435

Query: 471 DLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYPIV--------ITPVVSAPES 522
            +K+WYK N+  I +N                 YR +SYPIV        +  +VS    
Sbjct: 436 TVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYPIVKNVGTWDILKSLVSKEPK 495

Query: 523 AKXXXXXXXXXXXXXXXXXKQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSFYEKLEK 582
                                  ++G              S   D  D+L+KS Y+KL  
Sbjct: 496 THYGSGSSKNIFSAADIKVVDTKEEG------------NQSDKLDAADELLKSLYQKLSL 543

Query: 583 GKN---------------------------------HSKVSFSDKIAFQNDENDHSATSS 609
            ++                                 H KVSF    A Q           
Sbjct: 544 KQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQKVSFDFGTAGQQKTVTEVPDLG 603

Query: 610 DNDDKSKSQLTLKQRNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665
           D +     +   ++  ILL+S+SN +  DK+C KL + R ++E  L + G Y ++N
Sbjct: 604 DGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVN 659

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  395 bits (1016), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/511 (42%), Positives = 295/511 (57%), Gaps = 41/511 (8%)

Query: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70
           N F+GF+PIH IFY++FHPTEGTKVR++FP  +L  S I FD IKNY+IPK QLCNKL+T
Sbjct: 10  NKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKLVT 69

Query: 71  FKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQN 130
           FK+ +YR+V YP+ I + +YAR           PYD  TSPYEPAIARL KM +VLEEQ+
Sbjct: 70  FKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEEQS 129

Query: 131 QILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRXXXXXX 190
           Q+LSK E DP+Y++      +        +D+  K +  L KK      +R Q       
Sbjct: 130 QMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHN-LDKK------SRAQHNATTKY 182

Query: 191 XXXXXXXXXXXXXXXXXXXXXXXXXTIEQYLNNNSR-ISVQDLIMRIYQDLNNYSECLIP 249
                                     I +++N++ + + ++DLI ++Y+DLNNYSECLIP
Sbjct: 183 HE------------------------IMKHINSDEKNLYIEDLITKLYEDLNNYSECLIP 218

Query: 250 IDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDI 309
           +D GN +DIK+FPLL PP +  LS EDVP++ V+L  + DVNWDPTMLK++PFINGIN I
Sbjct: 219 MDSGNAIDIKLFPLLTPPNS-CLSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSI 277

Query: 310 SKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQN 369
           +KISK S+S+  LV+ECIKHL+YY+CV + D+FQFSN Y+ T+L+  FL D  +   CQ 
Sbjct: 278 AKISKCSDSAVELVMECIKHLVYYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQV 337

Query: 370 YVVLPLGSKLTRLPF-------HIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNGRS 422
           YVV     ++ RLPF       H   +T+  ++           +  SF S+   +   S
Sbjct: 338 YVVSSEDCEIHRLPFESRPNGGHSRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSS 397

Query: 423 SFSADDRKQSETXXXXXXXXXXXXXXXTAH-LPTKMSLFELYRSLNQRTDLKNWYKLNYT 481
             S+  +  +++                   LPT+  LF+LYRSL Q   LK WYK NY+
Sbjct: 398 GISSLAQSFTQSNKDYYYNRSRNLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYS 457

Query: 482 TIIENNXXXXXXXXXXXXXXXXYRCHSYPIV 512
            I EN                 YRC+SYP+ 
Sbjct: 458 AIRENQIDVRRLIIFGVFHRLIYRCYSYPVA 488

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 623 QRNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665
           Q  +LL S+ ++D+ DKI V+L   + ++E  L   G+Y ++N
Sbjct: 637 QEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVN 679

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  318 bits (816), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 191/452 (42%), Positives = 254/452 (56%), Gaps = 46/452 (10%)

Query: 227 ISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTK 286
           ISVQDLIMRIYQDLNNYSECLIPID+GN +DIKIFPL+ PP +  LSIEDVPM +V L K
Sbjct: 177 ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLVVKLKK 236

Query: 287 ITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSN 346
           I D+NWDPTM+ ++PFING+N I  I++LS+S P LVIECIKHLIYY CVIITDIFQFSN
Sbjct: 237 IIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDIFQFSN 296

Query: 347 TYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHE 406
            Y+ +SLI+ FLTDP MA  CQ YV LP  S+L  +P     +TSV  S      +N+H+
Sbjct: 297 IYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPL----QTSVPGS-----RNNKHK 347

Query: 407 KTPSFGSS---------ITSNNGRSSFSADDRKQSETXXXXXXX-XXXXXXXXTAHLPTK 456
           K+ S  S+           SNN    +S  ++K+SE+                T + PT+
Sbjct: 348 KSNSLSSTGVLSWQSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGAGRSDDHTIYYPTR 407

Query: 457 MSLFELYRSLNQRTDLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYPIVITPV 516
           M LF+LYRSL+Q   L+ WY  N+TTI  N                 YR  SYP++    
Sbjct: 408 MVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVL---- 463

Query: 517 VSAPESAKXXXXXXXXXXXXXXXXXKQHTQKGPISRFPGLGSHVPSSGVR-DTRDKLMKS 575
                                     +  +K P S+     +   +S ++ D  D+L  S
Sbjct: 464 -----------EKRRNSIIAKQMGKSKMAEKAPHSK----NAFFSTSDIKFDDGDRLFNS 508

Query: 576 FYEKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDND-DKSKSQLTLKQRNILLDSISNM 634
            Y +       SKVSF  +     +     A    N  DK    LT +++  LL ++ N+
Sbjct: 509 LYARF------SKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNL 562

Query: 635 DNMDKICVKLGRPRSQIEEWLSEFGDYKVINC 666
           ++ DKICV+LGR R +I   +++ G+Y+VINC
Sbjct: 563 ESFDKICVQLGRSRVEIANLIADIGEYRVINC 594

 Score =  198 bits (503), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 90/141 (63%), Positives = 108/141 (76%)

Query: 10  INHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLL 69
           ++ FEGF+PIHT+FY+IFHPTEG+KV Y+FPP NL   DI+FDAIKNYIIPK QLC++LL
Sbjct: 2   MSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRLL 61

Query: 70  TFKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQ 129
           T KY NYRIVSYP+ + S  YAR           PY+C TSPYEPAI RLGKMF+VLEEQ
Sbjct: 62  TMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEEQ 121

Query: 130 NQILSKAENDPIYFKSDYTPY 150
           +Q+LS+AE D   FK D  P+
Sbjct: 122 SQVLSRAERDDSLFKGDKLPF 142

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  296 bits (758), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 174/443 (39%), Positives = 248/443 (55%), Gaps = 49/443 (11%)

Query: 224 NSRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVD 283
           +++ S+QDL+MR+YQDLNNYSECLIPID+GN ++IKIFP+LKPP +  +SIEDVP+S+V+
Sbjct: 145 DTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVN 204

Query: 284 LTKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQ 343
           L KI D+NWDPTML ++PFI+G+N I+ IS LS+S P LVIECIKHLIYYNCVIITDIFQ
Sbjct: 205 LDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQ 264

Query: 344 FSNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHN 403
           FSN Y+ +SLI+ FL DP +A  CQ+YVVLP GSK+  LP   E +  + +S   +   +
Sbjct: 265 FSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMTQKALS 324

Query: 404 RHEKTPSFGSSITSNNGRSSFSADDRKQSETXXXXXXXXXXXXXXXTAHLPTKMSLFELY 463
               + S   S  S   R S +A   + + T                  LP+K +LF+LY
Sbjct: 325 SSRSSFSSYFSHKSAYARVSETAHHHQSTSTLSSSEGQQDNPRQGQV--LPSKCTLFDLY 382

Query: 464 RSLNQRTDLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYPIVITPVVSAPESA 523
           RSLN    ++ WYK N++TI EN+                YR H YPI+      +P   
Sbjct: 383 RSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIMEHKTFKSP--- 439

Query: 524 KXXXXXXXXXXXXXXXXXKQHTQKGPISRFPGLGSHVPSSGVR-DTRDKLMKSFYEKLEK 582
                              +   K  +S          +S ++ D  D+++ S Y KL  
Sbjct: 440 ---------------LLSDRQNDKIVLS----------TSDIKFDVGDRILNSIYNKLS- 473

Query: 583 GKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDSISNMDNMDKICV 642
                      K+ F  D+   S   +  +      L   ++NIL +++   ++ D+IC 
Sbjct: 474 -----------KVTFDRDKKLESKIGNSRN------LGESEKNILFNALERHESFDRICS 516

Query: 643 KLGRPRSQIEEWLSEFGDYKVIN 665
           KLG+ ++++E  +SE G+Y  IN
Sbjct: 517 KLGKSKNEVESIISEIGEYMTIN 539

 Score =  181 bits (458), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 82/133 (61%), Positives = 102/133 (76%)

Query: 12  HFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLTF 71
            FEGF PIHTIF+SIFHPTEG+KV Y+FPP NL A +I+FD+IKN++IPK QLC++LLT 
Sbjct: 4   QFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRLLTL 63

Query: 72  KYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQNQ 131
           +Y NYR+VSYP+ ++S  YAR            YDC+T PYEPAI RLGKMFK LEEQ+Q
Sbjct: 64  EYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEEQSQ 123

Query: 132 ILSKAENDPIYFK 144
           ILSK++    +FK
Sbjct: 124 ILSKSQRTSAFFK 136

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  287 bits (734), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 182/455 (40%), Positives = 254/455 (55%), Gaps = 48/455 (10%)

Query: 225 SRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDL 284
           S  S+QDL+MRI+QDLNNYSECLIPIDDGN VDIKIFPLL+PP    +S+EDVP+S V+L
Sbjct: 198 STFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP-TTCVSLEDVPLSSVNL 256

Query: 285 TKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQF 344
            KI DVNWDPTM+ ++P+I+G+N I+KISK S+S P LVIECI+HLIYY CV ++DIFQF
Sbjct: 257 KKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIRHLIYYKCVTLSDIFQF 316

Query: 345 SNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAY------ 398
           SN Y+ +SLI  FLTDP MAT CQ+YV  P  SKL+ LP +   ++  Q  +++      
Sbjct: 317 SNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNFDSVDQDLTSFSVRRKS 376

Query: 399 --------RHHHNRHEKTPSFGSSITSNNGRSSFSADDRKQSETXXXXXXXXXXXXXXXT 450
                    +       + S  S  +S N   S  + D +QS+T                
Sbjct: 377 KSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQSQT--SCSSTNTHAISKRN 434

Query: 451 AHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYP 510
             LPT+  LF+LYRSL+Q   LK+WY+L +TT+ ENN                YRC+S+P
Sbjct: 435 QFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCYSFP 494

Query: 511 IVITPVVSAPESAKXXXXXXXXXXXXXXXXXKQHTQKGPISRFPGLGSHVPSSGVRDTRD 570
           ++I   V + ++ +                 K+                +  +G + T  
Sbjct: 495 VMIH--VGSRDTKEMTPVATKEPSNEDNSLKKRDYNHS-----------LSVTGSKSTTQ 541

Query: 571 KLMKSFYEKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDS 630
             +KS        +  SKVSF  + A      +  AT  +   K    L+ +++ IL  S
Sbjct: 542 TNVKS--------ERPSKVSFEMQRA------NSLATGKNKIPK----LSDEEKKILEKS 583

Query: 631 ISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665
           I + +N DKICV LG+ + ++E +LSE G++KVIN
Sbjct: 584 IRSAENFDKICVLLGKSKQEVENYLSELGEFKVIN 618

 Score =  204 bits (519), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 93/148 (62%), Positives = 116/148 (78%), Gaps = 2/148 (1%)

Query: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70
           ++F+GF+PIHTIFYS+FHPTEG+K++YEFPP+NL +  I+F+ IKNYIIPK  LC+KL+T
Sbjct: 3   SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKLIT 62

Query: 71  FKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQN 130
           FKY  YRIV YP+TINS  YAR           PYDCETSPYEPAI RLGKMFKVLEEQN
Sbjct: 63  FKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQN 122

Query: 131 QILSKAENDPIYFKSDYTPYQPTLIIPT 158
           Q+LSK+E DP++F  D    + +L+ P+
Sbjct: 123 QLLSKSERDPVFF--DLKAIENSLLTPS 148

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  279 bits (714), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 180/461 (39%), Positives = 248/461 (53%), Gaps = 59/461 (12%)

Query: 225 SRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDL 284
           S  S+QDL+MRI+QDLNNYSECLIPID+GN VDIKIFPLL+PP    +S+EDVP+S V+L
Sbjct: 193 SSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP-TTCVSLEDVPLSSVNL 251

Query: 285 TKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQF 344
            KI DVNWDPTM+ ++P+I+G+N I+KISKLS S P LVIECI+HLIYY CV ++DIFQF
Sbjct: 252 KKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYYKCVTLSDIFQF 311

Query: 345 SNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNR 404
           SN Y+ +SLI TFLTD  MA+ CQ+YV  P  SK++ LP       S    SA R   + 
Sbjct: 312 SNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPL------SKNLDSADRDSPSL 365

Query: 405 HEKTPSFGSSITSN--NGRSSFSAD------------------DRKQSETXXXXXXXXXX 444
             +  S  SSI SN  +  +SFS++                  D +QS+T          
Sbjct: 366 FVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQT--SLSSSNLR 423

Query: 445 XXXXXTAHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXY 504
                   LPT+  LF+LYRSL+Q   LK+WY+  +  + ENN                Y
Sbjct: 424 ANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERRIIY 483

Query: 505 RCHSYPIVITPVVSAPESAKXXXXXXXXXXXXXXXXXKQHTQKGPISRFPGLGSHVPSSG 564
           RC+S+P+++   V + E  K                 K+  Q    S      S  P++ 
Sbjct: 484 RCYSFPVMLN--VDSRE-RKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV 540

Query: 565 VRDTRDKLMKSFYEKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQR 624
                            K +  SKVSF              A S    + +  +L+ ++ 
Sbjct: 541 -----------------KSERPSKVSF----------EMQRAGSLATGEATIPKLSDEEE 573

Query: 625 NILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665
            IL +SI + ++ D ICV L + + ++E +L+E G++KVIN
Sbjct: 574 RILENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVIN 614

 Score =  201 bits (510), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 89/133 (66%), Positives = 107/133 (80%)

Query: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70
           ++F+GF+PIHTIFYS+FHPTEG+K++YEFPP+NL    I+F+ IKNYIIPK  LC+KL+T
Sbjct: 3   SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKLIT 62

Query: 71  FKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQN 130
           FKY  YRIV YP+TINS  YAR           PYDCETSPYEPAI RLGKMFKVLEEQN
Sbjct: 63  FKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQN 122

Query: 131 QILSKAENDPIYF 143
           Q+LSK+E D ++F
Sbjct: 123 QLLSKSEKDAVFF 135

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  279 bits (714), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 178/455 (39%), Positives = 248/455 (54%), Gaps = 47/455 (10%)

Query: 225 SRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDL 284
           S  S+QDL+MRI+QDLNNYSECLIPID+GN VDIKIFPLL+PP    +S+EDVP+S V+L
Sbjct: 193 SAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP-TTCVSLEDVPLSSVNL 251

Query: 285 TKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQF 344
            KI DVNWDPTM+ ++P+I+G+N I+KISKLSNS P LVIECI+HLIYY CV ++DIFQF
Sbjct: 252 KKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYYKCVTLSDIFQF 311

Query: 345 SNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNR 404
           SN Y+ +SLI  FLTDP MA+ CQ+YV  P  SK++ LP +    +  Q S ++      
Sbjct: 312 SNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQDSPSFSVRRKS 371

Query: 405 HEKT-PSFGSSITSNNGRSSFSA-------------DDRKQSETXXXXXXXXXXXXXXXT 450
              + PS   S T++   +S  +              D +QS+T                
Sbjct: 372 KSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQT--SCSSSNIHVINNRN 429

Query: 451 AHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYP 510
             LPT+  LF+LYRSL+Q   LK WY+  Y  + ENN                YRC+S+P
Sbjct: 430 RFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRCYSFP 489

Query: 511 IVITPVVSAPESAKXXXXXXXXXXXXXXXXXKQHTQKGPISRFPGLGSHVPSSGVRDTRD 570
           ++I      P+                    + H               + ++G R+T  
Sbjct: 490 VMINAGSREPKEM-TPIITKDLVNNDKLLEKRNHNH------------LLSATGSRNT-- 534

Query: 571 KLMKSFYEKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDS 630
              +S   K E+    SKVSF  +            +S      +  +L+ ++  IL +S
Sbjct: 535 --AQSGNLKPERP---SKVSFEMQ----------RVSSLATGKSTMPKLSDEEEGILEES 579

Query: 631 ISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665
           I N +  DKICV L +P+ ++E +L+E G++KVIN
Sbjct: 580 IRNAETFDKICVLLSKPKLEVESYLNELGEFKVIN 614

 Score =  201 bits (511), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 108/134 (80%)

Query: 10  INHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLL 69
           +++F+GF+PIHTIFYS+FHPTEG+K++YEFPP+NL    I+F+  KNYIIPK  LC+KL+
Sbjct: 2   LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLI 61

Query: 70  TFKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQ 129
           TFKY  YRIV YP+TINS  YAR           PYDCETSPYEPAI RLGKMFKVLEEQ
Sbjct: 62  TFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQ 121

Query: 130 NQILSKAENDPIYF 143
           NQ+LSK+E DP++F
Sbjct: 122 NQLLSKSERDPVFF 135

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  277 bits (708), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 176/455 (38%), Positives = 251/455 (55%), Gaps = 47/455 (10%)

Query: 225 SRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDL 284
           S  S+QDL+MRI+QDLNNYSECLIPID+GN VDIKIFPLL+PP    +S+EDVP+S V+L
Sbjct: 193 STFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP-TTCVSLEDVPLSSVNL 251

Query: 285 TKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQF 344
            KI DVNWDPTM+ ++P+I+G+N I+KISKLSNS P LVIECI+HLIYY CV ++DIFQF
Sbjct: 252 EKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYYKCVTLSDIFQF 311

Query: 345 SNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIE-TETSVQSSSAYRHHHN 403
           SN Y+ +S I  FLTDP MA  CQ YV  P  SK++ LP +   T   + S S      +
Sbjct: 312 SNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDLDSPSFSVRRKS 371

Query: 404 RHEKTPS-------------FGSSITSNNGRSSFSADDRKQSETXXXXXXXXXXXXXXXT 450
           +    PS               S  +S N   S +  D +QS+T                
Sbjct: 372 KSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQT--SCSSSNIHISNNRN 429

Query: 451 AHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYP 510
             LPT+  LF+LYRSL+Q   LK WY+  Y  I +NN                YR +SYP
Sbjct: 430 RFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYP 489

Query: 511 IVITPVVSAPESAKXXXXXXXXXXXXXXXXXKQHTQKGPISRFPGLGSHVPSSGVRDTRD 570
           ++++  V   E+ +                 K++              H  S  +  +++
Sbjct: 490 VMLS--VGPRETKETAPIIAKDSPNESNSSEKKY--------------HEHSFSIIRSKN 533

Query: 571 KLMKSFYEKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDS 630
            ++   +  ++ G+  SKVSF          +   A+S    + +  +L+  +  IL +S
Sbjct: 534 AVL---FNNIKSGR-PSKVSF----------DMQKASSLITGESTIPKLSDDEERILEES 579

Query: 631 ISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665
           + + +N DKICV LG+P+ ++E +L+E G++K+IN
Sbjct: 580 VRSAENFDKICVLLGKPKLEVENYLNELGEFKIIN 614

 Score =  202 bits (515), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 109/134 (81%)

Query: 10  INHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLL 69
           +++F+GF+PIHTIFYS+FHPTEG+K++YEFPP+NL    I+F+ IKNYIIPK  LC+KL+
Sbjct: 2   LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKLI 61

Query: 70  TFKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQ 129
           TFKY  YRIV YP+TINS  YAR           PYDCETSPYEPAI RLGKMFKVLEEQ
Sbjct: 62  TFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQ 121

Query: 130 NQILSKAENDPIYF 143
           NQ+LSK+E DP++F
Sbjct: 122 NQLLSKSEKDPVFF 135

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  255 bits (652), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 168/503 (33%), Positives = 255/503 (50%), Gaps = 76/503 (15%)

Query: 223 NNSRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLV 282
           N  ++S++DLI ++Y+DLNNYSECLIP+D GN +DIK+FPLL PP +   S+EDVP++ +
Sbjct: 187 NEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNS-CFSVEDVPIAKL 245

Query: 283 DLTKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIF 342
           +L    DVNWDPTM+K++P+INGIN I+KISK S+S   LV+EC+KHLIYY+CV++ D+F
Sbjct: 246 NLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVVLVDMF 305

Query: 343 QFSNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHH 402
           QFSN Y+ TS +S FLTDP++A  CQ YV+    S+L +LPF        +      H  
Sbjct: 306 QFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPF--------EGRPNANHSR 357

Query: 403 NRHEKTPSFGS---SITSNNGRSSFSADDRKQSETXXXXXXXXXXXXXXXTAH------- 452
           N    T +FG+   +I +N    SFS++     +                + +       
Sbjct: 358 NPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHEN 417

Query: 453 --------LPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXY 504
                   LPT+  LF+LYRSL+Q   +K+WYK+N+  I +N                 Y
Sbjct: 418 NKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIY 477

Query: 505 RCHSYPIVIT----------PVVSAPESAKXXXXXXXXXXXXXXXXXKQHTQKGPISRFP 554
           RC+SYP+  +             S P +                       +     + P
Sbjct: 478 RCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRKKP 537

Query: 555 GLGSHVPSSGVRDTRDKLMKSFYEKL---EKGKNH-SKVSFSDKIAFQNDEN---DHSAT 607
                VP++   D  D++++  Y+KL   E+  N   +++ S K++ +ND +   D+   
Sbjct: 538 ----LVPNT---DAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKL 590

Query: 608 SSDNDDKSKSQLTLK-------------------------QRNILLDSISNMDNMDKICV 642
           SS     +K    +K                         Q+ +LL SI N+D+ DKI +
Sbjct: 591 SSSTSGTAKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAI 650

Query: 643 KLGRPRSQIEEWLSEFGDYKVIN 665
           KL   + ++EE L   G+Y +IN
Sbjct: 651 KLEINKQEVEELLKATGEYNIIN 673

 Score =  201 bits (512), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 89/133 (66%), Positives = 106/133 (79%)

Query: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70
           NHF+GF+PIH+IFYS+FHPTEGTKVR++FPP +L  S I FD IKNY+IPK QLCNKLLT
Sbjct: 3   NHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKLLT 62

Query: 71  FKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQN 130
           FKY +YR+V YP+ IN+ +YAR           PYD  TSPYEPAI RLGKMF+VLEEQ+
Sbjct: 63  FKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEEQS 122

Query: 131 QILSKAENDPIYF 143
           Q+LSK E DPIY+
Sbjct: 123 QVLSKIERDPIYY 135

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  243 bits (619), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 167/502 (33%), Positives = 242/502 (48%), Gaps = 65/502 (12%)

Query: 226 RISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLT 285
           +I++ DLI +IY+DLN+YSECLIPID GN VDIK+FPLL PP ++  SIEDVP+S V+L 
Sbjct: 191 KIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPP-SSCFSIEDVPISTVNLA 249

Query: 286 KITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFS 345
           K+ DVNWDPTMLK++P INGIN I+K++K S+S   LV+ECIKHLIYYNCVI+TDIFQFS
Sbjct: 250 KLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCVILTDIFQFS 309

Query: 346 NTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHN-- 403
           N Y++T+ +S FLT+P +A  CQ YV     + L  LPF      S Q +   R  +   
Sbjct: 310 NIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNIRDRSSNGTL 369

Query: 404 ----RHEKTP----SFGSSITSNNGRSSFSADDRKQS----ETXXXXXXXXXXXXXXXTA 451
               + ++TP    SF S +   + +   +   R  S     T                 
Sbjct: 370 DILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGNSDAGLKGKLM 429

Query: 452 HLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNXXXXXXXXXXXXXXXXYRCHSYPI 511
              +K  LF+LYRSL Q   ++ WYK ++  I                    YR +SYP+
Sbjct: 430 PFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGLIYRSYSYPV 489

Query: 512 VITPVVSAPESAKXXXXXXXXXXXXXXXXXKQHTQKGPI------------SRFPGLGSH 559
           +    +   ES +                 K +     +            + F      
Sbjct: 490 LRN--IGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENAGFKARSEK 547

Query: 560 VPSSGVRDTRDKLMKSFYEKL---EKGKNHSKVSFS--DKIAFQNDEND------HSATS 608
           +      D  ++++   Y KL   +K  +H     +   K+  +N E+        SA S
Sbjct: 548 LKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDISTRESANS 607

Query: 609 SDNDDKSKSQLTL-----------KQRNILLDSIS--------------NMDNMDKICVK 643
             +D K+K    +           ++R+ +L SI               ++ N DKIC  
Sbjct: 608 MGSDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKRNEELILLKSVRSVHNFDKICTL 667

Query: 644 LGRPRSQIEEWLSEFGDYKVIN 665
           LG+ R ++E  LSE G Y V++
Sbjct: 668 LGKDRERVESMLSELGPYNVLH 689

 Score =  194 bits (493), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 102/134 (76%)

Query: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70
            HF+GF+P+H IFYS+FHPTEGTKVR++FP   L  SDI FD IKNY+IPK QLCNKLLT
Sbjct: 3   GHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKLLT 62

Query: 71  FKYANYRIVSYPITINSDFYARXXXXXXXXXXXPYDCETSPYEPAIARLGKMFKVLEEQN 130
           FKY  +R+V YP+ + + +YAR           PYDC TSPYEPAI RLGKMF VLEEQ+
Sbjct: 63  FKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEEQS 122

Query: 131 QILSKAENDPIYFK 144
           QILSKAEN  +YF+
Sbjct: 123 QILSKAENSSVYFQ 136

>ZYRO0C06732g Chr3 (505681..506337) [657 bp, 218 aa] {ON} similar to
           uniprot|Q03322 Saccharomyces cerevisiae YDR468C TLG1
           member of the syntaxin family of t-SNAREs tSNARE that
           affects a Late Golgi compartment
          Length = 218

 Score = 38.1 bits (87), Expect = 0.043,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 56/127 (44%), Gaps = 34/127 (26%)

Query: 573 MKSFYEKLEKGKNHSKVSFS--DKIAFQNDENDHSATS-----SDNDDKSKSQLTLKQRN 625
           +KS YEKL+ G  +S  S S  D + +Q +E +  A +      DN D    +  L++++
Sbjct: 74  LKSAYEKLKLGVTNSTSSASNTDNVVWQQEEEEREANALQRPMRDNYDNPFQEQMLREQD 133

Query: 626 ILLDSI-------------------------SNMD-NMDKICVKLGRPRSQIEEWLSEFG 659
           + LDSI                          +MD NMD I  KL R R Q+ EW+ E  
Sbjct: 134 VQLDSIHHTMTNLHLQAQTMGDELQDQGELLQDMDTNMDTIGNKLSRGRRQL-EWIYERN 192

Query: 660 DYKVINC 666
             K  +C
Sbjct: 193 KEKYNDC 199

>NCAS0D04460 Chr4 (847921..849462) [1542 bp, 513 aa] {ON} Anc_6.323
           YCR053W
          Length = 513

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 2   HNISNLNSINHFEGFMPIHTIFYSIFHPTEGTKVRYEF--PPSNLA 45
           HN+  +NSIN       I   FYS F  T GT+ R +F  P  N  
Sbjct: 234 HNVGAVNSINWARILAQITYYFYSYFKATNGTEGRVKFVVPSGNFG 279

>ZYRO0F04554g Chr6 complement(382457..383836) [1380 bp, 459 aa] {ON}
           similar to uniprot|P43589 Saccharomyces cerevisiae
           YFR005C SAD1 Conserved zinc-finger domain protein
           involved in pre-mRNA splicing required for assembly of
           U4 snRNA into the U4/U6 particle
          Length = 459

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 9/49 (18%)

Query: 582 KGKNHSKVSFSDKIAFQNDE---------NDHSATSSDNDDKSKSQLTL 621
           KG+N + V FS KI FQN           +    T+ DNDDKS  ++ L
Sbjct: 370 KGRNQTLVEFSQKIEFQNSRYTLVANVVHDTIGTTAFDNDDKSVWRIQL 418

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,892,273
Number of extensions: 2917769
Number of successful extensions: 13505
Number of sequences better than 10.0: 52
Number of HSP's gapped: 13970
Number of HSP's successfully gapped: 89
Length of query: 666
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 550
Effective length of database: 40,180,143
Effective search space: 22099078650
Effective search space used: 22099078650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)