Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0D008306.23ON37437417770.0
KNAG0D02240singletonON35932011291e-154
NCAS0H008406.23ON36031111201e-152
KAFR0A050806.23ON31130410941e-149
SAKL0E01342g6.23ON34130110931e-149
KNAG0M011906.23ON38030010861e-147
ZYRO0C07722g6.23ON37330710831e-147
CAGL0F01815gsingletonON31429410541e-143
NCAS0D021706.23ON31030010521e-143
CAGL0I08151gsingletonON38230010521e-142
KNAG0K01400singletonON30929410451e-142
TDEL0G044606.23ON36931910391e-140
TPHA0M002806.23ON30330110241e-139
Kpol_1061.27singletonON30630410231e-139
KLTH0C11154g6.23ON30529510211e-138
NDAI0C026206.23ON31130110131e-137
Kpol_385.5singletonON30630410091e-136
Kwal_56.224396.23ON32030610071e-136
KAFR0G026806.23ON38330010121e-136
KLLA0D01243g6.23ON3113019591e-129
NDAI0J003407.535ON63687760.68
Ecym_44463.432ON85559695.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0D00830
         (374 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   689   0.0  
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   439   e-154
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   436   e-152
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   426   e-149
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   425   e-149
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   422   e-147
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   421   e-147
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   410   e-143
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   409   e-143
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   409   e-142
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   407   e-142
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              404   e-140
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   399   e-139
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   398   e-139
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   397   e-138
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      394   e-137
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   393   e-136
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   392   e-136
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     394   e-136
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   374   e-129
NDAI0J00340 Chr10 complement(56120..58030) [1911 bp, 636 aa] {ON...    34   0.68 
Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar t...    31   5.0  

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/374 (90%), Positives = 339/374 (90%)

Query: 1   MSEXXXXXXXXXXXFYRYXXXXXXXXXXXXXXXXSISMSKTKEXXXXXXXXVFTNKNIVN 60
           MSE           FYRY                SISMSKTKE        VFTNKNIVN
Sbjct: 1   MSEPIPPTPKTKKPFYRYFKFLATLLLFLVPLIFSISMSKTKEQQPQQHQQVFTNKNIVN 60

Query: 61  EDIARIATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQ 120
           EDIARIATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQ
Sbjct: 61  EDIARIATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQ 120

Query: 121 GFPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGR 180
           GFPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGR
Sbjct: 121 GFPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGR 180

Query: 181 PGIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLA 240
           PGIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLA
Sbjct: 181 PGIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLA 240

Query: 241 YTPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIK 300
           YTPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIK
Sbjct: 241 YTPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIK 300

Query: 301 GQSATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSI 360
           GQSATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSI
Sbjct: 301 GQSATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSI 360

Query: 361 ADGIDEDTANALLN 374
           ADGIDEDTANALLN
Sbjct: 361 ADGIDEDTANALLN 374

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  439 bits (1129), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 207/320 (64%), Positives = 251/320 (78%), Gaps = 4/320 (1%)

Query: 54  TNKNIVNEDIARIATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHF 113
           T  N  N D   + +    R+I  +FIP E +EGVGARV+R++G+ +  RF PFLMLD F
Sbjct: 43  TRTNTTNNDYT-MPSLFKLRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDF 101

Query: 114 KVTPPEQGFPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMP 173
            V  P  GFPDHPHHGQETITY++DG+IAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMP
Sbjct: 102 TVKSP-SGFPDHPHHGQETITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMP 160

Query: 174 VLMKDGRPGIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGV 233
           V M+DGRP  GLQLWVDLP++LKNCEPRYRNLR  +IP+V   +  ++ V+VISG +YG 
Sbjct: 161 VEMEDGRPARGLQLWVDLPKDLKNCEPRYRNLRSEDIPVVKPHE--NLEVRVISGKSYGT 218

Query: 234 DSVRDLAYTPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFN 293
           +SV+DLAYTPI FY+ ++ KAG EF Q +P DFN FLYVMKG+VVI++++FKQNTA+FF+
Sbjct: 219 ESVKDLAYTPIDFYYMLASKAGTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFD 278

Query: 294 VDGHSIKGQSATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERA 353
            DG  + GQ+ ++DTEFAIIGGKILDQPLVQHGPFVET +E LY+ F NY+    GFERA
Sbjct: 279 TDGEGVAGQAGSDDTEFAIIGGKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERA 338

Query: 354 VNWRSSIADGIDEDTANALL 373
             WRS IA GI+E  A  LL
Sbjct: 339 KGWRSDIASGINESEAKQLL 358

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  436 bits (1120), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 206/311 (66%), Positives = 254/311 (81%), Gaps = 4/311 (1%)

Query: 59  VNEDIARIATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPP 118
           VNED A  A +   R+ILK+FI +EQSEG GA VRR++G+ +M RF PFLMLD FKVTPP
Sbjct: 49  VNEDSAT-AESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPP 107

Query: 119 EQGFPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKD 178
           E GFPDHPHHGQETITY+  G++AHEDFTGSKGVL PGDLQFMTAGKGIVH EMPV M D
Sbjct: 108 E-GFPDHPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMND 166

Query: 179 GRPGIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRD 238
                GLQ WVDLP +LKNCEPRYRNLR + IP+V  +D  ++ VKVISG +Y V+SV+D
Sbjct: 167 SAVSTGLQFWVDLPADLKNCEPRYRNLRADTIPVVQVND--NLNVKVISGKSYDVESVKD 224

Query: 239 LAYTPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHS 298
           LAYTPI FY++IS+KAG EF Q +P DFN F+YV KGA+ I +++FK +++VFF  DG+ 
Sbjct: 225 LAYTPIDFYYFISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNF 284

Query: 299 IKGQSATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRS 358
           I+G +A+++TEFA+IGGKILDQ +VQHGPFVETTRE L +VF+NY+ GINGFE+A+ W+S
Sbjct: 285 IRGFTASDNTEFAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKS 344

Query: 359 SIADGIDEDTA 369
           SI++GIDE TA
Sbjct: 345 SISNGIDEQTA 355

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  426 bits (1094), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 201/304 (66%), Positives = 251/304 (82%), Gaps = 6/304 (1%)

Query: 66  IATTDDA---RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGF 122
           +ATT++A   RTI K+F+  EQ EGVGARVRR++G+     F PFL+LDHF V+ P  GF
Sbjct: 1   MATTENATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHP-AGF 59

Query: 123 PDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPG 182
           PDHPHHGQETITY+ +GMIAHEDFTGSKG+LRPGDLQFMTAGKGI+HSE+PVLM++G  G
Sbjct: 60  PDHPHHGQETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAG 119

Query: 183 IGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYT 242
           +GLQLWVDLP+E+K+CEPRYRNLR  EIPIV  ++  H+ VKVISG +YGV+SV++LAYT
Sbjct: 120 VGLQLWVDLPQEMKDCEPRYRNLRGGEIPIVEPNE--HLKVKVISGRSYGVESVKELAYT 177

Query: 243 PIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQ 302
           P+ FYH+IS+K G +F Q  P++FN FLYVMKG+V I D+ F Q + +FFN DG+ IKG 
Sbjct: 178 PVDFYHFISNKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGV 237

Query: 303 SATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIAD 362
            + +DTEFAIIGG ILDQP++QHGPF+E+TRE L +VF+N+Q GINGFERAV W+SSI +
Sbjct: 238 VSDDDTEFAIIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRN 297

Query: 363 GIDE 366
           GI E
Sbjct: 298 GILE 301

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  425 bits (1093), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 194/301 (64%), Positives = 244/301 (81%), Gaps = 3/301 (0%)

Query: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132
           RTI K+F+  EQSEGVGARVRR+IGT ++  F PFLMLDHF VTPP  GFPDHPHHGQET
Sbjct: 41  RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPA-GFPDHPHHGQET 99

Query: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192
           ITY+L GM+AHEDFTGSKGVLRPGDLQFMTAGKGIVHSE+PV M+ G P +GLQLWVDLP
Sbjct: 100 ITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLP 159

Query: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252
             LKNCEPRYR+LR  E PI   +  +++ V+VISG +YGV S  +LAYTP+HFYH+IS 
Sbjct: 160 ERLKNCEPRYRDLRGAETPIA--EPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISS 217

Query: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312
           K G  F+Q  P+DFNVF+YV+KG++ ++ + F Q +A+FF  DG  ++G +A++DTEFA+
Sbjct: 218 KKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFAL 277

Query: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANAL 372
           +GG IL+QP+VQHGPFVET++E + +VF++YQ G+NGFERA NW+SSI+DGI +  A   
Sbjct: 278 VGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEKQ 337

Query: 373 L 373
           L
Sbjct: 338 L 338

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  422 bits (1086), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/300 (66%), Positives = 242/300 (80%), Gaps = 3/300 (1%)

Query: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132
           RTI K+FI  EQ EGVGARVRR++G+     F PFL+LDHF V+ P  GFPDHPHHGQET
Sbjct: 76  RTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPA-GFPDHPHHGQET 134

Query: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192
           ITY+ +GMIAHEDF GSKGVLRPGDLQFMTAGKGI+HSE+PVLM++G  G+GLQLWVDLP
Sbjct: 135 ITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 194

Query: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252
           +++K+C PRYRNLR  EIPI   ++  H+ +KVISG ++G+DSV++LAYTP+ FYHYISD
Sbjct: 195 KDMKDCAPRYRNLRGTEIPIAEPNE--HLKIKVISGKSHGIDSVKELAYTPVDFYHYISD 252

Query: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312
           K G  F Q VP +FNVFLYVMKGAV ID Q+F Q + VF+N +G +I+G    +DTEFAI
Sbjct: 253 KKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAI 312

Query: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANAL 372
           IGG ILDQP++QHGPFVETTRE + +VF+N+Q GINGFERAV W+SSI +GI E    A 
Sbjct: 313 IGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPAF 372

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  421 bits (1083), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 241/307 (78%), Gaps = 3/307 (0%)

Query: 66  IATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDH 125
           ++ +   R++LK FI  EQ EGVGARVRR+IGT +M RFPPFLMLD F V PP  GFPDH
Sbjct: 67  MSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPP-AGFPDH 125

Query: 126 PHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGL 185
           PHHGQETITY L GMIAHEDFTGSKGVL PGDLQFMTAGKGIVHSE+PV ++DG    GL
Sbjct: 126 PHHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGL 185

Query: 186 QLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIH 245
           QLWVDLP ELKNCEPRYR+LRK + P V  +D  ++TV+VISG +YGVDSV++LAYTP+H
Sbjct: 186 QLWVDLPAELKNCEPRYRDLRKKQTPEVKVND--NLTVRVISGKSYGVDSVQELAYTPVH 243

Query: 246 FYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSAT 305
           FYH+I+ K G EF Q  P DFNVF Y++KG++ ++DQ+F +++AVFF+ DG  + G S +
Sbjct: 244 FYHFITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVS 303

Query: 306 NDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGID 365
           +D EF +IGGKILDQ ++QHGPFVET+RE +  VF NYQ G+NGFE A +W S IA GI 
Sbjct: 304 DDAEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGIS 363

Query: 366 EDTANAL 372
           E  A  L
Sbjct: 364 EAEARKL 370

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  410 bits (1054), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/294 (66%), Positives = 238/294 (80%), Gaps = 3/294 (1%)

Query: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132
           R+I K+F+  EQ EGVGARVRR++GT +   F PFLMLD F V  P  GFPDHPHHGQET
Sbjct: 5   RSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPA-GFPDHPHHGQET 63

Query: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192
           ITY+L+GM+AHEDFTG+KGVL  GDLQFMTAGKGIVHSE+PV M+ G    GLQ WVDLP
Sbjct: 64  ITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWVDLP 123

Query: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252
           ++LK CEPRYRNLR ++IP+V  ++  ++TVKVISG +YGVDSVRDLAYTPIH YHY+++
Sbjct: 124 KDLKWCEPRYRNLRGDKIPVVRPNE--NLTVKVISGKSYGVDSVRDLAYTPIHMYHYLTN 181

Query: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312
           KAG +++Q  P +FNVF+YVMKG V + DQ+F ++TAVFFN DG ++KG+ AT+D +FAI
Sbjct: 182 KAGTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFAI 241

Query: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDE 366
           +GG+ILDQ  +QHGPFVET RE L KVF NYQ GINGFERA  W+SSI  GI E
Sbjct: 242 MGGQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITE 295

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  409 bits (1052), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 192/300 (64%), Positives = 237/300 (79%), Gaps = 3/300 (1%)

Query: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132
           R++LK F+  EQ EGVGA VRR+IG+ +   F PFL++D+F V+ P  GFPDHPHHGQET
Sbjct: 8   RSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHP-AGFPDHPHHGQET 66

Query: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192
           ITY+L GMIAHEDFTGS+GVLRPGDLQFMTAGK I+HSE+PV M +G  GIG+QLWVDLP
Sbjct: 67  ITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLP 126

Query: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252
           ++LKNCEPRYRNLR  EIPIV  +D+  +TV+V+SG +YGV+SV+DLAYTPI +Y   + 
Sbjct: 127 KKLKNCEPRYRNLRATEIPIVKPNDD--LTVRVVSGKSYGVESVKDLAYTPIDYYFMNTK 184

Query: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312
           K G EF Q  P DFNVFLY++KG+V I+D +  Q + +FF  DG +IKG SA+ DTEF +
Sbjct: 185 KTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVL 244

Query: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANAL 372
           +GG+ILDQP++QHGPFVE+ RE L +VF+NYQ  INGFERA  WRS IADGI ED   A 
Sbjct: 245 VGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAF 304

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  409 bits (1052), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 239/300 (79%), Gaps = 3/300 (1%)

Query: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132
           R+IL +FI  EQ EGVGARVRR++GT +M RF PFLMLD F V PP  GFPDHPHHGQET
Sbjct: 83  RSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPP-NGFPDHPHHGQET 141

Query: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192
           ITY+ DGMIAHED TGSKGVL  GDLQFMTAGKGIVHSE+PV  KDG+P  GLQLWVDLP
Sbjct: 142 ITYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLP 201

Query: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252
            ++KN +PRYRNLR NE P+ + ++  ++ V+VISG +YGV+S+RDLAYTP+H YH++++
Sbjct: 202 SDMKNIDPRYRNLRGNETPVAYPNE--NLEVRVISGKSYGVESLRDLAYTPVHLYHFLAN 259

Query: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312
           K G EF Q +P+DFNVF+YVMKG++ ++D      ++ FF+VDG++I+G++ + D +FAI
Sbjct: 260 KTGTEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAI 319

Query: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANAL 372
           I G+ILDQ ++QHGPFVET RE L +VF NYQ+  NGFE A +WRSSI DGI E+ A  L
Sbjct: 320 IAGRILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEALKL 379

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  407 bits (1045), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 188/294 (63%), Positives = 234/294 (79%), Gaps = 3/294 (1%)

Query: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132
           R++ K F   EQ+EGVGA VRR+IG      F PFL+LDHF V+ P  GFPDHPHHGQET
Sbjct: 6   RSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPS-GFPDHPHHGQET 64

Query: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192
           ITYI  GMIAHEDFTGSKG+LRPGDLQFMTAGKGIVHSE+PVL KD +  +GLQLWVDLP
Sbjct: 65  ITYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLP 124

Query: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252
           + +K+C PRYRNLR +EIPI   ++  H+ VKVISG +YGV+SV++LAYTP+ FYHYISD
Sbjct: 125 KNMKDCPPRYRNLRASEIPIAQPNE--HLKVKVISGKSYGVESVKELAYTPVDFYHYISD 182

Query: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312
           K G+ F Q +P+++N FLYVM+G+VV+D Q + Q + +F+N +G++IKG +   +TEFAI
Sbjct: 183 KEGINFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFAI 242

Query: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDE 366
           I G ILDQ +VQHGPFVET+ E + +VF NYQ GINGFE+A+NW SSI +GI E
Sbjct: 243 IAGLILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITE 296

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  404 bits (1039), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 185/319 (57%), Positives = 243/319 (76%), Gaps = 6/319 (1%)

Query: 54  TNKNIVNEDIAR---IATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLML 110
           T++ I+ + I++   ++ T   R+I+K F+  +Q EGVGA VRR+IGT +M RF PFLML
Sbjct: 43  TSRKIITDFISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLML 102

Query: 111 DHFKVTPPEQGFPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHS 170
           DHF V+PP  GFPDHPHHGQETITY+L GM+AHEDF+ SKG+L PGDLQFMTAGK I+HS
Sbjct: 103 DHFTVSPPA-GFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHS 161

Query: 171 EMPVLMKDGRPGIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNA 230
           E+PV M  G+P +GLQLWVDLP +LKNCEPRYR+L+  +IP++   +  H+ V VISG +
Sbjct: 162 EIPVKMDSGQPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSE--HLKVTVISGTS 219

Query: 231 YGVDSVRDLAYTPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAV 290
           YGV S RDLAYTP+H+YH+ + K G EF Q  P  FN F+Y++KG++ I +++F Q + V
Sbjct: 220 YGVQSARDLAYTPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTV 279

Query: 291 FFNVDGHSIKGQSATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGF 350
           FF+ DG +++G SA+++ EF +IGG+IL Q +VQHGPFVET RE L +VF NYQ  INGF
Sbjct: 280 FFDTDGDAVEGFSASDNAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGF 339

Query: 351 ERAVNWRSSIADGIDEDTA 369
           +R  NWRS+IA GI E  A
Sbjct: 340 DRGRNWRSTIAGGITESEA 358

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  399 bits (1024), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 188/301 (62%), Positives = 234/301 (77%), Gaps = 3/301 (0%)

Query: 69  TDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHH 128
           + + R+ILK+FI  EQ+EGVGARVRR+IGT +M +F PFLMLDHF V PP  GFPDHPHH
Sbjct: 2   SQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPP-AGFPDHPHH 60

Query: 129 GQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLW 188
           GQETITY+  GM+AHEDFTGSKG+LRPGDLQFMTAGK + HSEMPVLM++G    GLQLW
Sbjct: 61  GQETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLW 120

Query: 189 VDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYH 248
           VDLP  LKN EPRYR+L K  IPI   D+  ++ ++VISG +YG++SV+DLAYTP+ FY 
Sbjct: 121 VDLPTNLKNTEPRYRDLHKENIPIAKPDE--NLEIEVISGKSYGIESVKDLAYTPVDFYV 178

Query: 249 YISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDT 308
           Y + K G  F Q    D+NVFLY++KG+V I +++F Q++++FFN DG +++G   ++DT
Sbjct: 179 YKARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDT 238

Query: 309 EFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDT 368
           EFAIIGG+IL Q  VQHGPFVE T E L KVF NY+    GFERA+NWRSSI +GIDE  
Sbjct: 239 EFAIIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQ 298

Query: 369 A 369
           A
Sbjct: 299 A 299

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  398 bits (1023), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 196/304 (64%), Positives = 230/304 (75%), Gaps = 3/304 (0%)

Query: 66  IATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDH 125
           ++   + R+I K+FI  EQSEGVGARVRR+IGT  + +F PFLMLDHF V P   GFPDH
Sbjct: 1   MSKQQNLRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPG-AGFPDH 59

Query: 126 PHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGL 185
           PHHGQETITY+ +GMIAHEDFTG KGVL  GDLQFMTAGK I H+EMPV    G   +GL
Sbjct: 60  PHHGQETITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGL 119

Query: 186 QLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIH 245
           QLWVDLP ++KN EPRYR+LR  +IP  +  D+  + ++VISGN+YGVDSV+DLAYTPI 
Sbjct: 120 QLWVDLPTDMKNTEPRYRDLRNKDIPRANPTDD--LEIEVISGNSYGVDSVKDLAYTPID 177

Query: 246 FYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSAT 305
           FY Y   KAG EF Q    DFNVF+YV+KGAV I DQ+F Q +++FFN DG ++ G  A 
Sbjct: 178 FYMYRGKKAGTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAA 237

Query: 306 NDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGID 365
           +DTEFAIIGGKILDQ  VQHGPFVE T+E L KVF +YQ   NGFERA NWRSSI DGI 
Sbjct: 238 DDTEFAIIGGKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIK 297

Query: 366 EDTA 369
           ED A
Sbjct: 298 EDDA 301

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  397 bits (1021), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 237/295 (80%), Gaps = 3/295 (1%)

Query: 70  DDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHG 129
           +  R+ILKYF   EQSEGVGA+VRR+IG+ E+  F PFLMLDHF V+PP  GFPDHPHHG
Sbjct: 2   NKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPA-GFPDHPHHG 60

Query: 130 QETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWV 189
           QETITY+L GMIAHEDFTGS+GVLRPGDLQFMTAGKGI+HSE+PV ++ G P +GLQLWV
Sbjct: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120

Query: 190 DLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHY 249
           DLP  LK+CEPRYR+L  NEIP V    +  + V+VISG +YGV S+ +LAYTP+HFYHY
Sbjct: 121 DLPMHLKDCEPRYRDLLNNEIPSVQ--PKAGLEVRVISGESYGVGSMSELAYTPVHFYHY 178

Query: 250 ISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTE 309
           I+ K G  F+Q  P +FNVF+YV+KG+V+++ + F Q ++VFFN DG  ++G  ++ ++E
Sbjct: 179 ITRKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESE 238

Query: 310 FAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGI 364
           F +IGG++LDQP++Q+GPFVET+++++Y+V  NYQ G NGFERA  W SSIA G+
Sbjct: 239 FILIGGEVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGV 293

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  394 bits (1013), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 193/301 (64%), Positives = 238/301 (79%), Gaps = 4/301 (1%)

Query: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132
           R++ K FI  EQ EGVGA VRR+IG+ +   F PFL++DHF V+ P  GFPDHPHHGQET
Sbjct: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHP-AGFPDHPHHGQET 66

Query: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192
           ITY+L+GMIAHEDFTGSKGVLRPGDLQFMTAGK I+HSE+PV M++G PGIG+QLWV LP
Sbjct: 67  ITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALP 126

Query: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252
            +LKN EPRYRNLR ++IPI+  ++  ++TV+VISG +YG +SV+DLAYTPI +Y +  +
Sbjct: 127 IDLKNSEPRYRNLRGDKIPIIKPNE--NLTVRVISGKSYGTESVKDLAYTPIDYYIFNMN 184

Query: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATN-DTEFA 311
           K GVEF Q  P +FN FLY+ KGAV I+  ++ + + VFF+ DG SIKG+SA + +TEFA
Sbjct: 185 KKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFA 244

Query: 312 IIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANA 371
           IIGG ILDQP++QHGPFVET RE L +VF+NYQ  INGFERA  WRSSIADGI E    A
Sbjct: 245 IIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDVPA 304

Query: 372 L 372
            
Sbjct: 305 F 305

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  393 bits (1009), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 191/304 (62%), Positives = 231/304 (75%), Gaps = 3/304 (0%)

Query: 66  IATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDH 125
           ++   + R+I K+FI  EQ+EGVGARVRR+IGT  + +F PFLMLDHF V P   GFPDH
Sbjct: 1   MSKQQNLRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGA-GFPDH 59

Query: 126 PHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGL 185
           PHHGQETITY+ +GMIAHEDFTG KGVL  GDLQFMTAGK I H+EMPV    G   +GL
Sbjct: 60  PHHGQETITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGL 119

Query: 186 QLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIH 245
           QLWVDLP ++KN EPRYR+L+  EIP  +  D+  + V+VISGN+YGVDSV+DLAYTPI 
Sbjct: 120 QLWVDLPTDMKNTEPRYRDLKNKEIPRANPTDD--LEVEVISGNSYGVDSVKDLAYTPID 177

Query: 246 FYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSAT 305
           FY Y   KAG EF Q+   DFNVF+YV++GA+ I DQ+F Q +++FFN DG ++ G  A 
Sbjct: 178 FYMYRGKKAGTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAA 237

Query: 306 NDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGID 365
           ++TEFAIIGGKILDQ  VQHGPFVE T+E L KVF +YQ   NGFERA NW+SSI DGI 
Sbjct: 238 DNTEFAIIGGKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIK 297

Query: 366 EDTA 369
           E+ A
Sbjct: 298 ENDA 301

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  392 bits (1007), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 232/306 (75%), Gaps = 3/306 (0%)

Query: 62  DIARIATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQG 121
           DI        AR+ILKYF   EQSEGVGA+VRR+IGT ++  F PFLMLDHF + PP  G
Sbjct: 8   DIEHSELMKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPA-G 66

Query: 122 FPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRP 181
           FPDHPHHGQET+T+IL G +AHEDFTGSKGVLR GDLQFMTAGKG VHSE+PV ++ G P
Sbjct: 67  FPDHPHHGQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDP 126

Query: 182 GIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAY 241
             G+QLWVDLP  LK+C+PRYR+L+++ IP   + +   + + VISG +YGVDS+++LAY
Sbjct: 127 TEGIQLWVDLPARLKDCQPRYRDLKRDRIPTARSKNG--LNISVISGQSYGVDSIQELAY 184

Query: 242 TPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKG 301
           T +H+YHY+  +A + F+Q  P DFNVFLYV+KG + I  Q F +++++FF  DG  + G
Sbjct: 185 TSVHYYHYVFSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSG 244

Query: 302 QSATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIA 361
            S +ND EF + GG+ILDQP+VQ+GPFVET++E + +VF+NYQ G NGFE+A  W SSIA
Sbjct: 245 FSGSNDLEFILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIA 304

Query: 362 DGIDED 367
           +GI E 
Sbjct: 305 NGIVES 310

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  394 bits (1012), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 187/300 (62%), Positives = 238/300 (79%), Gaps = 3/300 (1%)

Query: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132
           R+I+ +FIP+E  EG GARV+R+IG++E  RF PFLMLD F VTPP  GFPDHPHHGQET
Sbjct: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPP-AGFPDHPHHGQET 143

Query: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192
           ITY+L GMIAHEDFTG  G+L PGDLQFMTAG+GIVHSE+PV M++G    GLQLWVDLP
Sbjct: 144 ITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLP 203

Query: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252
           ++LK  EPRYRNLR  +IPI    +  ++ V VISG +Y V+S+ DLAYTP+H YH+++ 
Sbjct: 204 QDLKTIEPRYRNLRAADIPIAMPYE--NLKVYVISGKSYDVESLNDLAYTPVHLYHFVTI 261

Query: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312
           KAG  F Q  P DFNVFLYV+KGAV+I+++IFK+NTA+FF+VDG SI+GQ AT+D+EF +
Sbjct: 262 KAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVL 321

Query: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANAL 372
           +GG+IL+QP+VQ GPFVET ++ L +VF++++   NGFERA NW S+I  GI E  A  L
Sbjct: 322 VGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEAREL 381

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  374 bits (959), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 227/301 (75%), Gaps = 3/301 (0%)

Query: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132
           R++LK+F+  EQSEG GA V+R+IGT +M  FPPFLMLD+F V+PP  GFP+HPHHGQET
Sbjct: 10  RSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPP-AGFPEHPHHGQET 68

Query: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192
           ITY+L GM+AHEDFTGSKGVLR GDLQFMTAGK IVHSE+PV M +G    GLQLWVDLP
Sbjct: 69  ITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLP 128

Query: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252
            ++KN EPRYR+LR+ EIP+    D  ++ VKVISG +YGV S+ +LAYTP+ FYH+I++
Sbjct: 129 NDIKNVEPRYRDLRREEIPLATPSD--NLIVKVISGESYGVKSLTELAYTPVEFYHFIAN 186

Query: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312
           K   EF Q   DDF+ F+Y+MKG++ I DQ + +++A+FF  DG  I+G + +++ EFAI
Sbjct: 187 KKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAI 246

Query: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANAL 372
           I GK  +Q +VQ+GPFVE++RE++  V +NYQ G+NGFE A  W   I +G+ E      
Sbjct: 247 IAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQY 306

Query: 373 L 373
           L
Sbjct: 307 L 307

>NDAI0J00340 Chr10 complement(56120..58030) [1911 bp, 636 aa] {ON}
           Anc_7.535
          Length = 636

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 75  ILKYFIPDEQSEGVGARVRRAIGTN-EMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET- 132
           IL+YF  ++  E V     R + TN E+    PFL++DHF   P      D P H  ET 
Sbjct: 56  ILRYFETEDYKEDVVLESMRTMCTNSELVSTHPFLLIDHF--LPKSLITKDVPLHMVETS 113

Query: 133 --ITYILDGM-IAHEDFTGSKGVLRPG 156
                + D + +  E  T +  V RPG
Sbjct: 114 GKFAALRDLINLVQEYETNTAIVCRPG 140

>Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ADR035C
          Length = 855

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 12/59 (20%)

Query: 294 VDGHSIK-------GQSATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQ 345
           +DGH I+       G ++T  T    I GKI+    V++ PF E TR+D++++F ++ Q
Sbjct: 701 IDGHKIQLKLSHRQGTASTAKTSKKNINGKII----VKNLPF-EATRKDIFELFSSFGQ 754

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.139    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,217,162
Number of extensions: 1732262
Number of successful extensions: 3535
Number of sequences better than 10.0: 23
Number of HSP's gapped: 3581
Number of HSP's successfully gapped: 23
Length of query: 374
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 263
Effective length of database: 40,753,473
Effective search space: 10718163399
Effective search space used: 10718163399
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)