Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0D008506.25ON79079039150.0
NCAS0H008606.25ON75577623180.0
KAFR0G026606.25ON73577120310.0
Suva_15.1766.25ON74576919480.0
Kpol_1037.296.25ON74677819430.0
SAKL0E01452g6.25ON73777019150.0
YOR001W (RRP6)6.25ON73376519140.0
TPHA0J003706.25ON74377718980.0
KNAG0M012306.25ON73876718930.0
ZYRO0C07678g6.25ON74177618820.0
TDEL0G044406.25ON73577118800.0
Skud_15.1626.25ON73477818670.0
Smik_15.1706.25ON77377318510.0
CAGL0E02585g6.25ON73750918190.0
KLLA0D01309g6.25ON74476918030.0
TBLA0A071706.25ON77177617680.0
ACL001C6.25ON74577717440.0
Kwal_56.224476.25ON73551816760.0
Ecym_30306.25ON74769316580.0
KLTH0C11066g6.25ON73577416100.0
KAFR0G004208.860ON37449800.50
TPHA0K016104.107ON78967810.55
Smik_8.104.11ON22383760.97
NDAI0A033204.107ON77868762.2
TDEL0G018004.11ON226116715.0
Kpol_1048.731.389ON154998725.5
Skud_8.134.11ON22383706.5
ZYRO0D06842g8.276ON23877697.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0D00850
         (790 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...  1512   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   897   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   786   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   754   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   753   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   742   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   741   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   735   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   733   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   729   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   728   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   723   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   717   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   705   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   699   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   685   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   676   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   650   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   643   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   624   0.0  
KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860     35   0.50 
TPHA0K01610 Chr11 complement(341899..344268) [2370 bp, 789 aa] {...    36   0.55 
Smik_8.10 Chr8 complement(22475..23146) [672 bp, 223 aa] {ON} YH...    34   0.97 
NDAI0A03320 Chr1 (753952..756288) [2337 bp, 778 aa] {ON} Anc_4.1...    34   2.2  
TDEL0G01800 Chr7 (361298..361978) [681 bp, 226 aa] {ON} Anc_4.11...    32   5.0  
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    32   5.5  
Skud_8.13 Chr8 complement(26793..27464) [672 bp, 223 aa] {ON} YH...    32   6.5  
ZYRO0D06842g Chr4 (591212..591928) [717 bp, 238 aa] {ON} similar...    31   7.9  

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score = 1512 bits (3915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 759/790 (96%), Positives = 759/790 (96%)

Query: 1   MSSSSIDQTGTPPTAAGANEKQSPKDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKT 60
           MSSSSIDQTGTPPTAAGANEKQSPKDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKT
Sbjct: 1   MSSSSIDQTGTPPTAAGANEKQSPKDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKT 60

Query: 61  LKETTSQLADMINSVLLAVDENSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLR 120
           LKETTSQLADMINSVLLAVDENSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLR
Sbjct: 61  LKETTSQLADMINSVLLAVDENSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLR 120

Query: 121 SKNTNTNNSNMQYLDEYSGRDDTSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNAL 180
           SKNTNTNNSNMQYLDEYSGRDDTSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNAL
Sbjct: 121 SKNTNTNNSNMQYLDEYSGRDDTSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNAL 180

Query: 181 KSLDESIQLLPVDENVPEHYAQPYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTP 240
           KSLDESIQLLPVDENVPEHYAQPYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTP
Sbjct: 181 KSLDESIQLLPVDENVPEHYAQPYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTP 240

Query: 241 ESLQSMIKDLNNCTEFAVDLEHHDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNE 300
           ESLQSMIKDLNNCTEFAVDLEHHDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNE
Sbjct: 241 ESLQSMIKDLNNCTEFAVDLEHHDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNE 300

Query: 301 PFTNPQITKVLHGAFMDIIWLQRDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFK 360
           PFTNPQITKVLHGAFMDIIWLQRDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFK
Sbjct: 301 PFTNPQITKVLHGAFMDIIWLQRDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFK 360

Query: 361 TSKKYQMADWRIRPLSKAMNSYARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKR 420
           TSKKYQMADWRIRPLSKAMNSYARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKR
Sbjct: 361 TSKKYQMADWRIRPLSKAMNSYARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKR 420

Query: 421 RFEYVKYRPLITSSAVYSPIEKIDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDES 480
           RFEYVKYRPLITSSAVYSPIEKIDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDES
Sbjct: 421 RFEYVKYRPLITSSAVYSPIEKIDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDES 480

Query: 481 PRYIMPNQLLVSLVAYAPVEPAGVVSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDAD 540
           PRYIMPNQLLVSLVAYAPVEPAGVVSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDAD
Sbjct: 481 PRYIMPNQLLVSLVAYAPVEPAGVVSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDAD 540

Query: 541 SLILQQEQNQPGTSTTTTNVDLSEQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEK 600
           SLILQQEQNQPGTSTTTTNVDLSEQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEK
Sbjct: 541 SLILQQEQNQPGTSTTTTNVDLSEQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEK 600

Query: 601 KNSFLLCTDHMSFNDEDGKNFIKYSVSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSI 660
           KNSFLLCTDHMSFNDEDGKNFIKYSVSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSI
Sbjct: 601 KNSFLLCTDHMSFNDEDGKNFIKYSVSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSI 660

Query: 661 PIPENEIVVVESEQQEPSIPAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHS 720
           PIPENEIVVVESEQQEPSIPAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHS
Sbjct: 661 PIPENEIVVVESEQQEPSIPAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHS 720

Query: 721 XXXXXXXXXXXXYSKMEKVLDXXXXXXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAM 780
                       YSKMEKVLD                   FDPYNVNNEGPRAPKKRKAM
Sbjct: 721 DDDDEGEIEVIDYSKMEKVLDNSNTKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAM 780

Query: 781 TRGKNVSFKR 790
           TRGKNVSFKR
Sbjct: 781 TRGKNVSFKR 790

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/776 (60%), Positives = 553/776 (71%), Gaps = 25/776 (3%)

Query: 18  ANEKQSPKDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLL 77
           + + Q  +  LLP+VV TVRA+ ALAAQDVDFYRS+DK  A +L+++++Q+ADMINSVLL
Sbjct: 2   SEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLL 61

Query: 78  AVDENSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEY 137
           ++DENSE +DGTKENLED WKDF NLMDNL EKSDRS+D++ R    +   S MQY+DE+
Sbjct: 62  SIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEF 121

Query: 138 SGRDDTSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVP 197
           SGRD T  K+  I KPQL+F  P+DNTE+HPFIPLLK KP ALK L+ES+Q++P DE  P
Sbjct: 122 SGRDLTPGKQ--ILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSP 179

Query: 198 EHYAQPYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFA 257
            HY QPYEYEID+Q YND ILQ  DPIPS  W +   IWVDT   LQS++ DL   TE A
Sbjct: 180 MHYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIA 239

Query: 258 VDLEHHDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMD 317
           VDLEHHDYRTYYGI CLMQISTR  DY++DTL LR  LQ LN  F NP ITKV HGAFMD
Sbjct: 240 VDLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMD 299

Query: 318 IIWLQRDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSK 377
           IIWLQRDLGLY+V LFDTFHASRA+G PK+SLAYLLEKF+ FKTSKKYQ+ADWRIRPLSK
Sbjct: 300 IIWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSK 359

Query: 378 AMNSYARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRP--LITSSA 435
           AM++YAR+DTHFLLNIFDQMRN L++  KLAGVLKESRNVAKRRFEY  +RP  L T+  
Sbjct: 360 AMHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGL 419

Query: 436 VYSPIEKIDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVA 495
           VYSPIEK DPWKT+M+QYNIP  KE LLKELYQWRDKIARRDDESPR++MPNQLLVSLVA
Sbjct: 420 VYSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVA 479

Query: 496 YAPVEPAGVVSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTST 555
           Y P++  GVVSVSN VTD+VRSNSKILANLIKNCL K+KD    D+ + ++     G S 
Sbjct: 480 YTPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEE-----GISV 534

Query: 556 T-TTNVDLSEQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFN 614
              T  DLS++L+IHQL  LKS+F  L  K N      N+ +     +  L   D +SF 
Sbjct: 535 VPETGHDLSQKLTIHQLQNLKSKFQLLSDKFN------NSVKTRLSNHDQLYLFDGISFA 588

Query: 615 DEDGKNFIKYSVSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQ 674
           D+     IKY    D K + T E+  +R E FD AM+QL++VEY IP+ E      + + 
Sbjct: 589 DDVT---IKYFA--DGKIQTTAEQYKERSEQFDDAMKQLEEVEYCIPVIEENKQTQDQDN 643

Query: 675 QEPSIPAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXXYS 734
             P   A NAE        K EDLDE+IVL+KTN+NK  K + K+             Y 
Sbjct: 644 IPPITVATNAEGQVNEMIEKPEDLDEVIVLRKTNKNKSIKNKPKNR---EEPELEIIDYF 700

Query: 735 KMEKVLDXXXXXXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790
           K  KVL                    FDPY+  NEGP APKKRK +TRGKNVSFKR
Sbjct: 701 KTAKVL-TNDKNSRGGRNNNGNKRKRFDPYSAANEGPAAPKKRKNVTRGKNVSFKR 755

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/771 (51%), Positives = 520/771 (67%), Gaps = 51/771 (6%)

Query: 27  QLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSETL 86
           +LL  VV TVRAS  LAAQDVDFYRS+D   + ++ E T +L DM+NS++L++DEN ETL
Sbjct: 8   KLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYETL 67

Query: 87  DGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSSK 146
           D  KE L ++WK  SN++DNL EKSDRS+D+L         N   +Y +  +  ++   K
Sbjct: 68  DEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATTTENIPQK 127

Query: 147 RRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYEY 206
           R  I KPQL+F  P+DN+E+HPFIPLLK KPNALK++DES +L+  DENVPEHYA PYEY
Sbjct: 128 R--INKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHPYEY 185

Query: 207 EIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDYR 266
           EIDNQPYND ILQ+ +PIPS+ W ET  +WVD  ESL  M+ D+   TE A+DLEHHDYR
Sbjct: 186 EIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHHDYR 245

Query: 267 TYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDLG 326
           TYYGIVCLMQISTR  DY+VDT+ LR+ L+ LNE FT+P + KVLHGAFMDIIWLQRDLG
Sbjct: 246 TYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQRDLG 305

Query: 327 LYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARSD 386
           LYIVSLFDTFHASRALGFP++SLAYLLE+F+NFKTSKKYQ+ADWR+RPLSKAM +YAR+D
Sbjct: 306 LYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYARAD 365

Query: 387 THFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDPW 446
           THFLLNI+DQ+RN+LV+  KL GVL ESRNVAKRRFEY K+RP + S  VYS +EK DPW
Sbjct: 366 THFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKEDPW 425

Query: 447 KTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVVS 506
           +TLM+QYNIP  +E LLK L++WRD IARRDDESPRYIMPNQL+V+LVAY P +PAGV+S
Sbjct: 426 RTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAGVIS 485

Query: 507 VSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQL 566
            S +VTD+VRSNSKI+ANLIKN LT+ KD       +      +   ST        +++
Sbjct: 486 ASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRST--------DKM 537

Query: 567 SIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYSV 626
           ++ Q+    S F+ +  K+         +++  + N F   +  +        + I+Y  
Sbjct: 538 TVSQIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKL--------DIIEYKN 589

Query: 627 SPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSIPAANAE- 685
              +K  +  ++L+ R   + + + +L  V Y +P+           ++ P +   + E 
Sbjct: 590 G--EKHSVKQQQLVSRFNTYTKQVNELTNVRYELPV----------HKEPPQLQKDDVEE 637

Query: 686 -----ITTAVASRKKEDLDEIIVLKKTNR--NKGKKRERKHSXXXXXXXXXXXXYSKMEK 738
                I  ++ ++ + DLDE++VLKK NR  NK K  E +              YSK EK
Sbjct: 638 VKKTIIADSIPAKPEIDLDEVVVLKKVNRQPNKTKLEENE--------KIDFIDYSKSEK 689

Query: 739 VLDXXXXXXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAMTRGKNVSFK 789
           +L                    FDP+  +NEGP+A +KRK+ TRG+N+S+K
Sbjct: 690 IL-----KGDKQRKKRESKKRQFDPFAASNEGPKAARKRKSGTRGRNLSYK 735

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/769 (50%), Positives = 526/769 (68%), Gaps = 52/769 (6%)

Query: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85
           D LL +VV  +RA+ +LAAQDVDFYR++D+  +K L+  +S+L +M+N ++L++DE+ ++
Sbjct: 25  DVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSIDEHHDS 84

Query: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145
           L+  +E + D WKDF N+MDNLLEKSD S+D L R+ N+N + +++QYL ++SG+D   +
Sbjct: 85  LELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSGKDSQPT 144

Query: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205
           KR  + KPQL+F  P+DN+E+HPFIPLLK KPNALK L +S++++  +EN P HY  PYE
Sbjct: 145 KR--VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYPHPYE 202

Query: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265
           YEID+Q YN  ILQ+   IPS+PW  +  IW+++  +L+SM++DL N  E AVDLEHHDY
Sbjct: 203 YEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLEHHDY 262

Query: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325
           R+YYG+VCLMQ+STR +DY+VDTL+LR  L  LNE FTNP I KV HGAFMDIIWLQRDL
Sbjct: 263 RSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWLQRDL 322

Query: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385
           GLY+V LFDT+HAS+A+G P++SLAYLLE F+NFKTSKKYQ+ADWRIRPLSK M +YAR+
Sbjct: 323 GLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARA 382

Query: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445
           DTHFLLNI+DQ+RNKL++  KLAGVL ESRNVAKRRFEY KYRP+  SS VYSP EK +P
Sbjct: 383 DTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTEKENP 442

Query: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505
           W+ LMYQYNI   +E L+K+LY+WRD IARRDDESPR+IMPNQLL +LVAY P++  GVV
Sbjct: 443 WRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDVIGVV 502

Query: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565
           S+SN VTDHVR N+KILANLIK+ L  +KDT    + I+         S+   +  L E 
Sbjct: 503 SLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIV---------SSKFKSASL-EA 552

Query: 566 LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYS 625
           +++ Q+  +  +F S++S       VT + R+ +   S +L    + +  E+G    + S
Sbjct: 553 ITVSQIRDIMDRF-SVFSS----NSVTED-RSMDSTASSILFGKILPY--EEGDIVYEDS 604

Query: 626 VSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPEN----EIVVVESEQQEPSIPA 681
             P    K+  E++  R + F+ A+  L+ +++ +  P N    E+V +E+  + P+   
Sbjct: 605 GLP---HKVKVEDMRDRAQRFNSALVGLEDIKFEVEKPVNVEKSEMVKIETTPEPPT--- 658

Query: 682 ANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXXYSKMEKVLD 741
                       K ED DE++VLKK   +K +  +R               YSK+  VL 
Sbjct: 659 ------------KIEDPDEVVVLKKKRIHKKQVAKR-----SDVAAEEAVDYSKIPNVL- 700

Query: 742 XXXXXXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790
                              FDP   ++EGPRAPKK++  TRGKNVSFKR
Sbjct: 701 ----SSKPGQNNKQQRKRRFDPSFNDSEGPRAPKKKRPTTRGKNVSFKR 745

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/778 (50%), Positives = 523/778 (67%), Gaps = 53/778 (6%)

Query: 27  QLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSETL 86
           +LL  VV TVRA+ +LAAQDVDFYR++DK  + +L E++ ++ +MIN++LL+++EN+E L
Sbjct: 8   ELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEEL 67

Query: 87  DGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSSK 146
           +  KE LE  WKDFSN+MDNL EKSDRS+D++ RSK +N N S  QYL + +  D   SK
Sbjct: 68  ESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSK 127

Query: 147 RRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYEY 206
           R  + KPQL+F  PVDN+E+ PF+PLL  KP+++KS  +S+ ++P  E +P HYA PYE 
Sbjct: 128 R--VTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEV 185

Query: 207 EIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDYR 266
           EID Q YN  +LQ+++P+ SQPW  + + WVDT E+LQSM+  L  CTE AVDLEHHDYR
Sbjct: 186 EIDKQEYNASVLQVAEPLKSQPW-NSESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYR 244

Query: 267 TYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDLG 326
           +YYGIVCLMQISTR +D++VDTL LR  L  LNE F +P I KVLHGAFMDIIWLQRDLG
Sbjct: 245 SYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLG 304

Query: 327 LYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARSD 386
           LY+VSLFDT+HASRALGFP++SLAYLLEK++NFKTSKKYQ+ADWR+RPLSK M++YAR+D
Sbjct: 305 LYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARAD 364

Query: 387 THFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDPW 446
           THFLLNI+DQ+RN+L+++ KLA VL ESRNVAKRRFEY ++RP + S AV++PIEK +PW
Sbjct: 365 THFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPW 424

Query: 447 KTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVVS 506
           +TL+YQYN+P  K  LLK +++WRD IARRDDESPRYIMPNQL++SLV Y P++PAGV+S
Sbjct: 425 RTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVIS 484

Query: 507 VSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDL---- 562
           VSN++TDHVRSNSK++ANLIK  L  +K                 G  T   N+D     
Sbjct: 485 VSNVMTDHVRSNSKVIANLIKKSLEDMKSVP-------------AGALTAFQNIDYKIGQ 531

Query: 563 ---SEQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGK 619
              S++L+I Q+  + + F  + S  + IE        ++K +  L     +S N+    
Sbjct: 532 KFASDKLTISQIQNMTALFKEIASNPSIIEKDV-----SKKIDPILFSNIFLSKNE---- 582

Query: 620 NFIKYSVSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPEN-EIVVVESEQQEP- 677
             + Y    DK+  +T E+L  R E  +  M +      +I I  + E+ V E E +E  
Sbjct: 583 -IVLY--DHDKRHVVTNEQLAGRAEEVEGFMNEANNTTLAINIESSAEMHVEEPEAKEKN 639

Query: 678 ---SIPAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXXYS 734
              S P +N E  ++  +   ED+++IIVLK     K +   + H             YS
Sbjct: 640 ALFSPPISNVENASSSNTDGFEDMNDIIVLKDV---KKRTNIKDHKKKQGMPNKEVIDYS 696

Query: 735 KMEKVLDXXXXXXXXXXXXXXXXXXXFDPYNVNN--EGPRAPKKRKAMTRGKNVSFKR 790
           K++ +L                     DP+   N  EGP+A KKRK + RGKNVSFKR
Sbjct: 697 KLDTILSKEKRENSKKRKG--------DPFGEENGLEGPKAAKKRKQINRGKNVSFKR 746

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/770 (50%), Positives = 524/770 (68%), Gaps = 46/770 (5%)

Query: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85
           D+LL  +V TVRA+ AL+AQD+DF++S+D   +K+++ ++S+L ++IN VLL++DEN++T
Sbjct: 7   DKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSIDENNDT 66

Query: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145
           ++  K+N +++WKD  ++MDNL EKSD + D L R+ + N  NSN+QYLD+ S  +   S
Sbjct: 67  IEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRN-SINQGNSNVQYLDDSSRSNLNPS 125

Query: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205
           KR  I KPQL F  P+DNTE+HPF PLL++KP+AL+ L E ++  P  EN+P HY  PY 
Sbjct: 126 KR--IEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYG 183

Query: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265
           YEID Q YN+ ILQ+ DPIPSQPW +T  +WVDT ESLQ ++ +L +  E AVDLEHHDY
Sbjct: 184 YEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDY 243

Query: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325
           R+YYGIVCLMQISTR +D++VDT+ LR  L  LNE FT+P + KV HGAFMDIIWLQRDL
Sbjct: 244 RSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDL 303

Query: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385
           G+Y+VSLFDT+HASR+LG P++SLAYLLEKF+ FKTSKKYQ+ADWRIRPL+K M +YAR+
Sbjct: 304 GIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARA 363

Query: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445
           DTHFLLNI+DQ+RN L++  KLA VL +SRNVAKRRFEY  +RP I S+ V+SPIEK +P
Sbjct: 364 DTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEP 423

Query: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505
           W+ LMYQYNIPL++E L+++LY+WRD IARRDDESPRY+MPNQLLVSLVA AP +PAGV+
Sbjct: 424 WRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVL 483

Query: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKD----TTDADSLILQQEQNQPGTSTTTTNVD 561
           SVSN +TD+VRSNSK+L+NLIK  L  +K+    T +A S  L+++             D
Sbjct: 484 SVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEK-------------D 530

Query: 562 LSEQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNF 621
           LS+ LSI Q+  +  QF SL SKV       N+A N+  K S L   DH+  ND      
Sbjct: 531 LSQVLSISQIQNMCLQFNSLASKVKK----ANSATNSMPKVSILFDGDHIFSNDR----- 581

Query: 622 IKYSVSPDKKDKITTEE--LLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSI 679
              +V   K  KI  +E  L +R+    + ++++Q+ ++ + +    +   E+++    +
Sbjct: 582 ---AVLYSKNSKIVIDENQLQERKLEVSEKLKEVQEPDFRLHV---NVTTKETDEVSKDV 635

Query: 680 PAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXXYSKMEKV 739
              +     +     + + DEIIVLKK  R++ + R++               Y   EK+
Sbjct: 636 SEKDDVNRASETDPLETNKDEIIVLKKKKRHEPQDRKK----VGNSTDVEPMDYKNAEKL 691

Query: 740 LDXXXXXXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAMTRGKNVSFK 789
           L                    FDPY   N GP++ KKRK  T GKN+SFK
Sbjct: 692 LG-----NSKKSSKQKTTKRRFDPYTSENVGPQSAKKRKKPTPGKNMSFK 736

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/765 (50%), Positives = 520/765 (67%), Gaps = 38/765 (4%)

Query: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85
           D LL +V+  VRA+ +LA+QDVDFY+++D+  +K LK    +LADM N ++L++DE+ E+
Sbjct: 7   DVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSIDEHHES 66

Query: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145
            +  +E++ D W +F N+MDNLLE SD S+D L  + N+ +  S++QYL E+SG++ + +
Sbjct: 67  FELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSGKNFSPT 126

Query: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205
           KR  + KPQL+F  P+DN+E+HPFIPLLK KPNALK L ES++L+  DEN P HY  PYE
Sbjct: 127 KR--VEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYE 184

Query: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265
           YEID+Q Y+ +ILQ+ + IPS+ W ++  IWVDT   L+SM++DL N  E AVDLEHHDY
Sbjct: 185 YEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDY 244

Query: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325
           R+YYGIVCLMQISTR +DY+VDTLKLR +L  LNE FTNP I KV HGAFMDIIWLQRDL
Sbjct: 245 RSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDL 304

Query: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385
           GLY+V LFDT+HAS+A+G P++SLAYLLE F+NFKTSKKYQ+ADWRIRPLSK M +YAR+
Sbjct: 305 GLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARA 364

Query: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445
           DTHFLLNI+DQ+RNKL++  KLAGVL ESRNVAKRRFEY KYRPL  SS VYSPIEK  P
Sbjct: 365 DTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESP 424

Query: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505
           WK LMYQYNIP  +E+L++ELYQWRD IARRDDESPR++MPNQLL +LVAY P +  GVV
Sbjct: 425 WKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVV 484

Query: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565
           S++N VT+HVR N+K+LANLI++ L  IK+T +  + I       P + T    + L E 
Sbjct: 485 SLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPI-------PSSETKADGI-LLET 536

Query: 566 LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYS 625
           +S+ Q+  +  +F S+    N      + +R     NS +L    +   + D    I YS
Sbjct: 537 ISVPQIRDVMERF-SVLCNSN-----ISKSRAKPVTNSSILLGKILPREEHD----IAYS 586

Query: 626 VSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSIPAANAE 685
                 +K+ TE++  R + F  A+  L+ + + I  P   +V V+ E+ +   PA+   
Sbjct: 587 -KDGLPNKVKTEDIRIRAQNFKSALANLEDIIFEIEKP--LVVPVKLEEIKTVDPASAPN 643

Query: 686 ITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXXYSKMEKVLDXXXX 745
            +  +     ++LD+++VLKK N  K +  + K              YSK+  +L     
Sbjct: 644 HSPEI-----DNLDDLVVLKKKNIQKKQPAKEK-----GVTEKDAVDYSKIPNIL----- 688

Query: 746 XXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790
                          FDP + ++ GPRA KKR+   +GKN+SFKR
Sbjct: 689 SNKPGQNNRQQKKRRFDPSSSDSNGPRAAKKRRPAAKGKNLSFKR 733

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/777 (49%), Positives = 521/777 (67%), Gaps = 49/777 (6%)

Query: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85
           D+LLP VV +VRA+ ALAAQDVDFYRS+DK  A +L  T+ ++ DMINS++ +VDENSE 
Sbjct: 4   DELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEG 63

Query: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145
           L   KENL+++WKD  NL+D+L E +D S+D L ++   ++N+  M+YL++    +  + 
Sbjct: 64  LVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNV 123

Query: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205
            R  + KPQL F VPVDN+ETHPF PLL  KPNA+  LDE ++++   E+ P+HY QPYE
Sbjct: 124 TR--LSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYE 181

Query: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265
            EID Q YN+++LQ SDPIPS+ W ET AIWVD  ESL +M+ +L   TE AVDLEHHD+
Sbjct: 182 TEIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDF 241

Query: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325
           R+YYGI CLMQISTR  DY+VDT+ LR  LQ LN  FT+P+ITK+LHGAFMDIIWLQRDL
Sbjct: 242 RSYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDL 301

Query: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385
           GLYIVSLFDT+HASRALGFP++SLAYLLE+F++FKTSK+YQ+ADWR RPLSKAMN+YAR+
Sbjct: 302 GLYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARA 361

Query: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445
           DTHFLLNIFDQ+RN L+Q+ KLA +L ESR VAKRRFEY KY+P + SSAV+SP E   P
Sbjct: 362 DTHFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMP 421

Query: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505
           W++++YQYNIP  K  L+K L++WRD IARRDDESPRYIMPNQL+ SLV Y P  PAGV+
Sbjct: 422 WRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVI 481

Query: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565
           SV+ M+TD VRSN+K +ANLIK+ L  +K+   + +++          STT  + + S  
Sbjct: 482 SVNRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVV----------STTAKDKETSSN 531

Query: 566 -LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKY 624
            LS  Q+  + SQF ++  K +      N+  + E K+S +       FN  D  + I Y
Sbjct: 532 DLSTSQIKFIVSQFENILEKYSSNNSNLNDVTSKEGKDSLVFSK---IFNSRD--DIITY 586

Query: 625 SVSPDKKDK--ITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSIPAA 682
               DK  K  IT ++L  R++  D AM+Q +++ +S+ + +     ++    EP    +
Sbjct: 587 ----DKGTKHLITEQQLSDRQKEVDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVIS 642

Query: 683 NAEITTAVASRKKEDLDEIIVLKKT-------NRNKGKKRERKHSXXXXXXXXXXXXYSK 735
            + +       ++EDLDEIIVLK T       +R +G+  +  H+            YSK
Sbjct: 643 QSHLPAFEDKEEQEDLDEIIVLKDTKDRRNRQHRGRGRSADSDHT---------VIDYSK 693

Query: 736 MEKVLDXXXXXXXXXXXXXXXXXXXFDPYNV-NNEGP-RAPKKRKAMTRGKNVSFKR 790
            +K+L                    +DP++  NNE   +  K+R+   + +NVSFKR
Sbjct: 694 GDKIL-------SQDNRRRTPNKRKYDPFSADNNENALQGAKRRRPTAKNRNVSFKR 743

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/767 (50%), Positives = 501/767 (65%), Gaps = 39/767 (5%)

Query: 27  QLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSETL 86
           +LL + V TVRAS +L  QDV F+ ++D   A ++KE  +++ +MIN +L ++DENS+  
Sbjct: 8   KLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDENSKPF 67

Query: 87  DGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTN-NSNMQYLDEYSGRDDTSS 145
             + E + ++W+DF+NL DNL EKSDRSMD++ +    N    S +QYLD+  G D +S 
Sbjct: 68  AESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLVGNDSSSG 127

Query: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205
           KR  I KPQL F  PVDN+E+ PF PLL  KPNALK L ES+Q++P  EN+P HY  PY+
Sbjct: 128 KR--ITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNPYD 185

Query: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265
           YEI NQ YN+ IL+   PIPS PW E+  +WVD+ E LQS++KDL    E A+DLEHHDY
Sbjct: 186 YEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHHDY 245

Query: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325
           R+YYGIVCLMQISTR  DY+VDT+ LR  L  LN+ FT+P +TKV HGAFMDIIWLQRDL
Sbjct: 246 RSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQRDL 305

Query: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385
           GLYIVSLFDTFHAS+ALGFPK+SLAYLLE  +NFKTSKKYQ+ADWRIRPLSK M+ YAR+
Sbjct: 306 GLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYARA 365

Query: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445
           DTHFLLNIFDQMRN+L++D KLAGVL ESR VAKRRFEY K+RP +    V++PIEK  P
Sbjct: 366 DTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPIEKESP 425

Query: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505
           W+TLM+QYN+   KE L+K LY+WRD IARRDDESPRYIMPNQLL+SL AY P +P  +V
Sbjct: 426 WRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVSLV 485

Query: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565
           SV++ VTD VRSNSK+LANLIK+ +   K        +  Q    P T  T+T       
Sbjct: 486 SVNSYVTDCVRSNSKVLANLIKSFVESSK--------LGPQSSYTPNTENTSTPF----V 533

Query: 566 LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFND-EDGKNFIKY 624
           L++ Q+  +  +F  L     + +  +    +  +++SF        F D   GK  + Y
Sbjct: 534 LTLSQIKDIGMRFTKL---TENFQSSSCQKISPLQRSSF--------FGDLSKGKVTVSY 582

Query: 625 SVSPDKKDKITTEELLK-REEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSIPAAN 683
           +   D K    ++ +L+ R + F++ M+    +EY IP     ++ +       S  +A+
Sbjct: 583 N---DAKTTPVSQSVLESRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTESAD 639

Query: 684 AEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXXYSKMEKVLDXX 743
           ++         KED+DEI+VLKK  R   K +                 YSK +KVL   
Sbjct: 640 SKTVEKPPKNIKEDMDEIVVLKKVKRELPKPKGNDED-----AEREIVDYSKEDKVL--- 691

Query: 744 XXXXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790
                            FDP++  +EGP+APKKRKA+T+GKN SFKR
Sbjct: 692 VQRQFDKKKKNNNNKKRFDPFSAISEGPKAPKKRKAVTKGKNASFKR 738

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/776 (51%), Positives = 525/776 (67%), Gaps = 52/776 (6%)

Query: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85
           +QLLP+VV TVRA+ ALAAQDVDFYRS+DK  AK+L +T+++L  MINS LL +D+NS  
Sbjct: 7   EQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCIDQNSRL 66

Query: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145
           L+G KE LED+ KDFSNLMDNL EKSDRS+D +LR +  +   + + YLD+ +  D   +
Sbjct: 67  LEGGKEKLEDSRKDFSNLMDNLFEKSDRSLD-ILRGRAPDRKGAALMYLDDAARSDMIPA 125

Query: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205
           KR  I KPQ+ F  P+DNTETHPF PLL++KP+AL+ L + ++L+  DE++PEHY QPYE
Sbjct: 126 KR--ILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYPQPYE 183

Query: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265
           YEI+NQ YN+ IL++++PIPS+PW  +  +WVD  ESL SM++DL   TE AVDLEHHDY
Sbjct: 184 YEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEHHDY 243

Query: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325
           R+YYGIVCLMQ+STR  DY+VDTL LR  L  LNE F NP I KV HGAFMDIIWLQRDL
Sbjct: 244 RSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQRDL 303

Query: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385
           GLYIVSLFDT+HASRALGFP++SLAYLLE F++FKTSKKYQ+ADWR+RPLSKAM++YAR+
Sbjct: 304 GLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAYARA 363

Query: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445
           DTHFLLNI+DQ+RNKL+ + KLAGVL ESRNVAKR F+Y KYRP + +S+VYSP+++ D 
Sbjct: 364 DTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDRADG 423

Query: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505
           WK LM QYNIPL KE+L+K LY+WRD IARRDDESPRY+MPNQLL  LV Y P++P GV+
Sbjct: 424 WKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPTGVI 483

Query: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565
           SVS  VTDHVR+N+K LANLI   L +I D      +   Q ++Q          DLS+ 
Sbjct: 484 SVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQH---------DLSQV 534

Query: 566 LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTD-HMSFNDEDGKNFIKY 624
           L++ Q+ +  SQF  L SK    +G++    ++   +S +     H          F+ Y
Sbjct: 535 LTVGQIESQVSQFHDL-SKA--FKGLSQGTNSSNSSSSIIFGNILHAPC------GFVGY 585

Query: 625 SVSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSIPAANA 684
             S   K  +T +++ KR+    +A+E +   E +  I E +     + +     PA + 
Sbjct: 586 GRS--LKKPVTDKQIEKRKLELSEALEFI-DAETATTIQEEDRGSELTHE-----PADDK 637

Query: 685 EIT--------TAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXXYSKM 736
           +++         A  +  +ED +EII LKK  +++GKK +R +             Y K 
Sbjct: 638 KVSENDESKKEEAKETEPEEDKNEIITLKKV-KDRGKKSKRSNE----SEPEEPIDYKKS 692

Query: 737 EKVLDXXXXXXXXXXXXXXXXXXXFDPYNVNNEGPRA--PKKRKAMTRGKNVSFKR 790
           +K+L                    FDPY  +N+   A  PKK++ M RGK+ SFKR
Sbjct: 693 KKIL-------ETEKKSKSTKKRAFDPYAASNDAGNAPKPKKKRRMARGKSASFKR 741

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/771 (51%), Positives = 510/771 (66%), Gaps = 46/771 (5%)

Query: 25  KDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSE 84
           +DQLL +VV T+RAS ALAAQDVDF+RS+ +   K+L ET++++  +INS+L ++D+NSE
Sbjct: 6   EDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSE 65

Query: 85  TLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTS 144
            L   KE L + WKDFSN+MDNL E SD S D+L R+  +  +   +++LD  S  D   
Sbjct: 66  PLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIP 125

Query: 145 SKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPY 204
           SKR  I KPQL F  PV+NTE  PF+PLLK KP AL+ L   I  +P ++ VPEHYAQPY
Sbjct: 126 SKR--ISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDI--VPGNDAVPEHYAQPY 181

Query: 205 EYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHD 264
           EYEI++Q Y + ++  S+PIPS+PW  T A+WVD  E L++MI DL + TE AVDLEHHD
Sbjct: 182 EYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHD 241

Query: 265 YRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRD 324
           YR+YYGIVCLMQISTR +DY++DT+ LR  LQ LNE F NP+I KV HGAFMDIIWLQRD
Sbjct: 242 YRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRD 301

Query: 325 LGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYAR 384
           LGLY+VSLFDTFHASRA+G P++SLAYLLEKF+NFKTSKKYQ+ADWR+RPLSKAMN+YAR
Sbjct: 302 LGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYAR 361

Query: 385 SDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKID 444
           +DTHFLLNI+DQ+RN L++  KLAGVL ESRNVAKRRFEY K+RP+  S  VY PI+K D
Sbjct: 362 ADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPD 421

Query: 445 PWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGV 504
           PWK LM+QY+I   +E L+K+LY WRD IARRDDESPRY+MPNQLLV L   AP EP  V
Sbjct: 422 PWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINV 481

Query: 505 VSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTN-VDLS 563
           +SV+++VTDHVRSNS +LA+LIKN L      +D             GT     N  D +
Sbjct: 482 ISVNSIVTDHVRSNSLVLAHLIKNTLASSDKESDK------------GTFEADNNSTDAA 529

Query: 564 EQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIK 623
             L++ Q+  L + F  +      ++    + R++       + TD ++ +++D  N++ 
Sbjct: 530 SLLTVPQIQKLAACFAGVSRAFTILQNEYKDGRSSS------IFTDILT-SEDDAVNYVG 582

Query: 624 YSVSPDKKDKITTEELLKREEMFDQAMEQLQQV-EYSIPIPENEIVVVESEQQEPSIPAA 682
                +  D IT +EL KR     Q+MEQ  +   Y +PIPE   +  ES   E   P A
Sbjct: 583 -----NNMDHITKKELGKRAAKALQSMEQFDEATSYYMPIPE---IAKESNTMEEIRPPA 634

Query: 683 NAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXXYSKMEKVLDX 742
             E+  +  S  KED+DEII LKK  + K +  +                Y+K +KVL  
Sbjct: 635 PEEVKES-PSPPKEDMDEIITLKKIKKQKSQSPKE---LGISEREIPAVDYTKTKKVL-- 688

Query: 743 XXXXXXXXXXXXXXXXXXFDPYNVNN---EGPRAPKKRKAMTRGKNVSFKR 790
                             FDPY  +N   + PRAPKKRK + R +NVSFKR
Sbjct: 689 ----ATNQDKNKDKKKRKFDPYAASNHSSDAPRAPKKRKPVNRERNVSFKR 735

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/778 (48%), Positives = 506/778 (65%), Gaps = 63/778 (8%)

Query: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85
           D L  ++V+ VRA+ +LA+QDVDFY+++++  +  LK  + +L DM+N ++L++DE+ E+
Sbjct: 7   DVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDEHHES 66

Query: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145
            +  ++ +   WKDF N+MDNLLE SD S+D L  + N+  + + +QYL ++SG+D  S+
Sbjct: 67  FELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKDSLST 126

Query: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205
           KR  + KPQL+F   +DN+E+HPFIPLLK KPNALK L ES++L   +EN P HY  PY 
Sbjct: 127 KR--LEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYLHPYA 184

Query: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265
           YEID+Q Y+  +LQ+   IPS+ W ++  IW+DT   L  M++DL N +E AVDLEHHDY
Sbjct: 185 YEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHHDY 244

Query: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325
           R+YYGIVCLMQ+STR +DY+VDT++LR  L  LNE FT+P I KV HGAFMDIIWLQRDL
Sbjct: 245 RSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQRDL 304

Query: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385
           GLY+V LFDT+HAS+A+G P++SLAYLLE F+NFKTSKKYQ+ADWR RPLSK M +YAR+
Sbjct: 305 GLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYARA 364

Query: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445
           DTHFLLNI+DQ+RNKL++  KLAGVL ESRNVAKRRFEY K+RP   SS VYSPIEK +P
Sbjct: 365 DTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKENP 424

Query: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505
           W+ LMYQYNI   KE L+K+LY WRD IARRDDESPR++MPNQLL +LVAYAP++  GVV
Sbjct: 425 WRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIGVV 484

Query: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565
           S++N VT+HVR N+K+LANLI+N L  IKDT    + I   E    G S         E 
Sbjct: 485 SLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSESKPDGISL--------EV 536

Query: 566 LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYS 625
           ++I Q+  +  +F SL S      GV NN        S +L    + F +E G ++ K  
Sbjct: 537 ITISQIRDIMERF-SLLSN----SGVINNRTKTGDSTSSILLGKTLPF-EECGISYGKKG 590

Query: 626 VSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIP--------ENEIVVVESEQQEP 677
                 +K+  E++  R + F+ A+  L+ + + +  P        + E V +ES  + P
Sbjct: 591 TP----NKVKVEDIKARAQKFNSALAGLENIMFELEKPVTVPASVEKGEAVEIESAPELP 646

Query: 678 SIPAANAEITTAVASRKKEDLDEIIVLKKTNRN-----KGKKRERKHSXXXXXXXXXXXX 732
           S               K E  D+IIVLKK   +     KGK    K +            
Sbjct: 647 S---------------KAESFDDIIVLKKKKMHKKQPAKGKDMTVKEA----------VD 681

Query: 733 YSKMEKVLDXXXXXXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790
           YSKM  VL                    FDP + ++EGPRA KK++   RGKN+SFKR
Sbjct: 682 YSKMPSVL-----SSKPGQNRKQQRKRRFDPSSNDSEGPRAAKKKRPAPRGKNMSFKR 734

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/773 (49%), Positives = 511/773 (66%), Gaps = 47/773 (6%)

Query: 22  QSPKDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDE 81
           Q+P D LL +VV  +RA+ +LA QDVDFY+++D+   K LK  + +LADM N ++L++DE
Sbjct: 44  QNP-DVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDE 102

Query: 82  NSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRD 141
           + E+ +   E++   W DF N+MDNLLE SD S+D L R+  +  N +++QYL ++S ++
Sbjct: 103 HHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSEKN 162

Query: 142 DTSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYA 201
            + +KR  + KPQL+F  P+DN+E+HPFIPLLK KPNALK L +S++L+  D+N P HY 
Sbjct: 163 LSPAKR--VEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220

Query: 202 QPYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLE 261
            PYEYEID+Q Y   ILQ+   IPS+ W ++  IW+DT   L+SM+++L N  E AVDLE
Sbjct: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280

Query: 262 HHDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWL 321
           HHDYR+YYGIVCLMQISTR +DY+VDTL+LR  L  LNE FT+P I KV HGAFMDIIWL
Sbjct: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340

Query: 322 QRDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNS 381
           QRDLGLY+V LFDT+HAS+A+G P++SLAYLLE F+NFKTSKKYQ+ADWRIRPLSK M +
Sbjct: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400

Query: 382 YARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIE 441
           YAR+DTHFLLNI+DQ+RNKL++  KLAGVL ESRNVAKRRFEY KYRP I SS VYSPIE
Sbjct: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460

Query: 442 KIDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEP 501
           K  PW+ LMYQYNI   KE L+K+LYQWRD IARRDDESPR++MPNQLL +LVAY P++ 
Sbjct: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520

Query: 502 AGVVSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVD 561
            GV+S++N +T+HVR N+K+L NLIKN L  IKDT   DS +   E       + T  V 
Sbjct: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSE-------SMTNEVS 573

Query: 562 LSEQLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNF 621
           L E ++I Q+  +  +F S+ S  N      +N R        +L    +   + D    
Sbjct: 574 L-EAITIPQIRDIMERF-SVLSNSN-----VSNCRAKNGATPSILLGRILPLEEND---- 622

Query: 622 IKYSVSPDKKDKITTEELLKREEMFDQAMEQLQ----QVEYSIPIPENEIVVVESEQQEP 677
           I Y  +    +++  E++  R + F+ A+  L+    +VE    +P N +  +E    E 
Sbjct: 623 IAYK-NNGLPNRVKFEDIRARAQSFNSALSNLEDCMLEVEKPHILPTN-VKKIERINTE- 679

Query: 678 SIPAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXXYSKME 737
            +P  +A I         E+ D+I+VLKK N ++ +    K +            YSK+ 
Sbjct: 680 DVPKHSATI---------ENPDDIVVLKKKNIHRTQSMNAKDT-----MGEKAIDYSKIP 725

Query: 738 KVLDXXXXXXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790
            VL                     DP   +++GPRA KK++  TRG+NVSFKR
Sbjct: 726 NVLSSKSDQNRRQQKKRRS-----DPLFNDSDGPRAAKKKRPATRGRNVSFKR 773

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/509 (66%), Positives = 419/509 (82%), Gaps = 2/509 (0%)

Query: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85
           D +L +V++TVRAS ALA+QDV+F++S+D + A +L+++   +A ++N++LL++D N+E 
Sbjct: 7   DNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSIDNNNEK 66

Query: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145
           LDGT ENLE+  K+FSN+MD L EK+DRS+D+L R  +TN N  NMQ+LD+ +  ++  S
Sbjct: 67  LDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVAENDPS 126

Query: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205
           +R  I KPQL F  PVDN+E+HPF PLL  KPNALKS++ES QL+   E++PEH+ QPYE
Sbjct: 127 RR--ISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQPYE 184

Query: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265
           YEI NQ YN+ IL+  +PIPS  W++T AIWVD   SLQ M+++L   +E AVDLEHHD+
Sbjct: 185 YEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEHHDF 244

Query: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325
           R+YYG+VCLMQISTRTQDYIVDT+ LR  L+ LNE FTNP ITKV HGAFMDIIWLQRDL
Sbjct: 245 RSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQRDL 304

Query: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385
           GLYIVSLFDTFHAS+ALG PK+SLAYLLEK++NFKTSKKYQ+ADWR RPLSKAM +YAR+
Sbjct: 305 GLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAYARA 364

Query: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445
           DTHFLLNIFDQMRN L+  GKLAGVL+ESRNVA RRFEY KY+P I  + +++P+EK  P
Sbjct: 365 DTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEKESP 424

Query: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505
           W+TLMYQYNIP+ KE L++ELY+WRD +ARRDDESPRY+MPNQLLVSLVAY PV+P  VV
Sbjct: 425 WRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPISVV 484

Query: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIK 534
           SVS++VTDHVR NSK LANLIK  L +IK
Sbjct: 485 SVSSVVTDHVRRNSKTLANLIKKKLEEIK 513

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/769 (48%), Positives = 511/769 (66%), Gaps = 33/769 (4%)

Query: 25  KDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSE 84
           KD LL  +VQTVR+S ALAAQD+DFY+S+D     +L++T++ +  +IN +LL++D N++
Sbjct: 6   KDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSIDPNND 65

Query: 85  TLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTS 144
            +   K++  D+WK  SN+MDNL EKSD ++D +      N    +++YL++    ++  
Sbjct: 66  VIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDRSNNKP 125

Query: 145 SKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPY 204
           SKR  I KPQL F  PVDNTE HPF PLL+ KP++L+  + S++++P +E++P HY  PY
Sbjct: 126 SKR--IEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYPHPY 183

Query: 205 EYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHD 264
           EYEID+Q YND IL  ++PIPS+ W ET AIWVDT E L  M  +L+  TE A+DLEHHD
Sbjct: 184 EYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLEHHD 243

Query: 265 YRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRD 324
           YR+YYGIVCLMQIS R  D+IVDT+ LR  L  LN+ FT+P +TKVLHGAFMDIIWLQRD
Sbjct: 244 YRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWLQRD 303

Query: 325 LGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYAR 384
           LGLYIV LFDT+HASR LGFPK+SLAYLLE+F+NFKTSKKYQ+ADWRIRPL+K M +YAR
Sbjct: 304 LGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAYAR 363

Query: 385 SDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKID 444
           +DTHFLLNIFD++RN L++  K++ VL ESR VAKRRFEY  +RP + SSAV+SPIEK +
Sbjct: 364 ADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIEKDE 423

Query: 445 PWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGV 504
           PWK +M+QYNIP +KELLL+ LY+WRD IARRDDESPRY+MPNQLLVSLVA AP EP  V
Sbjct: 424 PWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEPINV 483

Query: 505 VSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSE 564
           +SVS+ V++H+R+NSK++ANLIK  L  +K  +++ ++ L +     GT       DL+ 
Sbjct: 484 LSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGT-------DLAN 536

Query: 565 QLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKY 624
            ++  Q+ ++++ F SL S++N      NN +N+EK   F         ++ D    ++Y
Sbjct: 537 IITTSQIKSIQNIFHSLASEIN--SQKLNNEQNSEKSVLF------NGISNLDVNTAVRY 588

Query: 625 SVSPDKKDKITTEELLKREEMFDQAMEQ--LQQVEYSIPIPENEIVVVESEQQEPSIPAA 682
           +  P  +  I   ELLKR+    + +EQ    +   SI +P NE    E+  Q  +    
Sbjct: 589 T--PKTRTLIPQHELLKRQHEITRTLEQEYTDRQAQSIVLPSNE---DEAPTQVSNDENR 643

Query: 683 NAEITTAVASRK-KEDLDEIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXXYSKMEKVLD 741
           N  IT+  +  + +E+ DE+I L+K       KR+                Y+    +L+
Sbjct: 644 NEVITSDPSQEEIEENKDEVITLRKRQSQSNNKRK----TISPPASHEIMDYAAGSDLLN 699

Query: 742 XXXXXXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAMTRGKNVSFKR 790
                              FDPY+V + GP+  KK+    +GKNVSFKR
Sbjct: 700 STKNNTNSQKHKKRR----FDPYSVEHVGPQPIKKKSKPAKGKNVSFKR 744

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/776 (48%), Positives = 500/776 (64%), Gaps = 47/776 (6%)

Query: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85
           ++LL  +V  VRAS ALAAQDVDFY+S+DK  + +L +T +   D+ NS+LL++DEN   
Sbjct: 32  EELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDENCSP 91

Query: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145
           L+  K+ + D W  FSN+MDNL+EKSD  +D L +  N N   +   +LD  S  +   S
Sbjct: 92  LEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSRTNSNPS 151

Query: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205
           KR  I KPQL F  PVDNT++ PF PLL  KPNALK L +S+ L+P    VP HY QPYE
Sbjct: 152 KR--IEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQPYE 209

Query: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265
           YEIDNQ YN++++++ DP P +PW  T+AIW+DT ESL  ++ DL   +E AVDLEHHD 
Sbjct: 210 YEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEHHDL 269

Query: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325
           R+YYGI CLMQISTR QDYIVDT+ LR  L  LNE FTNP ITKV HGA MDIIWLQRDL
Sbjct: 270 RSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQRDL 329

Query: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385
           GLYIVSLFDTFHAS+ALG  ++SLAYLLE +++FKTSKKYQ+ADWR RPL+  M +YARS
Sbjct: 330 GLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAYARS 389

Query: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445
           DTHFLLNIFDQ+RN L++  KLAGVL ESRNVAKRRFEY+K+RP +    +Y+ IEK  P
Sbjct: 390 DTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIEKEAP 449

Query: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505
           WK+L+ QYNI   KE+L+++L++WRD IARRDDESPRYIMP Q+L+SL++Y P + +GV+
Sbjct: 450 WKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSSGVI 509

Query: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565
           SVSNMVT+HVRSNS  LANLIK  L   K        I     +    + + T+ +++  
Sbjct: 510 SVSNMVTEHVRSNSTTLANLIKKALESTKS-------IPNSSDSSSTFNMSRTDTNVASL 562

Query: 566 LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYS 625
           +SI ++N +  +F SL    N  + +T+       + S LL ++ M+ + +         
Sbjct: 563 ISITEINNICLKFNSLSKHYNTSKFLTSGI-----EVSSLLFSNIMTSSPKIS------D 611

Query: 626 VSPDKKDKITTEELLKREEMFDQAMEQLQ---QVEYSIPIPENEIVVVESEQQEPSI-PA 681
            S DK     +E+++ R     + ++ L       Y  P+ + + + + +E   P++ P 
Sbjct: 612 YSKDKTTSFKSEDMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPK 671

Query: 682 ANAEITTAVASRKKEDLDEIIVLKKTNR--NKGKKRERKHSXXXXXXXXXXXXYSKMEKV 739
           +  + TT   +   ED +EIIVLKK NR   KGKK   K S            YSK +K+
Sbjct: 672 STQKKTTKEIN---EDNEEIIVLKKVNRKYQKGKKDADKDS-------TVVVDYSKAKKI 721

Query: 740 LDXXXXXXXXXXXXXXXXXXXFDPYNVNNEG-----PRAPKKRKAMTRGKNVSFKR 790
                                FDPY  NN+G     PRA KKR+  TRGKN+S+KR
Sbjct: 722 F----QKKDETINGNSKKRKSFDPY--NNDGDTDKVPRALKKRQTNTRGKNISYKR 771

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/777 (47%), Positives = 484/777 (62%), Gaps = 49/777 (6%)

Query: 25  KDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSE 84
           +D L  ++V T+RA+ AL+AQD+DFYRS+  +  + L +T++ +  +IN +LL+VDEN+ 
Sbjct: 6   EDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDENNN 65

Query: 85  TLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTS 144
            L   ++N ED+WK+ SN+MDN+ EKSD + D +    ++     NMQYL + S  D T 
Sbjct: 66  ELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSHDDSTP 125

Query: 145 SKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPY 204
           SKR  I KPQL F  PVDNTE HPF PLLK KP+ALK L+ES+ L P +ENVP HY  PY
Sbjct: 126 SKR--IEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYPHPY 183

Query: 205 EYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHD 264
           EYEID QPYND +L++ + I  QPW  T  IWVD  ESL  M+ +L    E AVDLEHHD
Sbjct: 184 EYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLEHHD 243

Query: 265 YRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRD 324
           YR+YYGIVCLMQIS+R++D++VDT+ LR  L  LN    +P + KV HGAFMD+IWLQRD
Sbjct: 244 YRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWLQRD 303

Query: 325 LGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYAR 384
           LGLY+VSLFDT+HASRALGFPK+SLAYLLE F+ FKTSKKYQ+ADWR+RPL K +  YAR
Sbjct: 304 LGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRDYAR 363

Query: 385 SDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKID 444
           SDTHFLL+I+D +RN LV+ GKLA VL  SRNVAKRRFEY  +RP I  S VYSPIE  +
Sbjct: 364 SDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIESTE 423

Query: 445 PWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGV 504
           PW+ LMYQYN+P +KE LLK+LY+WRD +ARRDDES RY+MPNQLLVSLV+ +P E AGV
Sbjct: 424 PWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSETAGV 483

Query: 505 VSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSE 564
           +SVS  VTD+VRSN++ LANLIK  L  IK  T + +     E+     + T        
Sbjct: 484 LSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAAT-------- 535

Query: 565 QLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMS---FNDE--DGK 619
            LS+H +  L   F SL  +               +K S  +C+ H S   FN +   G 
Sbjct: 536 -LSLHMIQNLDDHFRSLLMEA--------------QKQSGSICSQHSSSLLFNSDLATGP 580

Query: 620 NFIKYSVSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPSI 679
           + ++Y+    +K  I    L  R+    Q     Q VE   P+ + E    +S  + P +
Sbjct: 581 SAVEYTNG--QKHVIGDNVLQTRKHALLQKFTS-QPVE---PVTDIEAPSHQSSSENPQV 634

Query: 680 -----PAANAEITTAVASRKKEDLD--EIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXX 732
                P+   E    V  + + D +  EI+VL+K  +   +K +   S            
Sbjct: 635 SEDISPSEPQESQNEV-QKDEPDFEKSEIVVLRKKKKAHAQKPKGTSS-----SPTETVD 688

Query: 733 YSKMEKVLDXXXXXXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAMTRGKNVSFK 789
           YS  ++VL                    FDPY  +N  P   KK+   ++GK++SFK
Sbjct: 689 YSNAKEVLGKGTSSTAKRGDKDRPRKRKFDPYGQDNNAPSGVKKKNKPSKGKSISFK 745

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/518 (57%), Positives = 397/518 (76%), Gaps = 3/518 (0%)

Query: 18  ANEKQSPKDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLL 77
           A  ++  +  +L QVV T+RAS A++AQDVDFY+S+D T +++L ET+++L  +IN V++
Sbjct: 2   AKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVI 61

Query: 78  AVDENSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEY 137
           ++D+N++ ++  +  LE++W +   +MD L EKS+ ++   ++ K +N   +N+QYLD+ 
Sbjct: 62  SIDDNNDLIEPGRAGLENSWNNIGEVMDLLFEKSEHAL-AAMKKKGSNIIGNNLQYLDDS 120

Query: 138 SGRDDTSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVP 197
               DT+  +  I KPQ  F  PVDNTE+HPF PLL  KPNAL+ LD+ +QL   +E +P
Sbjct: 121 QPLTDTTLTK--ITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIP 178

Query: 198 EHYAQPYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFA 257
            HY  PYEYEID+Q Y++ +L++  PIPS+PW ET A WVD   +L  MI++L+   E A
Sbjct: 179 AHYPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELA 238

Query: 258 VDLEHHDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMD 317
           +DLEHHDYRTYYGI CLMQISTR  D++VDT+ LR HL  LNE FTNP++ KV HGAFMD
Sbjct: 239 IDLEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMD 298

Query: 318 IIWLQRDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSK 377
           +IWLQRDLGLY+VSLFDTFHASR LGFPK+SLAYLLE++++FKTSKKYQ+ADWRIRPLSK
Sbjct: 299 VIWLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSK 358

Query: 378 AMNSYARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVY 437
            + +YAR+DTHFLLNI+DQMRN L++ GKLA  L  SR VAKRRFEY K+RP + +S VY
Sbjct: 359 PLKAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVY 418

Query: 438 SPIEKIDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYA 497
           SP+E+ DPW++L++ YNIP +K  LLK LY+WRD IARRDDESPRY+MPNQLLV+LV  A
Sbjct: 419 SPVEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNA 478

Query: 498 PVEPAGVVSVSNMVTDHVRSNSKILANLIKNCLTKIKD 535
           P +  G++SV++ VT+HVRSN+K L+ LIK  L   +D
Sbjct: 479 PTDTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQD 516

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/693 (49%), Positives = 462/693 (66%), Gaps = 38/693 (5%)

Query: 25  KDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSE 84
           KD LL +++ TVRA+ +LAAQD+DF R +D +  + L ET+  +  ++N V+L+  + + 
Sbjct: 6   KDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKANN 65

Query: 85  TLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTN--NSNMQYLDEYSGRDD 142
            L+  K+NLE  WKD SN++DNL EKSD S+D+L +  +++++  ++NMQYL+  S RD 
Sbjct: 66  DLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVDSQRDG 125

Query: 143 TSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQ 202
             S+R  I KPQL+F +PVDN+E HPF PLLK KP+ALK L+E   L    E VP HY  
Sbjct: 126 KLSQR--IVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHYPH 183

Query: 203 PYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEH 262
           PYEYEIDNQPY+D +L + +PI    W E   IWVD   +L  M+  L N  E AVDLEH
Sbjct: 184 PYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDLEH 243

Query: 263 HDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQ 322
           HDYR+YYG+VCLMQISTR  D++VDT+ LR  LQ LNE FT+P I KV HGAFMDIIWLQ
Sbjct: 244 HDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIWLQ 303

Query: 323 RDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSY 382
           RDLGLY+VSLFDT+HASRALGFPK+SLAYLLE F+NFKTSKKYQ+ADWRIRPLSK M +Y
Sbjct: 304 RDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMKTY 363

Query: 383 ARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEK 442
           AR+DTHFLLNI+D++RN L+++ KL+GVL  SRNVAKRRFEY  +RP + S  V+SPIEK
Sbjct: 364 ARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSPIEK 423

Query: 443 IDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPA 502
            DPW+TLM QYN+P  KE L+++LY+WRD +AR+DDES RY+MPNQLLVSLV  AP +P+
Sbjct: 424 DDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSDPS 483

Query: 503 GVVSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDL 562
           G+++V + + DHVR+N+++L N+I   + +IK  +          + Q   + TTT V  
Sbjct: 484 GLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGS---------HEGQSIENVTTTYVSA 534

Query: 563 SE-QLSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFND--EDGK 619
            + ++S+  + T+   F  L  +V           +A + +S  +C D + F     D  
Sbjct: 535 QDPEMSVSLIKTMDRHFKFLLDEVQ---------SHAVEPSS--VCEDSLLFKGFLFDKP 583

Query: 620 NFIKY-SVSPDKKDKITTEELLKREEMFDQAMEQLQQVEYSIPIPENEIVVVESEQQEPS 678
             + Y SV    K  +   ELL R+    Q   ++ +    I I  + I  + S  + P+
Sbjct: 584 KAVAYNSVG---KRLVNDRELLDRKSDLSQKFSKVFKAA-GIAI-GSHIEKLSSNSELPA 638

Query: 679 IPAANAEITTAVASRK-----KEDLDEIIVLKK 706
              +N E  +   S+      KED  EIIVLK+
Sbjct: 639 DTTSNVESPSKEESKNNSDDLKEDKHEIIVLKR 671

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/774 (44%), Positives = 490/774 (63%), Gaps = 43/774 (5%)

Query: 18  ANEKQSPKDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLL 77
           A    S    +L QV+ T+RAS A+ AQDV FY+++D + A ++   +++L  +IN +LL
Sbjct: 2   AQAHGSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILL 61

Query: 78  AVDENSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEY 137
           +VDEN++ ++   E LE  W +   +MD L EKS+ ++    +  N   + + +QYLD+ 
Sbjct: 62  SVDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKT-VQYLDDS 120

Query: 138 SGRDDTSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVP 197
               D + K+  I KPQL F  P+DN+E+HPF PLLK KP+AL+SLDES++L    E+VP
Sbjct: 121 PSLHDGAPKK--ILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVP 178

Query: 198 EHYAQPYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFA 257
            HY QPYEYEID+Q YN+ +LQ+S+P+PS PW ET A WVD  ++L+ M+ +L    E A
Sbjct: 179 AHYPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIA 238

Query: 258 VDLEHHDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMD 317
           +DLEHHDYRTYYGI CLMQISTR +D+++DT+ LR  L  LNE FT+P+ITKVLHGAFMD
Sbjct: 239 IDLEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMD 298

Query: 318 IIWLQRDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSK 377
           IIWLQRDLGLYIVSLFDT+HASR LG PK+SLAYLLE++++FKTSKKYQ++DWR+RPL K
Sbjct: 299 IIWLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPK 358

Query: 378 AMNSYARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVY 437
           A+ +YAR+DTHFLLNI+D MRN L++  KL+ VL +SRNVAKRRFE+  +RP I +S V+
Sbjct: 359 ALKAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVF 418

Query: 438 SPIEKIDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYA 497
           SPIE+ DPW+TLM+QYNIP +K LL++ LY+WRD +ARRDDESPRY++PNQLLVSL   A
Sbjct: 419 SPIEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNA 478

Query: 498 PVEPAGVVSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTT 557
           P  PA +++ S  VT+H+R N+K LA LIK  L       ++ S    Q  N   T   +
Sbjct: 479 PTTPALIMATSTFVTEHIRQNAKSLALLIKKSL-------ESSSNEFGQLLNSANTVQNS 531

Query: 558 TNVDLSEQLSIHQLNTLKSQFLSLYSKVNHIE-GVTNNARNAEKKNSFLLCTDHMSFNDE 616
           +   +S +  I + + +  +FL  +S     + G++  +   +KK  F+ C +++S+  E
Sbjct: 532 SPTKMSSE-DIEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKK--FVPCEEYVSYQ-E 587

Query: 617 DGKNFIKYSVSPDKKDKITTEELLKREEMFDQAMEQLQ-QVEYSIPIPENEIVVVESEQQ 675
              + + ++   +++ +++     K E   D A  Q+  +   S  + + E    ++E  
Sbjct: 588 SRASLVDHNSLENRRHQVSK----KYEAERDIARPQVHIRAASSHAVCDKEAGAEDNESA 643

Query: 676 EPSIPAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSXXXXXXXXXXXXYSK 735
           E    A            +KE++DE+IVLK+  +    K +R  +               
Sbjct: 644 EEENKA------------RKEEMDEVIVLKQ-RKTLADKEQR--AVDKATPSIEPLDLQS 688

Query: 736 MEKVLDXXXXXXXXXXXXXXXXXXXFDPYNVNNEGPRAPKKRKAMTRGKNVSFK 789
             K+L+                   FDPY     GP + KKRK  T+G   SF+
Sbjct: 689 ARKILE-------APSNNVRRPKKRFDPYATLAAGPPSVKKRKK-TKGLQKSFR 734

>KAFR0G00420 Chr7 (122124..123248) [1125 bp, 374 aa] {ON} Anc_8.860
          Length = 374

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 346 KNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARSDTHFLLNIF 394
           K  L  L  + +NF  + +YQ+A W+ R  ++  + +  +D HF  NIF
Sbjct: 114 KGDLMNLFSEDTNFIENSRYQVALWKYRKRNRQSSCFGLNDIHFCRNIF 162

>TPHA0K01610 Chr11 complement(341899..344268) [2370 bp, 789 aa] {ON}
           Anc_4.107 YGL009C
          Length = 789

 Score = 35.8 bits (81), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 397 MRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDPWKTLMYQYNIP 456
           M N  ++ G  AG++K  +      F+YVK RPL  S A +   + +  WKTL    N  
Sbjct: 227 MCNMSIEAGARAGMIKPDQTT----FDYVKGRPLAPSGAEWD--KAVAYWKTLYTDENAK 280

Query: 457 LAKELLL 463
             KE+++
Sbjct: 281 FDKEIII 287

>Smik_8.10 Chr8 complement(22475..23146) [672 bp, 223 aa] {ON}
           YHL031C (REAL)
          Length = 223

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 54  DKTTAKTLKETTSQLADMINSVLLAVDENSET-------LDGTKENLEDNWKDFSNLMDN 106
           +K   K L+E  SQ  D+I+S+    D N          L   KE L+D+WK F N+  +
Sbjct: 43  EKKIDKQLEEILSQRQDVIDSLTQICDSNPAISASKLSQLQRHKEILQDHWKSFRNIRSS 102

Query: 107 LLEKSDRSMDMLLRSKNTNTNNS 129
           + ++ +R +++L   KN   N++
Sbjct: 103 IQQERNR-LNLLFSVKNDIANST 124

>NDAI0A03320 Chr1 (753952..756288) [2337 bp, 778 aa] {ON} Anc_4.107
           YGL009C
          Length = 778

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 397 MRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDPWKTLMYQYNIP 456
           M N  ++ G  AG++K      ++ FEY+K RPL+ + A +   + +  WKTL       
Sbjct: 232 MCNMSIEAGARAGMIKPD----EKTFEYLKGRPLVPTGAEWE--KGLAFWKTLHSDEGAK 285

Query: 457 LAKELLLK 464
              E+++K
Sbjct: 286 FDHEIVIK 293

>TDEL0G01800 Chr7 (361298..361978) [681 bp, 226 aa] {ON} Anc_4.11
           YHL031C
          Length = 226

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 23/116 (19%)

Query: 30  PQVVQTVRA-SVALAAQD---VDFYRSMDKTTA-----------KTLKETTSQLADMINS 74
           PQ   TVR+ +++L +Q    +  Y S  +TT+           K L+E  S+  ++I S
Sbjct: 4   PQSFVTVRSQAISLESQAESLLSRYSSFAQTTSSEATGKEKNLDKLLEENISKRREVIES 63

Query: 75  VLLAVDENSET-------LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKN 123
           +    DEN          +   KE L+++WK+F N+  ++ ++ +R +++L   KN
Sbjct: 64  LTHICDENPNISASKLSQVQRHKEVLQEHWKNFRNIRSSIQQERNR-LNLLFSVKN 118

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
           (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 11/98 (11%)

Query: 523 ANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQLSIHQLNTLKSQFL--- 579
            N IKN L K  D TD  +LI+  E N         N+ L + L I  LN L ++ L   
Sbjct: 65  CNKIKNVLLKFNDITDNKNLIITNENNDKILKVNLQNIILQKNL-ISLLNVLSNKSLEYE 123

Query: 580 -------SLYSKVNHIEGVTNNARNAEKKNSFLLCTDH 610
                  SL S +   + V + +R  +++ S L  TDH
Sbjct: 124 IELERKKSLRSNLTKTKEVKSKSRFKKRRVSNLNSTDH 161

>Skud_8.13 Chr8 complement(26793..27464) [672 bp, 223 aa] {ON}
           YHL031C (REAL)
          Length = 223

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 8/83 (9%)

Query: 54  DKTTAKTLKETTSQLADMINSVLLAVDENSET-------LDGTKENLEDNWKDFSNLMDN 106
           +K   K ++E   Q  D+I+S+    D N          L   KE L+D+WK F N+  +
Sbjct: 43  EKKIDKQVEEILGQRQDVIDSLTQICDANPAISASKLSQLQRHKEILQDHWKSFRNIRSS 102

Query: 107 LLEKSDRSMDMLLRSKNTNTNNS 129
           + ++ +R +++L   KN   N++
Sbjct: 103 IQQERNR-LNLLFSVKNDIANSA 124

>ZYRO0D06842g Chr4 (591212..591928) [717 bp, 238 aa] {ON} similar to
           uniprot|Q12255 Saccharomyces cerevisiae YLR093C NYV1
           v-SNARE component of the vacuolar SNARE complex involved
           in vesicle fusion inhibits ATP-dependent Ca(2 )
           transport activity of Pmc1p in the vacuolar membrane
          Length = 238

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 57  TAKTLKETTSQLADMINSVLLAVDENSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMD 116
           T   L +    + D  +  LL+  ++ E  DGT+ +L+D ++  ++ +D  L++ +R   
Sbjct: 124 TDSQLNQRICNVLDRFHGELLSYRDSGEHGDGTEADLQDIFQVMNDNIDKFLQRQERL-- 181

Query: 117 MLLRSKNTNTNNSNMQY 133
            LL  K +  NN+++ +
Sbjct: 182 SLLVDKTSQLNNNSLTF 198

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 86,263,923
Number of extensions: 4082803
Number of successful extensions: 16302
Number of sequences better than 10.0: 196
Number of HSP's gapped: 17151
Number of HSP's successfully gapped: 198
Length of query: 790
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 672
Effective length of database: 39,950,811
Effective search space: 26846944992
Effective search space used: 26846944992
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)