Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0D00820singletonON56256229880.0
NDAI0F01930singletonON56454925560.0
NCAS0E00160singletonON55855923630.0
NDAI0F01940singletonON55154523270.0
TBLA0A03450singletonON57357322460.0
TBLA0B04810singletonON57554922270.0
TBLA0A04910singletonON57555622210.0
TBLA0J00100singletonON57456121970.0
TBLA0A03480singletonON57456721950.0
TBLA0D05800singletonON57456721670.0
NDAI0D05020singletonON57356021470.0
KAFR0D00750singletonON55755421220.0
NDAI0D05010singletonON57456021130.0
TBLA0A03400singletonON57456021110.0
YDR343C (HXT6)5.395ON57054821000.0
YDR342C (HXT7)5.394ON57054820960.0
TBLA0B00840singletonON63754420950.0
KAFR0D00740singletonON56855020740.0
Smik_4.6065.394ON57054920730.0
Smik_4.6075.395ON57054820720.0
TBLA0A01240singletonON56954820660.0
Suva_2.512singletonON57055120660.0
NCAS0F031005.395ON57055820580.0
CAGL0A02211g5.394ON55254820560.0
TBLA0A03430singletonON56455520530.0
KNAG0B06940singletonON56055920500.0
NDAI0C017505.395ON57655920470.0
NDAI0G063108.22ON56553620450.0
TBLA0A033905.394ON57457020460.0
TBLA0B10150singletonON57155320390.0
KNAG0C052505.394ON56454920370.0
KNAG0C051905.395ON56455220340.0
CAGL0A02233g5.395ON54954920260.0
NDAI0C045605.395ON57056420190.0
Suva_15.2875.394ON57655720150.0
YHR092C (HXT4)5.394ON57655720120.0
NCAS0I03160singletonON57555720100.0
SAKL0G07678g5.394ON56754920080.0
CAGL0A00737gsingletonON54954920030.0
Skud_8.1535.394ON57655720050.0
KNAG0I00110singletonON56353620040.0
TBLA0D05810singletonON57455420030.0
TDEL0E023105.394ON56755120010.0
Smik_8.1705.394ON57555120010.0
KAFR0A055505.394ON56455819990.0
TDEL0E023005.395ON56756319970.0
NCAS0H018805.395ON57356119970.0
Smik_12.140na 1ON57356119940.0
Ecym_13175.394ON54654919900.0
NDAI0K02970singletonON57055819920.0
KNAG0E04270singletonON55754419890.0
SAKL0B12540gsingletonON57256319890.0
YLR081W (GAL2)na 1ON57456319820.0
Suva_15.2915.396ON59255819660.0
SAKL0G19844gsingletonON57254919620.0
TBLA0A03440singletonON50350319520.0
TBLA0A03420singletonON57753719560.0
CAGL0A01782g5.394ON56855219490.0
TBLA0A03470singletonON57856619440.0
KLTH0E02772g5.394ON57156219430.0
Smik_10.8singletonON56955119340.0
TBLA0A03460singletonON56854819310.0
TDEL0E02290singletonON57156119270.0
TDEL0E00200singletonON56855019260.0
Smik_6.20singletonON56955119260.0
Skud_8.1575.395ON59255519280.0
NDAI0C017405.396ON60755519270.0
KLTH0E02750g5.395ON56756119210.0
Kwal_55.200755.394ON57154319210.0
TBLA0A034105.395ON58957319210.0
ZYRO0G00286gsingletonON58956519210.0
TBLA0A01250singletonON50350319100.0
TPHA0P001208.22ON55856019140.0
CAGL0D02640gsingletonON56455919120.0
CAGL0D02662gsingletonON56455919120.0
ZYRO0A06688g5.394ON57155419110.0
NCAS0F031105.396ON56853319070.0
YJL214W (HXT8)singletonON56955119060.0
Ecym_13195.395ON53551219020.0
TDEL0E022805.396ON58755219070.0
YJL219W (HXT9)singletonON56755019030.0
TBLA0A03500singletonON57356019030.0
YOL156W (HXT11)singletonON56755018990.0
SAKL0C00154gsingletonON57155718930.0
NCAS0F04060singletonON61057218940.0
KAFR0F02800singletonON55153718870.0
Kpol_365.105.396ON63356018950.0
KAFR0E02030singletonON54853318830.0
YDR345C (HXT3)5.396ON56755918830.0
Smik_4.6095.396ON56755918820.0
NCAS0I03210singletonON56856618820.0
NCAS0F00120singletonON56954318820.0
NCAS0A03030singletonON57456818820.0
KAFR0D00760singletonON55954418800.0
Suva_2.5165.396ON56755918800.0
CAGL0A02321g5.396ON55654218790.0
KAFR0F04080singletonON54952518760.0
Suva_10.164na 1ON57356018780.0
NDAI0C045705.396ON56853618760.0
CAGL0I00286gsingletonON55554818730.0
KAFR0D00800singletonON55855118720.0
KAFR0D00780singletonON56055718710.0
KLTH0B00330gsingletonON56655218720.0
KAFR0D00790singletonON56154718710.0
NCAS0C02990singletonON56856018710.0
YHR094C (HXT1)5.395ON57055918710.0
TBLA0A035105.396ON57049918680.0
Suva_10.165na 2ON56953618640.0
KNAG0B043705.394ON55755018630.0
KNAG0C051805.396ON55555518590.0
YHR096C (HXT5)5.396ON59255618630.0
CAGL0A01804g5.395ON56354818580.0
SAKL0G07656g5.395ON57955118580.0
Smik_8.1735.396ON59255618580.0
TBLA0E01970singletonON57851318510.0
SAKL0C02134gsingletonON57156118480.0
KLLA0D13310g5.396ON56756118470.0
Smik_8.1725.395ON57055918440.0
AFL205C5.395ON54653418360.0
Suva_15.2905.395ON56755818380.0
CAGL0A01826g5.396ON58851518360.0
TDEL0A04250singletonON57354818350.0
AFL207C5.394ON53950918260.0
TBLA0A03700singletonON57255318270.0
KAFR0C03750singletonON58057018210.0
NCAS0H03600singletonON56055218050.0
NCAS0J00120na 3ON57255917980.0
NCAS0E03210singletonON55951817870.0
Kwal_14.854na 4ON57055317870.0
TBLA0F01600singletonON56755317840.0
KNAG0M02690singletonON55955617810.0
Kpol_1057.20singletonON57054117810.0
KLTH0C00462gna 4ON57055917760.0
NDAI0G04470singletonON56151917720.0
NCAS0H018905.396ON59155017750.0
TPHA0H015705.396ON64355817790.0
Suva_13.174na 5ON54153617680.0
Kpol_1059.395.396ON56355517680.0
Kpol_1049.20singletonON56754217670.0
Smik_6.68na 6ON54653417620.0
Kwal_26.6686singletonON56954917610.0
YMR011W (HXT2)na 5ON54153617580.0
NCAS0J00170singletonON53551217570.0
KAFR0E041205.396ON56353117600.0
Skud_6.61na 6ON54650917570.0
Skud_13.163na 5ON54753317510.0
Smik_13.171na 5ON54153617490.0
TPHA0H03110singletonON56155817450.0
KNAG0D05370singletonON45645517250.0
YFL011W (HXT10)na 6ON54652417310.0
Kwal_55.19582singletonON56754017120.0
Kwal_56.22285singletonON56754017010.0
NCAS0A08630singletonON59349716980.0
TPHA0N01930singletonON56155816890.0
NDAI0B03060singletonON59853016830.0
Smik_5.19na 7ON56756616710.0
Skud_14.406na 8ON56456316690.0
YEL069C (HXT13)na 7ON56456516690.0
YNR072W (HXT17)singletonON56456116660.0
KAFR0C00180singletonON55855716600.0
AFL204C5.396ON53552816540.0
Smik_14.401na 8ON63656616640.0
Skud_4.5singletonON57355716530.0
YDL245C (HXT15)singletonON56755816260.0
YJR158W (HXT16)singletonON56755816200.0
YIL170W (HXT12)singletonON45745515990.0
Suva_15.419singletonON58855415890.0
ZYRO0D13310gsingletonON61653515760.0
KAFR0G00160singletonON63653514810.0
Suva_12.263singletonON48747914650.0
Kwal_26.6680singletonON41640314020.0
Skud_7.620singletonON46834812071e-161
Skud_6.12singletonON47035611671e-155
Suva_2.5135.395ON24424210331e-138
Smik_25.4singletonON31529810241e-136
Suva_68.1singletonON27727710051e-133
SAKL0C07920gsingletonON60147710341e-133
Suva_6.49na 6ON3612759931e-130
Skud_87.1singletonON2422429781e-130
Skud_4.6145.396ON3363269831e-129
Skud_4.6135.395ON5403269831e-126
Ecym_27973.23ON5215139721e-125
KAFR0A085203.23ON5615229651e-123
Skud_8.155singletonOFF5073259591e-123
NDAI0G015203.23ON5304969581e-123
Smik_78.1singletonON2792729321e-122
AFR602W3.23ON5584809561e-122
Kwal_55.200685.395ON2672649261e-122
Skud_8.156singletonOFF4672829441e-121
Suva_59.1singletonON2742579251e-121
Ecym_5319singletonON5305309321e-119
Kpol_1014.213.23ON5325379191e-117
ZYRO0C03168g3.23ON5554829171e-116
Suva_37.1singletonON2652558871e-116
NCAS0E013503.23ON5235239061e-115
Smik_14.133.23ON5405179071e-115
KLLA0E20945g3.23ON5284958941e-113
KLTH0H13376gna 9ON5404858941e-113
Skud_14.213.23ON5415368811e-111
YNL318C (HXT14)3.23ON5405128811e-111
SAKL0D10131gna 9ON5704808781e-110
Suva_9.197singletonON2892598481e-110
Suva_14.213.23ON5415028661e-109
KNAG0C05230singletonON3782498301e-106
CAGL0M04103g3.23ON5315328351e-104
TBLA0H002403.23ON5335378281e-103
TDEL0A004203.23ON5094778181e-102
Kwal_27.9678singletonON5134808181e-102
Skud_96.1singletonON2082087891e-102
Kwal_56.24841singletonON5114858161e-102
TBLA0A077103.23ON5364968131e-101
TDEL0C00150singletonON5264808091e-100
KLTH0D00484gsingletonON5135018041e-100
KLTH0G19404gsingletonON5134998011e-99
KLTH0H00308gsingletonON5104797931e-98
SAKL0B00264gsingletonON5194817783e-96
Kwal_55.200645.396ON2382277403e-94
NDAI0D05050singletonON2132137201e-91
Suva_9.198na 10ON2071916972e-88
Smik_113.1singletonON1841786641e-83
Skud_122.1singletonON1701696184e-77
ZYRO0F05786g7.309ON7155116232e-71
CAGL0I03872g7.309ON7625206191e-70
Kwal_56.244697.309ON7095346133e-70
Ecym_80607.309ON7105286134e-70
Kpol_1019.317.309ON8335156161e-69
KAFR0L013107.309ON7845406086e-69
KLTH0H02156g7.309ON7165116012e-68
NCAS0A138807.309ON7985346043e-68
Smik_10.14singletonON1551555547e-68
NDAI0A021507.309ON7895645972e-67
KNAG0B028107.309ON7985045948e-67
YDL194W (SNF3)7.309ON8845735952e-66
TDEL0C023707.309ON7315335882e-66
CAGL0J09020g7.309ON8564975905e-66
ADR091W7.309ON6645485808e-66
KAFR0B010807.309ON7265695821e-65
TBLA0F021307.309ON8805035872e-65
TPHA0A031107.309ON8125105842e-65
KLLA0F05181g7.309ON7875485814e-65
Skud_4.1167.309ON7695065726e-64
YDL138W (RGT2)7.309ON7635065726e-64
Smik_4.977.309ON7675105727e-64
NDAI0A028907.309ON9085155768e-64
SAKL0F10362g7.309ON7355065672e-63
Suva_4.547.309ON8905465722e-63
Smik_4.467.309ON8815405643e-62
Skud_4.647.309ON8845845563e-61
TDEL0B07220na 11ON5735205424e-61
Skud_4.809na 11ON5685075398e-61
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0D00820
         (562 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {O...  1155   0.0  
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}              989   0.0  
NCAS0E00160 Chr5 complement(15851..17527) [1677 bp, 558 aa] {ON}      914   0.0  
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}              900   0.0  
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...   869   0.0  
TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa] ...   862   0.0  
TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa] ...   860   0.0  
TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON}       850   0.0  
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}              850   0.0  
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...   839   0.0  
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...   831   0.0  
KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {O...   822   0.0  
NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa] ...   818   0.0  
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...   817   0.0  
YDR343C Chr4 complement(1159608..1161320) [1713 bp, 570 aa] {ON}...   813   0.0  
YDR342C Chr4 complement(1154216..1155928) [1713 bp, 570 aa] {ON}...   811   0.0  
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...   811   0.0  
KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {O...   803   0.0  
Smik_4.606 Chr4 complement(1080999..1082711) [1713 bp, 570 aa] {...   803   0.0  
Smik_4.607 Chr4 complement(1085753..1087465) [1713 bp, 570 aa] {...   802   0.0  
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...   800   0.0  
Suva_2.512 Chr2 complement(911804..913516) [1713 bp, 570 aa] {ON...   800   0.0  
NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {O...   797   0.0  
CAGL0A02211g Chr1 complement(229556..231214) [1659 bp, 552 aa] {...   796   0.0  
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...   795   0.0  
KNAG0B06940 Chr2 (1377486..1379168) [1683 bp, 560 aa] {ON}            794   0.0  
NDAI0C01750 Chr3 (382042..383772) [1731 bp, 576 aa] {ON}              793   0.0  
NDAI0G06310 Chr7 (1563437..1565134) [1698 bp, 565 aa] {ON} Anc_8...   792   0.0  
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...   792   0.0  
TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON}            790   0.0  
KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON}            789   0.0  
KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON}            788   0.0  
CAGL0A02233g Chr1 complement(235820..237469) [1650 bp, 549 aa] {...   785   0.0  
NDAI0C04560 Chr3 complement(1036823..1038535) [1713 bp, 570 aa] ...   782   0.0  
Suva_15.287 Chr15 complement(489708..491438) [1731 bp, 576 aa] {...   780   0.0  
YHR092C Chr8 complement(287081..288811) [1731 bp, 576 aa] {ON}  ...   779   0.0  
NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON}              778   0.0  
SAKL0G07678g Chr7 (645867..647570) [1704 bp, 567 aa] {ON} highly...   778   0.0  
CAGL0A00737g Chr1 (74767..76416) [1650 bp, 549 aa] {ON} highly s...   776   0.0  
Skud_8.153 Chr8 complement(261078..262808) [1731 bp, 576 aa] {ON...   776   0.0  
KNAG0I00110 Chr9 complement(5329..7020) [1692 bp, 563 aa] {ON}        776   0.0  
TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa] ...   776   0.0  
TDEL0E02310 Chr5 (450790..452493) [1704 bp, 567 aa] {ON} Anc_5.3...   775   0.0  
Smik_8.170 Chr8 complement(263829..265556) [1728 bp, 575 aa] {ON...   775   0.0  
KAFR0A05550 Chr1 complement(1107647..1109341) [1695 bp, 564 aa] ...   774   0.0  
TDEL0E02300 Chr5 (447834..449537) [1704 bp, 567 aa] {ON}  YIL170W     773   0.0  
NCAS0H01880 Chr8 complement(361743..363464) [1722 bp, 573 aa] {O...   773   0.0  
Smik_12.140 Chr12 (270030..271751) [1722 bp, 573 aa] {ON} YLR081...   772   0.0  
Ecym_1317 Chr1 complement(643844..645484) [1641 bp, 546 aa] {ON}...   771   0.0  
NDAI0K02970 Chr11 (678231..679943) [1713 bp, 570 aa] {ON}             771   0.0  
KNAG0E04270 Chr5 (849856..851529) [1674 bp, 557 aa] {ON}              770   0.0  
SAKL0B12540g Chr2 complement(1075772..1077490) [1719 bp, 572 aa]...   770   0.0  
YLR081W Chr12 (290212..291936) [1725 bp, 574 aa] {ON}  GAL2Galac...   768   0.0  
Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {...   761   0.0  
SAKL0G19844g Chr7 (1708176..1709894) [1719 bp, 572 aa] {ON} high...   760   0.0  
TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {O...   756   0.0  
TBLA0A03420 Chr1 (824716..826449) [1734 bp, 577 aa] {ON}              758   0.0  
CAGL0A01782g Chr1 complement(175018..176724) [1707 bp, 568 aa] {...   755   0.0  
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}    753   0.0  
KLTH0E02772g Chr5 (252118..253833) [1716 bp, 571 aa] {ON} highly...   753   0.0  
Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)   749   0.0  
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}    748   0.0  
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...   746   0.0  
TDEL0E00200 Chr5 complement(25701..27407) [1707 bp, 568 aa] {ON}      746   0.0  
Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)   746   0.0  
Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON...   747   0.0  
NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON}              746   0.0  
KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly...   744   0.0  
Kwal_55.20075 s55 (239263..240978) [1716 bp, 571 aa] {ON} YDR343...   744   0.0  
TBLA0A03410 Chr1 complement(815181..816950) [1770 bp, 589 aa] {O...   744   0.0  
ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly s...   744   0.0  
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}              740   0.0  
TPHA0P00120 Chr16 complement(23525..25201) [1677 bp, 558 aa] {ON...   741   0.0  
CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly...   741   0.0  
CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {...   741   0.0  
ZYRO0A06688g Chr1 (546489..548204) [1716 bp, 571 aa] {ON} highly...   740   0.0  
NCAS0F03110 Chr6 complement(622619..624325) [1707 bp, 568 aa] {O...   739   0.0  
YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein...   738   0.0  
Ecym_1319 Chr1 complement(649182..650789) [1608 bp, 535 aa] {ON}...   737   0.0  
TDEL0E02280 Chr5 (438756..440519) [1764 bp, 587 aa] {ON} Anc_5.3...   739   0.0  
YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putativ...   737   0.0  
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...   737   0.0  
YOL156W Chr15 (25273..26976) [1704 bp, 567 aa] {ON}  HXT11Putati...   736   0.0  
SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON} ...   733   0.0  
NCAS0F04060 Chr6 (809459..811291) [1833 bp, 610 aa] {ON}              734   0.0  
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}              731   0.0  
Kpol_365.10 s365 complement(21800..23701) [1902 bp, 633 aa] {ON}...   734   0.0  
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}              729   0.0  
YDR345C Chr4 complement(1162957..1164660) [1704 bp, 567 aa] {ON}...   729   0.0  
Smik_4.609 Chr4 complement(1089106..1090809) [1704 bp, 567 aa] {...   729   0.0  
NCAS0I03210 Chr9 (600725..602431) [1707 bp, 568 aa] {ON}              729   0.0  
NCAS0F00120 Chr6 (11887..13596) [1710 bp, 569 aa] {ON}                729   0.0  
NCAS0A03030 Chr1 complement(593557..595281) [1725 bp, 574 aa] {O...   729   0.0  
KAFR0D00760 Chr4 complement(153417..155096) [1680 bp, 559 aa] {O...   728   0.0  
Suva_2.516 Chr2 complement(919934..921637) [1704 bp, 567 aa] {ON...   728   0.0  
CAGL0A02321g Chr1 complement(252192..253862) [1671 bp, 556 aa] {...   728   0.0  
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...   727   0.0  
Suva_10.164 Chr10 (291810..293531) [1722 bp, 573 aa] {ON} YLR081...   728   0.0  
NDAI0C04570 Chr3 complement(1042623..1044329) [1707 bp, 568 aa] ...   727   0.0  
CAGL0I00286g Chr9 complement(20521..22188) [1668 bp, 555 aa] {ON...   726   0.0  
KAFR0D00800 Chr4 complement(170100..171776) [1677 bp, 558 aa] {O...   725   0.0  
KAFR0D00780 Chr4 (163688..165370) [1683 bp, 560 aa] {ON}              725   0.0  
KLTH0B00330g Chr2 (29891..31591) [1701 bp, 566 aa] {ON} highly s...   725   0.0  
KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON}              725   0.0  
NCAS0C02990 Chr3 (563467..565173) [1707 bp, 568 aa] {ON}              725   0.0  
YHR094C Chr8 complement(290913..292625) [1713 bp, 570 aa] {ON}  ...   725   0.0  
TBLA0A03510 Chr1 complement(865967..867679) [1713 bp, 570 aa] {O...   724   0.0  
Suva_10.165 Chr10 (295189..296898) [1710 bp, 569 aa] {ON} YEL069...   722   0.0  
KNAG0B04370 Chr2 (835663..837336) [1674 bp, 557 aa] {ON}              722   0.0  
KNAG0C05180 Chr3 (1007743..1009410) [1668 bp, 555 aa] {ON}            720   0.0  
YHR096C Chr8 complement(294669..296447) [1779 bp, 592 aa] {ON}  ...   722   0.0  
CAGL0A01804g Chr1 complement(180180..181871) [1692 bp, 563 aa] {...   720   0.0  
SAKL0G07656g Chr7 (641127..642866) [1740 bp, 579 aa] {ON} highly...   720   0.0  
Smik_8.173 Chr8 complement(271033..272811) [1779 bp, 592 aa] {ON...   720   0.0  
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...   717   0.0  
SAKL0C02134g Chr3 (188874..190589) [1716 bp, 571 aa] {ON} highly...   716   0.0  
KLLA0D13310g Chr4 complement(1143027..1144730) [1704 bp, 567 aa]...   716   0.0  
Smik_8.172 Chr8 complement(267609..269321) [1713 bp, 570 aa] {ON...   714   0.0  
AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON} Syn...   711   0.0  
Suva_15.290 Chr15 complement(493441..495144) [1704 bp, 567 aa] {...   712   0.0  
CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {...   711   0.0  
TDEL0A04250 Chr1 (756579..758300) [1722 bp, 573 aa] {ON}  YBR298C     711   0.0  
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...   707   0.0  
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}              708   0.0  
KAFR0C03750 Chr3 complement(765712..767454) [1743 bp, 580 aa] {O...   706   0.0  
NCAS0H03600 Chr8 complement(683969..685651) [1683 bp, 560 aa] {O...   699   0.0  
NCAS0J00120 Chr10 complement(4561..6279) [1719 bp, 572 aa] {ON}       697   0.0  
NCAS0E03210 Chr5 complement(637282..638961) [1680 bp, 559 aa] {O...   692   0.0  
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...   692   0.0  
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...   691   0.0  
KNAG0M02690 Chr13 (502232..503911) [1680 bp, 559 aa] {ON}             690   0.0  
Kpol_1057.20 s1057 (38011..39723) [1713 bp, 570 aa] {ON} (38011....   690   0.0  
KLTH0C00462g Chr3 complement(49362..51074) [1713 bp, 570 aa] {ON...   688   0.0  
NDAI0G04470 Chr7 complement(1071044..1072729) [1686 bp, 561 aa] ...   687   0.0  
NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {O...   688   0.0  
TPHA0H01570 Chr8 complement(354813..356744) [1932 bp, 643 aa] {O...   689   0.0  
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...   685   0.0  
Kpol_1059.39 s1059 (87634..89325) [1692 bp, 563 aa] {ON} (87634....   685   0.0  
Kpol_1049.20 s1049 (47753..49456) [1704 bp, 567 aa] {ON} (47753....   685   0.0  
Smik_6.68 Chr6 (125842..127482) [1641 bp, 546 aa] {ON} YFL011W (...   683   0.0  
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...   682   0.0  
YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}  HXT2High-...   681   0.0  
NCAS0J00170 Chr10 complement(17702..19309) [1608 bp, 535 aa] {ON}     681   0.0  
KAFR0E04120 Chr5 (826520..828211) [1692 bp, 563 aa] {ON} Anc_5.3...   682   0.0  
Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W (...   681   0.0  
Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094...   679   0.0  
Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345...   678   0.0  
TPHA0H03110 Chr8 (742931..744616) [1686 bp, 561 aa] {ON}              676   0.0  
KNAG0D05370 Chr4 (984855..986225) [1371 bp, 456 aa] {ON}              669   0.0  
YFL011W Chr6 (112345..113985) [1641 bp, 546 aa] {ON}  HXT10Putat...   671   0.0  
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...   664   0.0  
Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W ...   659   0.0  
NCAS0A08630 Chr1 complement(1704322..1706103) [1782 bp, 593 aa] ...   658   0.0  
TPHA0N01930 Chr14 (410871..412556) [1686 bp, 561 aa] {ON}             655   0.0  
NDAI0B03060 Chr2 complement(775021..776817) [1797 bp, 598 aa] {O...   652   0.0  
Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON} Y...   648   0.0  
Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072...   647   0.0  
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...   647   0.0  
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...   646   0.0  
KAFR0C00180 Chr3 (24352..26028) [1677 bp, 558 aa] {ON}                644   0.0  
AFL204C Chr6 complement(51587..53194) [1608 bp, 535 aa] {ON} Unc...   641   0.0  
Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072...   645   0.0  
Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON} YJR...   641   0.0  
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...   630   0.0  
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...   628   0.0  
YIL170W Chr9 (19847..21220) [1374 bp, 457 aa] {ON}  HXT12Possibl...   620   0.0  
Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081...   616   0.0  
ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]...   611   0.0  
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                575   0.0  
Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072...   568   0.0  
Kwal_26.6680 s26 complement(19490..20740) [1251 bp, 416 aa] {ON}...   544   0.0  
Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1...   469   e-161
Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON...   454   e-155
Suva_2.513 Chr2 complement(917149..917883) [735 bp, 244 aa] {ON}...   402   e-138
Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)     399   e-136
Suva_68.1 Chr68 complement(3..833) [831 bp, 277 aa] {ON} YOL156W...   391   e-133
SAKL0C07920g Chr3 complement(735512..737317) [1806 bp, 601 aa] {...   402   e-133
Suva_6.49 Chr6 (85313..85525,85525..86397) [1086 bp, 361 aa] {ON...   387   e-130
Skud_87.1 Chr87 (1..726) [726 bp, 242 aa] {ON} YDR343C (REAL)         381   e-130
Skud_4.614 Chr4 complement(1092655..1093665) [1011 bp, 336 aa] {...   383   e-129
Skud_4.613 Chr4 complement(1091965..1092006,1092030..1092095,109...   383   e-126
Ecym_2797 Chr2 complement(1548238..1549803) [1566 bp, 521 aa] {O...   379   e-125
KAFR0A08520 Chr1 (1708192..1709877) [1686 bp, 561 aa] {ON} Anc_3...   376   e-123
Skud_8.155 Chr8 complement(264872..264913,264917..265015,265033....   374   e-123
NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {O...   373   e-123
Smik_78.1 Chr78 complement(3..839) [837 bp, 279 aa] {ON} YEL069C...   363   e-122
AFR602W Chr6 (1523461..1525137) [1677 bp, 558 aa] {ON} Non-synte...   372   e-122
Kwal_55.20068 s55 (236586..237389) [804 bp, 267 aa] {ON} YDR345C...   361   e-122
Skud_8.156 Chr8 complement(264872..264913,264917..265015,265033....   368   e-121
Suva_59.1 Chr59 (1..825) [825 bp, 274 aa] {ON} YFL011W (REAL)         360   e-121
Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}...   363   e-119
Kpol_1014.21 s1014 (34471..36069) [1599 bp, 532 aa] {ON} (34471....   358   e-117
ZYRO0C03168g Chr3 (243606..245273) [1668 bp, 555 aa] {ON} simila...   357   e-116
Suva_37.1 Chr37 complement(3..797) [795 bp, 265 aa] {ON} YFL011W...   346   e-116
NCAS0E01350 Chr5 complement(261125..262696) [1572 bp, 523 aa] {O...   353   e-115
Smik_14.13 Chr14 complement(23204..24826) [1623 bp, 540 aa] {ON}...   353   e-115
KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weak...   348   e-113
KLTH0H13376g Chr8 complement(1167211..1168833) [1623 bp, 540 aa]...   348   e-113
Skud_14.21 Chr14 complement(32206..33831) [1626 bp, 541 aa] {ON}...   343   e-111
YNL318C Chr14 complement(38707..40329) [1623 bp, 540 aa] {ON}  H...   343   e-111
SAKL0D10131g Chr4 complement(846993..848705) [1713 bp, 570 aa] {...   342   e-110
Suva_9.197 Chr9 (326927..327796) [870 bp, 289 aa] {ON} YFL011W (...   331   e-110
Suva_14.21 Chr14 complement(34919..36544) [1626 bp, 541 aa] {ON}...   338   e-109
KNAG0C05230 Chr3 (1021075..1022211) [1137 bp, 378 aa] {ON}            324   e-106
CAGL0M04103g Chr13 (452677..454272) [1596 bp, 531 aa] {ON} simil...   326   e-104
TBLA0H00240 Chr8 complement(35421..37022) [1602 bp, 533 aa] {ON}...   323   e-103
TDEL0A00420 Chr1 complement(75025..76554) [1530 bp, 509 aa] {ON}...   319   e-102
Kwal_27.9678 s27 complement(14940..16481) [1542 bp, 513 aa] {ON}...   319   e-102
Skud_96.1 Chr96 (1..624) [624 bp, 208 aa] {ON} YOL156W (REAL)         308   e-102
Kwal_56.24841 s56 complement(1167890..1169425) [1536 bp, 511 aa]...   318   e-102
TBLA0A07710 Chr1 complement(1905062..1906672) [1611 bp, 536 aa] ...   317   e-101
TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON}                316   e-100
KLTH0D00484g Chr4 complement(44278..45819) [1542 bp, 513 aa] {ON...   314   e-100
KLTH0G19404g Chr7 (1672150..1673691) [1542 bp, 513 aa] {ON} weak...   313   1e-99
KLTH0H00308g Chr8 (28695..30227) [1533 bp, 510 aa] {ON} weakly s...   310   1e-98
SAKL0B00264g Chr2 (22039..23598) [1560 bp, 519 aa] {ON} similar ...   304   3e-96
Kwal_55.20064 s55 (235602..236315) [714 bp, 238 aa] {ON} YHR094C...   289   3e-94
NDAI0D05050 Chr4 (1208468..1209109) [642 bp, 213 aa] {ON}             281   1e-91
Suva_9.198 Chr9 (327714..328337) [624 bp, 207 aa] {ON} YFL011W (...   273   2e-88
Smik_113.1 Chr113 complement(3..554) [552 bp, 184 aa] {ON} YOL15...   260   1e-83
Skud_122.1 Chr122 complement(3..512) [510 bp, 170 aa] {ON} YJL21...   242   4e-77
ZYRO0F05786g Chr6 complement(476413..478560) [2148 bp, 715 aa] {...   244   2e-71
CAGL0I03872g Chr9 (337985..340273) [2289 bp, 762 aa] {ON} some s...   243   1e-70
Kwal_56.24469 s56 complement(1008164..1010293) [2130 bp, 709 aa]...   240   3e-70
Ecym_8060 Chr8 complement(129041..131173) [2133 bp, 710 aa] {ON}...   240   4e-70
Kpol_1019.31 s1019 (61016..63517) [2502 bp, 833 aa] {ON} (61016....   241   1e-69
KAFR0L01310 Chr12 complement(241337..243691) [2355 bp, 784 aa] {...   238   6e-69
KLTH0H02156g Chr8 (195794..197944) [2151 bp, 716 aa] {ON} simila...   236   2e-68
NCAS0A13880 Chr1 complement(2723605..2726001) [2397 bp, 798 aa] ...   237   3e-68
Smik_10.14 Chr10 (23347..23814) [468 bp, 155 aa] {ON} YJL214W (R...   218   7e-68
NDAI0A02150 Chr1 (486774..489143) [2370 bp, 789 aa] {ON} Anc_7.309    234   2e-67
KNAG0B02810 Chr2 (541349..543745) [2397 bp, 798 aa] {ON} Anc_7.3...   233   8e-67
YDL194W Chr4 (111580..114234) [2655 bp, 884 aa] {ON}  SNF3Plasma...   233   2e-66
TDEL0C02370 Chr3 (416622..418817) [2196 bp, 731 aa] {ON} Anc_7.3...   231   2e-66
CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highl...   231   5e-66
ADR091W Chr4 (872923..874917) [1995 bp, 664 aa] {ON} Syntenic ho...   228   8e-66
KAFR0B01080 Chr2 (204541..206721) [2181 bp, 726 aa] {ON} Anc_7.3...   228   1e-65
TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {O...   230   2e-65
TPHA0A03110 Chr1 (684324..686762) [2439 bp, 812 aa] {ON} Anc_7.3...   229   2e-65
KLLA0F05181g Chr6 (510384..512747) [2364 bp, 787 aa] {ON} unipro...   228   4e-65
Skud_4.116 Chr4 (208941..211250) [2310 bp, 769 aa] {ON} YDL138W ...   224   6e-64
YDL138W Chr4 (213351..215642) [2292 bp, 763 aa] {ON}  RGT2Plasma...   224   6e-64
Smik_4.97 Chr4 (189933..192236) [2304 bp, 767 aa] {ON} YDL138W (...   224   7e-64
NDAI0A02890 Chr1 (648510..651236) [2727 bp, 908 aa] {ON}              226   8e-64
SAKL0F10362g Chr6 complement(796504..798711) [2208 bp, 735 aa] {...   223   2e-63
Suva_4.54 Chr4 (99974..102646) [2673 bp, 890 aa] {ON} YDL194W (R...   224   2e-63
Smik_4.46 Chr4 (89787..92432) [2646 bp, 881 aa] {ON} YDL194W (REAL)   221   3e-62
Skud_4.64 Chr4 (108965..111619) [2655 bp, 884 aa] {ON} YDL194W (...   218   3e-61
TDEL0B07220 Chr2 complement(1271585..1273306) [1722 bp, 573 aa] ...   213   4e-61
Skud_4.809 Chr4 (1427842..1429548) [1707 bp, 568 aa] {ON} YDR536...   212   8e-61
KLTH0B04510g Chr2 complement(364062..365768) [1707 bp, 568 aa] {...   209   6e-60
KNAG0C03990 Chr3 (786172..788541) [2370 bp, 789 aa] {ON} Anc_7.3...   213   8e-60
NCAS0E03740 Chr5 complement(733564..736194) [2631 bp, 876 aa] {O...   214   9e-60
Suva_4.106 Chr4 (201617..203923) [2307 bp, 768 aa] {ON} YDL138W ...   213   1e-59
Kwal_33.14911 s33 (868216..869928) [1713 bp, 570 aa] {ON} YDR536...   207   5e-59
Smik_10.2 Chr10 (3945..4403) [459 bp, 152 aa] {ON} YOL156W (REAL)     193   1e-58
YDR536W Chr4 (1508005..1509714) [1710 bp, 569 aa] {ON}  STL1Glyc...   206   1e-58
Ecym_3420 Chr3 (792244..793902) [1659 bp, 552 aa] {ON} similar t...   203   1e-57
Suva_2.730 Chr2 (1271371..1273059) [1689 bp, 562 aa] {ON} YDR536...   202   4e-57
KLLA0F26246g Chr6 (2432209..2433960) [1752 bp, 583 aa] {ON} high...   202   5e-57
Kpol_281.3 s281 complement(9070..10740) [1671 bp, 556 aa] {ON} c...   199   3e-56
Kpol_281.2 s281 complement(3711..5390) [1680 bp, 559 aa] {ON} co...   197   3e-55
Smik_4.815 Chr4 (1427987..1429696) [1710 bp, 569 aa] {ON} YDR536...   196   4e-55
Kwal_34.16190 s34 complement(239113..240783) [1671 bp, 556 aa] {...   195   1e-54
TPHA0O00950 Chr15 complement(176003..177682) [1680 bp, 559 aa] {...   193   6e-54
TDEL0E00120 Chr5 (7519..9231) [1713 bp, 570 aa] {ON}                  193   7e-54
ZYRO0E03916g Chr5 complement(296502..298217) [1716 bp, 571 aa] {...   192   1e-53
ZYRO0E01210g Chr5 (86975..88753) [1779 bp, 592 aa] {ON} similar ...   192   2e-53
AEL042C Chr5 complement(557191..558834) [1644 bp, 547 aa] {ON} S...   191   2e-53
Ecym_1345 Chr1 (711048..712715) [1668 bp, 555 aa] {ON} similar t...   191   4e-53
Kwal_34.16261 s34 (266378..267358) [981 bp, 327 aa] {ON} YFL011W...   185   5e-53
TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432    189   1e-52
KLTH0H13728g Chr8 (1199825..1201510) [1686 bp, 561 aa] {ON} simi...   189   1e-52
SAKL0G18810g Chr7 complement(1624866..1626581) [1716 bp, 571 aa]...   189   2e-52
KLLA0A11110g Chr1 (964084..965739) [1656 bp, 551 aa] {ON} unipro...   187   7e-52
SAKL0D10450g Chr4 (875475..877151) [1677 bp, 558 aa] {ON} highly...   184   1e-50
ZYRO0E01188g Chr5 (83763..85724) [1962 bp, 653 aa] {ON} similar ...   185   2e-50
TBLA0C01090 Chr3 (223890..226874) [2985 bp, 994 aa] {ON}              188   2e-50
ADR139C Chr4 complement(950169..951845) [1677 bp, 558 aa] {ON} N...   184   2e-50
TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {O...   176   2e-47
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...   174   5e-47
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...   174   8e-47
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432    175   9e-47
NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84     173   2e-46
Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {...   172   3e-46
SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]...   173   7e-46
KLTH0E10406g Chr5 (938423..940624) [2202 bp, 733 aa] {ON} weakly...   173   1e-45
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...   170   2e-45
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....   170   4e-45
YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}  ITR2Myo-i...   169   8e-45
KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3....   169   1e-44
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...   169   1e-44
TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa] ...   169   1e-44
NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa] ...   168   1e-44
SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {...   167   1e-44
ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {...   168   2e-44
NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {O...   166   7e-44
KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly...   166   1e-43
KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} high...   165   1e-43
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...   164   2e-43
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...   164   4e-43
TDEL0D06510 Chr4 (1168136..1169794) [1659 bp, 552 aa] {ON}            162   7e-43
Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W (...   162   1e-42
KLLA0E00287g Chr5 (15302..16837) [1536 bp, 511 aa] {ON} weakly s...   160   3e-42
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...   162   4e-42
Smik_10.3 Chr10 (4404..4463,4467..4679) [273 bp, 91 aa] {ON} YJL...   147   5e-42
Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W (...   160   8e-42
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...   161   1e-41
Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {...   159   2e-41
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...   157   6e-41
ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conser...   157   2e-40
NCAS0A11910 Chr1 complement(2361519..2363180) [1662 bp, 553 aa] ...   154   9e-40
CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly...   154   1e-39
KLLA0A03223g Chr1 (290002..292035) [2034 bp, 677 aa] {ON} simila...   152   8e-39
SAKL0D14960g Chr4 (1237823..1239559) [1737 bp, 578 aa] {ON} weak...   150   1e-38
Suva_95.1 Chr95 (144..581) [438 bp, 146 aa] {ON} YJL219W (REAL)       140   1e-38
Ecym_1521 Chr1 complement(1074197..1075954) [1758 bp, 585 aa] {O...   150   4e-38
NDAI0A04360 Chr1 (981092..982726) [1635 bp, 544 aa] {ON} Anc_5.469    146   3e-37
KLLA0F06853g Chr6 (656373..657959) [1587 bp, 528 aa] {ON} simila...   145   4e-37
Kpol_1046.1 s1046 (1..1053) [1053 bp, 350 aa] {ON} (1..1053) [10...   140   2e-36
CAGL0M01672g Chr13 (186088..187731) [1644 bp, 547 aa] {ON} simil...   144   2e-36
Ecym_2262 Chr2 (515606..517051) [1446 bp, 481 aa] {ON} similar t...   143   3e-36
TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {O...   143   4e-36
Kwal_14.1625 s14 (395421..396941) [1521 bp, 506 aa] {ON} YBR241C...   142   8e-36
KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {...   142   1e-35
Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {...   141   3e-35
KLTH0D00572g Chr4 complement(53475..55136) [1662 bp, 553 aa] {ON...   140   6e-35
ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]...   137   2e-34
SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} simila...   138   3e-34
TPHA0J02740 Chr10 complement(608490..610214) [1725 bp, 574 aa] {...   138   4e-34
KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} simila...   136   8e-34
KLLA0E03037g Chr5 complement(278965..280587) [1623 bp, 540 aa] {...   136   8e-34
ABR223C Chr2 complement(820634..822508) [1875 bp, 624 aa] {ON} S...   137   9e-34
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...   135   4e-33
Kwal_55.21289 s55 (770379..771992) [1614 bp, 537 aa] {ON} YDR387...   134   6e-33
Kpol_543.5 s543 complement(10929..12629) [1701 bp, 566 aa] {ON} ...   134   7e-33
Skud_2.373 Chr2 complement(671237..672703) [1467 bp, 488 aa] {ON...   132   2e-32
Suva_4.501 Chr4 complement(873617..875086) [1470 bp, 489 aa] {ON...   132   2e-32
AFL034W Chr6 (371827..373251) [1425 bp, 474 aa] {ON} Syntenic ho...   131   3e-32
YBR241C Chr2 complement(702589..704055) [1467 bp, 488 aa] {ON} P...   131   4e-32
Kwal_34.16266 s34 (267558..268034) [477 bp, 158 aa] {ON} YFL040W...   122   5e-32
TPHA0N01090 Chr14 (227811..229274) [1464 bp, 487 aa] {ON} Anc_6....   130   7e-32
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)      131   8e-32
Smik_2.384 Chr2 complement(688838..690304) [1467 bp, 488 aa] {ON...   130   9e-32
CAGL0C01771g Chr3 (187030..188487) [1458 bp, 485 aa] {ON} simila...   130   1e-31
TDEL0B03990 Chr2 (713794..715239) [1446 bp, 481 aa] {ON} Anc_6.1...   129   1e-31
Kpol_534.27 s534 (61814..63322) [1509 bp, 502 aa] {ON} (61814..6...   129   2e-31
KLLA0D00374g Chr4 (30962..32632) [1671 bp, 556 aa] {ON} similar ...   129   3e-31
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...   129   4e-31
ZYRO0D11088g Chr4 complement(937064..938680) [1617 bp, 538 aa] {...   128   5e-31
KLTH0F15136g Chr6 (1240733..1242346) [1614 bp, 537 aa] {ON} simi...   127   9e-31
YGL104C Chr7 complement(308713..310173) [1461 bp, 486 aa] {ON}  ...   126   1e-30
TBLA0A07970 Chr1 (1971258..1972760) [1503 bp, 500 aa] {ON} Anc_5...   127   1e-30
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...   127   2e-30
KLLA0E25015g Chr5 complement(2219051..2220721) [1671 bp, 556 aa]...   127   2e-30
SAKL0B00946g Chr2 (87829..89412) [1584 bp, 527 aa] {ON} similar ...   127   2e-30
Kwal_27.10664 s27 complement(441630..443591) [1962 bp, 653 aa] {...   127   2e-30
YDR387C Chr4 complement(1248154..1249821) [1668 bp, 555 aa] {ON}...   125   4e-30
KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {O...   125   9e-30
Skud_4.660 Chr4 complement(1168794..1170461) [1668 bp, 555 aa] {...   125   1e-29
KLLA0B00264g Chr2 (12844..14574) [1731 bp, 576 aa] {ON} uniprot|...   125   1e-29
KLLA0D00253g Chr4 (12804..14534) [1731 bp, 576 aa] {ON} highly s...   125   1e-29
SAKL0G03432g Chr7 complement(282042..283655) [1614 bp, 537 aa] {...   124   2e-29
CAGL0K12716g Chr11 complement(1260998..1262452) [1455 bp, 484 aa...   123   2e-29
KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]...   122   3e-29
KNAG0M00610 Chr13 (97448..98857) [1410 bp, 469 aa] {ON} Anc_6.15...   122   4e-29
KLLA0B14861g Chr2 complement(1305927..1307690) [1764 bp, 587 aa]...   123   5e-29
Kwal_14.1105 s14 (197347..198915) [1569 bp, 522 aa] {ON} YFL040W...   121   9e-29
Kwal_27.12815 s27 (1384724..1385320) [597 bp, 198 aa] {ON} YDR34...   114   1e-28
Kwal_27.12811 s27 (1383808..1384353) [546 bp, 181 aa] {ON} YDL13...   114   1e-28
Suva_2.514 Chr2 complement(917149..917349) [201 bp, 66 aa] {ON} ...   109   1e-28
KLLA0E14653g Chr5 (1309427..1310860) [1434 bp, 477 aa] {ON} weak...   120   2e-28
Smik_7.170 Chr7 complement(303998..305392) [1395 bp, 464 aa] {ON...   119   4e-28
SAKL0A06050g Chr1 (548837..550408) [1572 bp, 523 aa] {ON} simila...   119   4e-28
KLTH0C05808g Chr3 complement(506792..508741) [1950 bp, 649 aa] {...   120   5e-28
KLLA0E06755g Chr5 complement(612941..614944) [2004 bp, 667 aa] {...   120   6e-28
SAKL0F13310g Chr6 (1051101..1053050) [1950 bp, 649 aa] {ON} cons...   120   6e-28
KAFR0E03650 Chr5 (733164..734660) [1497 bp, 498 aa] {ON} Anc_5.4...   118   9e-28
KLLA0D19953g Chr4 complement(1704481..1705842) [1362 bp, 453 aa]...   117   1e-27
Smik_4.657 Chr4 complement(1168668..1170332) [1665 bp, 554 aa] {...   118   2e-27
KAFR0G03530 Chr7 complement(730598..732040) [1443 bp, 480 aa] {O...   117   2e-27
Suva_13.3 Chr13 (2118..2321,2325..2369) [249 bp, 83 aa] {ON} YJL...   106   3e-27
Kpol_1023.17 s1023 (34188..35789) [1602 bp, 533 aa] {ON} (34188....   115   2e-26
AGL277W Chr7 (185070..187085) [2016 bp, 671 aa] {ON} NOHBY715; N...   115   2e-26
Suva_10.256 Chr10 (460447..460638,460642..460692) [243 bp, 81 aa...   103   4e-26
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...   113   6e-26
Skud_7.639 Chr7 complement(1062313..1064163) [1851 bp, 616 aa] {...   114   6e-26
NCAS0H01230 Chr8 (233917..235386) [1470 bp, 489 aa] {ON} Anc_6.155    112   7e-26
Suva_2.562 Chr2 complement(999213..1000880) [1668 bp, 555 aa] {O...   110   9e-25
Suva_7.163 Chr7 complement(303502..304992) [1491 bp, 496 aa] {ON...   109   1e-24
KLTH0E16984g Chr5 complement(1508741..1510360) [1620 bp, 539 aa]...   109   1e-24
Suva_16.22 Chr16 (27942..29780) [1839 bp, 612 aa] {ON} YDL247W (...   109   1e-24
Skud_7.171 Chr7 complement(313034..314524) [1491 bp, 496 aa] {ON...   108   1e-24
TDEL0C00450 Chr3 (65197..66762) [1566 bp, 521 aa] {ON} Anc_8.22 ...   108   2e-24
Suva_6.17 Chr6 (24763..26385) [1623 bp, 540 aa] {ON} YFL040W (REAL)   107   5e-24
Kwal_33.12950 s33 complement(12899..14599) [1701 bp, 566 aa] {ON...   107   5e-24
KLTH0B00484g Chr2 complement(51712..53412) [1701 bp, 566 aa] {ON...   106   1e-23
YJR160C Chr10 complement(738008..739816) [1809 bp, 602 aa] {ON} ...   107   1e-23
NDAI0F02060 Chr6 complement(505217..506725) [1509 bp, 502 aa] {O...   106   1e-23
YDL247W Chr4 (5985..7814) [1830 bp, 609 aa] {ON}  MPH2Alpha-gluc...   106   1e-23
TDEL0A00150 Chr1 (24714..26414) [1701 bp, 566 aa] {ON}                106   1e-23
ZYRO0E02200g Chr5 complement(165393..167327) [1935 bp, 644 aa] {...   105   3e-23
Smik_16.14 Chr16 (11711..13567) [1857 bp, 618 aa] {ON} YBR298C (...   105   4e-23
Smik_16.19 Chr16 (22874..24727) [1854 bp, 617 aa] {ON} YJR160C (...   104   7e-23
Smik_5.14 Chr5 (18370..20214) [1845 bp, 614 aa] {ON} YDL247W (REAL)   104   8e-23
Ecym_2317 Chr2 (621407..623080) [1674 bp, 557 aa] {ON} similar t...   103   1e-22
TDEL0A07980 Chr1 complement(1393551..1395323) [1773 bp, 590 aa] ...   103   1e-22
YFL040W Chr6 (51350..52972) [1623 bp, 540 aa] {ON} Putative tran...   102   2e-22
Smik_6.38 Chr6 (66762..68384) [1623 bp, 540 aa] {ON} YFL040W (REAL)   102   2e-22
Skud_20.4 Chr20 complement(6959..8800) [1842 bp, 613 aa] {ON} YD...   102   4e-22
Smik_3.10 Chr3 (11618..13459) [1842 bp, 613 aa] {ON} YBR298C (REAL)   102   4e-22
NCAS0E01550 Chr5 (291758..293392) [1635 bp, 544 aa] {ON} Anc_8.22     100   1e-21
Skud_6.30 Chr6 (54440..56146) [1707 bp, 568 aa] {ON} YFL040W (REAL)   100   2e-21
Skud_4.1 Chr4 (3172..5007) [1836 bp, 611 aa] {ON} YJR160C (REAL)      100   2e-21
KLTH0H05280g Chr8 complement(469755..471596) [1842 bp, 613 aa] {...   100   3e-21
ZYRO0F02706g Chr6 (217664..219367) [1704 bp, 567 aa] {ON} simila...    99   3e-21
TDEL0C02900 Chr3 (509949..511922) [1974 bp, 657 aa] {ON}               99   3e-21
KLLA0E01783g Chr5 (171319..173037) [1719 bp, 572 aa] {ON} simila...    99   4e-21
NDAI0G01750 Chr7 (382453..384033) [1581 bp, 526 aa] {ON} Anc_8.22      98   6e-21
YBR298C Chr2 complement(802631..804475) [1845 bp, 614 aa] {ON}  ...    95   8e-20
SAKL0A05676g Chr1 (515333..517174) [1842 bp, 613 aa] {ON} simila...    95   8e-20
TBLA0C00430 Chr3 (79303..81042) [1740 bp, 579 aa] {ON} Anc_8.22 ...    94   1e-19
Skud_7.628 Chr7 complement(1052224..1054074) [1851 bp, 616 aa] {...    93   4e-19
Suva_2.2 Chr2 (1892..3736) [1845 bp, 614 aa] {ON} YDL247W (REAL)       93   4e-19
YIL171W Chr9 (19515..19844) [330 bp, 109 aa] {ON} Possible pseud...    83   1e-18
KAFR0C03590 Chr3 complement(734372..735910) [1539 bp, 512 aa] {O...    91   2e-18
Skud_2.428 Chr2 complement(772256..772414) [159 bp, 52 aa] {ON} ...    81   2e-18
YGR289C Chr7 complement(1073963..1075813) [1851 bp, 616 aa] {ON}...    91   2e-18
SAKL0E05258g Chr5 (426681..428531) [1851 bp, 616 aa] {ON} simila...    91   2e-18
Kwal_27.11079 s27 (629490..631331) [1842 bp, 613 aa] {ON} YGR289...    89   6e-18
NCAS0D03450 Chr4 complement(644151..645587) [1437 bp, 478 aa] {O...    87   3e-17
KNAG0E03090 Chr5 (616710..618212) [1503 bp, 500 aa] {ON} Anc_8.2...    87   3e-17
ZYRO0D17864g Chr4 (1481311..1483047) [1737 bp, 578 aa] {ON} some...    87   3e-17
KLLA0D05379g Chr4 complement(464200..465690) [1491 bp, 496 aa] {...    87   3e-17
TDEL0D06520 Chr4 complement(1169941..1171785) [1845 bp, 614 aa] ...    84   2e-16
Smik_52.1 Chr52 complement(604..1620) [1017 bp, 338 aa] {ON} YGR...    82   3e-16
NDAI0I01390 Chr9 (335634..337082) [1449 bp, 482 aa] {ON} Anc_6.155     83   4e-16
Skud_85.1 Chr85 (483..749) [267 bp, 89 aa] {ON} YJL219W (REAL)         71   1e-14
Skud_84.1 Chr84 (487..753) [267 bp, 89 aa] {ON} YJL219W (REAL)         69   7e-14
Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON} ...    75   2e-13
Smik_86.1 Chr86 (613..765) [153 bp, 51 aa] {ON} YJL219W (REAL)         65   8e-13
Skud_16.1 Chr16 complement(2..331) [330 bp, 110 aa] {ON} YEL069C...    65   4e-12
YDL199C Chr4 complement(101290..103353) [2064 bp, 687 aa] {ON} P...    69   2e-11
Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}...    63   1e-09
Kwal_27.11385 s27 (782576..783244) [669 bp, 222 aa] {ON} YIL170W...    60   2e-09
Skud_9.168 Chr9 (312310..312513,312517..312582) [270 bp, 90 aa] ...    55   6e-09
Skud_12.146 Chr12 (274357..274512) [156 bp, 52 aa] {ON} YLR081W ...    52   2e-08
Smik_4.41 Chr4 complement(79517..81580) [2064 bp, 687 aa] {ON} Y...    59   3e-08
Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}...    57   5e-08
Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}...    56   1e-07
Skud_5.16 Chr5 complement(21080..21337) [258 bp, 86 aa] {ON} YJR...    51   1e-07
YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}  P...    55   4e-07
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    52   3e-06
Suva_4.49 Chr4 complement(89704..91767) [2064 bp, 687 aa] {ON} Y...    52   4e-06
KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]...    51   6e-06
KAFR0H01700 Chr8 complement(314217..316154) [1938 bp, 645 aa] {O...    50   8e-06
TDEL0G04900 Chr7 (905679..906257) [579 bp, 192 aa] {ON}                49   9e-06
NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}...    49   2e-05
NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}...    49   3e-05
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    49   3e-05
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    48   5e-05
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...    48   6e-05
Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}...    48   6e-05
NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON...    47   9e-05
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...    47   1e-04
ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} simila...    47   1e-04
KLTH0G02024g Chr7 complement(156778..158406) [1629 bp, 542 aa] {...    46   2e-04
CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} simil...    46   2e-04
NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}...    45   3e-04
KAFR0C00100 Chr3 (7573..8994) [1422 bp, 473 aa] {ON}                   45   4e-04
KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {...    44   8e-04
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               44   8e-04
TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858...    44   9e-04
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    44   0.001
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...    44   0.001
SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON...    44   0.001
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    44   0.001
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    44   0.001
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    43   0.002
NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {O...    43   0.002
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    43   0.002
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    42   0.003
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    42   0.003
TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.2...    42   0.003
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    42   0.004
KLTH0F06864g Chr6 complement(601480..603192) [1713 bp, 570 aa] {...    42   0.004
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    42   0.005
Kpol_541.20 s541 (55476..57182) [1707 bp, 568 aa] {ON} (55476..5...    41   0.006
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    41   0.007
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...    41   0.008
TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.8...    41   0.008
Smik_23.7 Chr23 (9338..10222) [885 bp, 295 aa] {ON} YGR289C (REAL)     40   0.008
NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570     41   0.008
Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W (...    41   0.008
SAKL0F02178g Chr6 complement(187479..189050) [1572 bp, 523 aa] {...    41   0.008
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    41   0.008
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    41   0.010
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    40   0.010
CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly...    40   0.011
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    40   0.013
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    40   0.014
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    40   0.014
KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON}               40   0.015
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    40   0.016
KAFR0A02910 Chr1 (605168..606928) [1761 bp, 586 aa] {ON} Anc_8.8...    40   0.017
AFR442C Chr6 complement(1234193..1235884) [1692 bp, 563 aa] {ON}...    40   0.018
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    40   0.018
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    40   0.019
TDEL0B00270 Chr2 (51265..53010) [1746 bp, 581 aa] {ON} Anc_8.858...    40   0.020
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    40   0.021
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    39   0.025
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      39   0.031
TPHA0K02160 Chr11 complement(461256..463082) [1827 bp, 608 aa] {...    39   0.031
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    39   0.032
KNAG0I02165 Chr9 (424375..426114) [1740 bp, 579 aa] {ON}               39   0.032
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    39   0.036
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    39   0.039
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    39   0.042
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    39   0.043
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}               39   0.049
KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON}               39   0.051
Kwal_47.18976 s47 (1049766..1051370) [1605 bp, 534 aa] {ON} YKL2...    38   0.055
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    38   0.055
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}               38   0.056
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    38   0.058
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...    38   0.063
Kwal_33.14268 s33 complement(593529..595238) [1710 bp, 569 aa] {...    38   0.068
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    38   0.068
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    38   0.073
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    38   0.073
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    38   0.078
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    37   0.096
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    37   0.10 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    37   0.12 
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    37   0.14 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    37   0.14 
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    37   0.16 
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    37   0.16 
ZYRO0A00902g Chr1 complement(64264..66078) [1815 bp, 604 aa] {ON...    37   0.16 
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    37   0.17 
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    37   0.17 
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              37   0.17 
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    37   0.18 
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    37   0.19 
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    37   0.19 
Smik_15.566 Chr15 (1013326..1013535) [210 bp, 70 aa] {OFF} YNR07...    33   0.19 
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    36   0.21 
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    36   0.23 
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...    36   0.23 
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    36   0.27 
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    36   0.32 
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    36   0.34 
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    35   0.37 
Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]...    35   0.37 
YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multid...    35   0.39 
SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} simila...    35   0.41 
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    35   0.44 
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    35   0.48 
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    35   0.49 
TBLA0A10540 Chr1 (2603824..2605305) [1482 bp, 493 aa] {ON}             35   0.56 
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    35   0.57 
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    35   0.64 
Kpol_309.1 s309 (1360..3120) [1761 bp, 586 aa] {ON} (1360..3120)...    35   0.65 
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    35   0.66 
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...    35   0.67 
AGR195W Chr7 (1120597..1122456) [1860 bp, 619 aa] {ON} Syntenic ...    35   0.67 
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    35   0.67 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    35   0.68 
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    35   0.68 
Suva_8.358 Chr8 complement(630597..632165) [1569 bp, 522 aa] {ON...    35   0.70 
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    35   0.70 
Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W (...    35   0.73 
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    35   0.73 
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    35   0.74 
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    35   0.75 
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    35   0.77 
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    35   0.77 
CAGL0I09702g Chr9 complement(925383..926948) [1566 bp, 521 aa] {...    35   0.78 
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    35   0.80 
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    34   0.82 
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    34   0.83 
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    34   0.86 
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    34   0.91 
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    34   0.93 
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         34   0.95 
Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W (...    34   0.98 
YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON} ...    34   0.99 
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    34   1.0  
KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {...    34   1.1  
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    34   1.2  
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    34   1.2  
SAKL0F16632g Chr6 complement(1375911..1377758) [1848 bp, 615 aa]...    34   1.2  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...    34   1.2  
NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa] ...    34   1.3  
Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {...    34   1.3  
Suva_12.262 Chr12 (430121..430195) [75 bp, 25 aa] {OFF} YNR072W ...    30   1.3  
KNAG0D05230 Chr4 complement(952025..953386) [1362 bp, 453 aa] {O...    33   1.5  
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    33   1.5  
SAKL0E11110g Chr5 (933600..935456) [1857 bp, 618 aa] {ON} simila...    33   1.7  
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    33   1.8  
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    33   1.9  
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    33   2.0  
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...    32   2.0  
Smik_2.320 Chr2 (575945..577663) [1719 bp, 572 aa] {ON} YBR180W ...    33   2.1  
SAKL0G07480g Chr7 complement(621035..622549) [1515 bp, 504 aa] {...    33   2.1  
TBLA0C05470 Chr3 complement(1320528..1322477) [1950 bp, 649 aa] ...    33   2.1  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    33   2.2  
YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putati...    33   2.4  
TBLA0B07680 Chr2 (1819923..1822037) [2115 bp, 704 aa] {ON}             33   2.4  
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...    33   2.6  
TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.3...    33   2.7  
KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.5...    33   2.9  
Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...    33   3.0  
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    32   3.2  
Smik_15.488 Chr15 complement(839667..841235) [1569 bp, 522 aa] {...    32   3.4  
SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} simila...    32   3.5  
KNAG0I02170 Chr9 (426501..428408) [1908 bp, 635 aa] {ON} Anc_2.1...    32   3.6  
Klac_YGOB_Anc_8.858 Chr3 (1471304..1471548,1471550..1473029) [17...    32   3.8  
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...    32   4.1  
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...    32   4.1  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}       32   4.3  
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    32   4.3  
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    32   4.5  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    32   4.5  
KNAG0G03530 Chr7 (750723..752477) [1755 bp, 584 aa] {ON} Anc_8.8...    32   4.6  
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    32   4.7  
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       32   5.4  
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...    32   5.5  
KLTH0F09042g Chr6 complement(776944..778524) [1581 bp, 526 aa] {...    32   5.6  
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...    32   5.9  
AGL069C Chr7 complement(578235..580019) [1785 bp, 594 aa] {ON} N...    32   6.1  
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    32   6.3  
Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON} (1178...    32   6.8  
TDEL0G04730 Chr7 complement(862915..864624) [1710 bp, 569 aa] {O...    32   6.9  
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    32   7.0  
KNAG0G03160 Chr7 complement(681071..682642) [1572 bp, 523 aa] {O...    31   7.3  
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    31   7.5  
AEL114C Chr5 complement(407131..408903) [1773 bp, 590 aa] {ON} S...    31   7.6  
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    31   7.9  
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    31   8.2  
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    31   8.3  
TDEL0E04520 Chr5 complement(844782..846344) [1563 bp, 520 aa] {O...    31   8.4  
TPHA0C04830 Chr3 (1043390..1045186) [1797 bp, 598 aa] {ON} Anc_8...    31   8.6  
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...    31   8.8  
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    31   8.9  
SAKL0B05676g Chr2 complement(489102..490607) [1506 bp, 501 aa] {...    31   9.1  
TDEL0A05130 Chr1 complement(910315..912114) [1800 bp, 599 aa] {O...    31   9.2  
Kwal_33.15241 s33 complement(1027827..1029569) [1743 bp, 580 aa]...    31   9.3  
TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30 ...    31   9.6  

>NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 1155 bits (2988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/562 (100%), Positives = 562/562 (100%)

Query: 1   MDYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIM 60
           MDYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIM
Sbjct: 1   MDYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIM 60

Query: 61  CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAI 120
           CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAI
Sbjct: 61  CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAI 120

Query: 121 GSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLS 180
           GSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLS
Sbjct: 121 GSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLS 180

Query: 181 PMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALV 240
           PMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALV
Sbjct: 181 PMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALV 240

Query: 241 MIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGS 300
           MIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGS
Sbjct: 241 MIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGS 300

Query: 301 ASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGI 360
           ASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGI
Sbjct: 301 ASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGI 360

Query: 361 VNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNT 420
           VNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNT
Sbjct: 361 VNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNT 420

Query: 421 MIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITG 480
           MIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITG
Sbjct: 421 MIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITG 480

Query: 481 AINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGT 540
           AINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGT
Sbjct: 481 AINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGT 540

Query: 541 DYNAEALATDDKPIYKRMFSKN 562
           DYNAEALATDDKPIYKRMFSKN
Sbjct: 541 DYNAEALATDDKPIYKRMFSKN 562

>NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/549 (85%), Positives = 513/549 (93%), Gaps = 2/549 (0%)

Query: 14  SSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGW 73
           ++  GS HS  +  E KKD  DF+E  + + EIPKKPASAY SVCIMCLMVAFGGFISGW
Sbjct: 18  NNDVGSYHS-DNISETKKDISDFDEAAAPV-EIPKKPASAYTSVCIMCLMVAFGGFISGW 75

Query: 74  DTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVG 133
           DTGTIGGF++ +DYINRFGS+H  G+KY+SKVRTGLLVSIFNVGCAIGSV LGRLGD++G
Sbjct: 76  DTGTIGGFMAQTDYINRFGSTHPSGTKYMSKVRTGLLVSIFNVGCAIGSVFLGRLGDSIG 135

Query: 134 RRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLR 193
           RRKGIV+   IYIVGIVIQIASIDKW+QYFIGRII GLGSG IAVLSPMLISE+SPKHLR
Sbjct: 136 RRKGIVVGASIYIVGIVIQIASIDKWFQYFIGRIIGGLGSGAIAVLSPMLISEVSPKHLR 195

Query: 194 GTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPR 253
           GTLVSCYQLM+TFG+FLGYCTNYGTK Y+NS+QWRVPLGLCFAWALVMIGAMF+VPESPR
Sbjct: 196 GTLVSCYQLMVTFGIFLGYCTNYGTKNYNNSVQWRVPLGLCFAWALVMIGAMFLVPESPR 255

Query: 254 YLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKV 313
           YLVEKG IEEAKRSVAKSNKVT+DDPATIQE+ELVQIAV+AE+ AG+ASW+ELF TKTKV
Sbjct: 256 YLVEKGLIEEAKRSVAKSNKVTVDDPATIQEVELVQIAVDAEREAGTASWAELFHTKTKV 315

Query: 314 LQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVV 373
            QRTLMGV+VLALQQLTGCNYFFYYGT++F AVGLEDSFQTS++FGIVNFASTFVALYVV
Sbjct: 316 FQRTLMGVVVLALQQLTGCNYFFYYGTLVFSAVGLEDSFQTSIVFGIVNFASTFVALYVV 375

Query: 374 DKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFA 433
           DKYGRRTCLLWGAAGMVCCMVVFASVGVT+LWP+G+   SSKGAGN MIVFSCFFIFCFA
Sbjct: 376 DKYGRRTCLLWGAAGMVCCMVVFASVGVTRLWPHGKGNGSSKGAGNCMIVFSCFFIFCFA 435

Query: 434 TTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGC 493
           TTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI+FYYGYVF+GC
Sbjct: 436 TTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIDFYYGYVFMGC 495

Query: 494 LVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKP 553
           LVF+YCYVFAFVPETKGLQLEDVN+MWEEGVLPWKSASWVPPSQRG  Y+A+ALATDDKP
Sbjct: 496 LVFAYCYVFAFVPETKGLQLEDVNVMWEEGVLPWKSASWVPPSQRGDTYDADALATDDKP 555

Query: 554 IYKRMFSKN 562
           +YKR+FSKN
Sbjct: 556 LYKRIFSKN 564

>NCAS0E00160 Chr5 complement(15851..17527) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/559 (78%), Positives = 499/559 (89%), Gaps = 2/559 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           S+    E  + S + SVHS+Q    +KKD  D    +  +I+IP+KPASAY++VCI CLM
Sbjct: 2   SEENIPETDNLSASVSVHSNQ--DGLKKDLSDLETNEQHVIDIPQKPASAYIAVCIFCLM 59

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGGFISGWDTGTIGGFL+H D++ RFGS HSDG+ Y S VRTGLLVSIFN+GC +G+V
Sbjct: 60  VAFGGFISGWDTGTIGGFLAHPDFVGRFGSKHSDGTPYFSNVRTGLLVSIFNIGCCVGAV 119

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
            LGRLGD  GRR GIV+AV IYIVGIVIQIAS+DKWYQYFIGRI+AGLGSGTIAVLSPML
Sbjct: 120 FLGRLGDMYGRRIGIVLAVIIYIVGIVIQIASVDKWYQYFIGRIVAGLGSGTIAVLSPML 179

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE+SPKHLRGTLVSCYQLMITFG+FLGYC NYGTK Y+NSIQWRVPLGLCFAWAL +I 
Sbjct: 180 ISEVSPKHLRGTLVSCYQLMITFGIFLGYCANYGTKKYNNSIQWRVPLGLCFAWALFLIA 239

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
           AMF VPESPRYLVE G+IEEAKRSVA+SNKV+IDDPATI E+E++Q+AVE+E+AAGSASW
Sbjct: 240 AMFFVPESPRYLVEAGKIEEAKRSVAQSNKVSIDDPATIAEVEIIQVAVESERAAGSASW 299

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            ELFQTKTKVL RT+M V+VLALQQLTGCNYFFYYGTI+F AVG+ DS++TS++FGIVNF
Sbjct: 300 GELFQTKTKVLPRTIMCVMVLALQQLTGCNYFFYYGTIVFNAVGMSDSYETSIVFGIVNF 359

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
           ASTFVALYVVDK+GRRTCLLWGAAGMVCCMVVFASVGV  L P+G D PSSKGAGN MIV
Sbjct: 360 ASTFVALYVVDKFGRRTCLLWGAAGMVCCMVVFASVGVKSLHPHGDDGPSSKGAGNCMIV 419

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           FSCFFIFCFAT+WAPIPFVI+SESFP ++KAKGMA+GTVSNQ+WNFCIGFFTPFITGAI+
Sbjct: 420 FSCFFIFCFATSWAPIPFVIVSESFPTKIKAKGMAIGTVSNQLWNFCIGFFTPFITGAID 479

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYN 543
           FYYGYVFLGCLVF+YCYVF FVPETKGLQLEDVN+MWEEGVLPWKS++WVPPSQRG DY+
Sbjct: 480 FYYGYVFLGCLVFAYCYVFMFVPETKGLQLEDVNIMWEEGVLPWKSSAWVPPSQRGADYD 539

Query: 544 AEALATDDKPIYKRMFSKN 562
           A+ LA DDKP +KRM  KN
Sbjct: 540 AQELANDDKPAWKRMVGKN 558

>NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/545 (80%), Positives = 488/545 (89%), Gaps = 5/545 (0%)

Query: 21  HSSQSFQEMKKDSQDF----NEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTG 76
           HS  S  E+K+D         E  S ++EIPKKPASAY++V IMCLMVAFGGFI GWDTG
Sbjct: 7   HSLGS-NEIKQDQTSLYDHEQEHGSPLVEIPKKPASAYVAVFIMCLMVAFGGFILGWDTG 65

Query: 77  TIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRK 136
           TIGGF++ +D+I RFGS H DGS YLSKVR GLLVSIFN+GCAIGSV LGRLGDT+GRRK
Sbjct: 66  TIGGFMAQTDFIRRFGSKHRDGSHYLSKVRIGLLVSIFNIGCAIGSVFLGRLGDTIGRRK 125

Query: 137 GIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTL 196
           GIV+AV IY+VGIVIQIAS+ KW+QY IGRII+GLG+G IAVLSPMLISE+SPKHLRGTL
Sbjct: 126 GIVVAVSIYMVGIVIQIASVKKWFQYLIGRIISGLGAGCIAVLSPMLISEVSPKHLRGTL 185

Query: 197 VSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLV 256
           VSCYQLM+TFG+FLGYCTNYGTK + NS+QWRVPLGLCFAWAL M+GAMF+VPESP YLV
Sbjct: 186 VSCYQLMVTFGIFLGYCTNYGTKKHSNSVQWRVPLGLCFAWALFMLGAMFLVPESPHYLV 245

Query: 257 EKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQR 316
           + G IEEAKRSVAKSNKVTIDDPA IQE+E+VQIAVEAE A G + W ELF+TK K+ QR
Sbjct: 246 KNGLIEEAKRSVAKSNKVTIDDPAVIQEVEMVQIAVEAEHAGGPSRWMELFETKNKIFQR 305

Query: 317 TLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKY 376
            ++GV++L LQQLTG NYFFYYGTI+FKAVGLEDSFQTS++FGIVNFASTFVALYVVDKY
Sbjct: 306 VVVGVVLLGLQQLTGVNYFFYYGTIVFKAVGLEDSFQTSIVFGIVNFASTFVALYVVDKY 365

Query: 377 GRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTW 436
           GRRTCLLWGAAGMVCCMVVFASVGVT+LWP+G+   SSKGAGN MIVFSCFFIFCFATTW
Sbjct: 366 GRRTCLLWGAAGMVCCMVVFASVGVTRLWPHGKGNGSSKGAGNCMIVFSCFFIFCFATTW 425

Query: 437 APIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVF 496
           APIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVF
Sbjct: 426 APIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVF 485

Query: 497 SYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYK 556
           S+ YVF FVPETKGLQL+D+N+MWEEGVL WKSASWVPPSQRG  Y+A+ALATDDKP+YK
Sbjct: 486 SWFYVFIFVPETKGLQLDDINVMWEEGVLSWKSASWVPPSQRGDTYDADALATDDKPLYK 545

Query: 557 RMFSK 561
           RM  +
Sbjct: 546 RMLGR 550

>TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/573 (72%), Positives = 484/573 (84%), Gaps = 15/573 (2%)

Query: 4   SQSPTGEDVHSSTAG-------SVHSSQSFQEMKKDSQDFNEIDS------QIIEIPKKP 50
           S+    EDV SS +G       SVHS++ FQ+     QDF+++++      Q IEIPK+P
Sbjct: 2   SEVAYNEDVGSSGSGIEHTDIESVHSNR-FQKEDDMKQDFDDMENSLDDTPQAIEIPKQP 60

Query: 51  ASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLL 110
            SAY++VC+ C+MVAFGGFI+GWD GTIGGF++ +D++ RFGS HSDG+ YLSKVRTGLL
Sbjct: 61  KSAYITVCLTCIMVAFGGFINGWDIGTIGGFVAQTDFLERFGSRHSDGTAYLSKVRTGLL 120

Query: 111 VSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAG 170
           VSIFNVGCAIGSV LGRLGD  GRR G+++A  I++VG+VI+IASIDKWYQYFIGRIIAG
Sbjct: 121 VSIFNVGCAIGSVTLGRLGDIYGRRLGLIMATAIFVVGVVIEIASIDKWYQYFIGRIIAG 180

Query: 171 LGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVP 230
           +G G IAVLSPMLISE+SPK +RG +VSCYQLMIT G+FLG C NYGTKTY +S QWRV 
Sbjct: 181 IGMGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCCNYGTKTYSDSTQWRVG 240

Query: 231 LGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQI 290
           LGL FAW L M+G M  VPESPRYLVEKG++EEAKRSVA SNK+T+DDPA I E+E +QI
Sbjct: 241 LGLQFAWCLCMVGGMMFVPESPRYLVEKGKLEEAKRSVATSNKLTVDDPAVISEVEEIQI 300

Query: 291 AVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLED 350
           AVE E+A G A W ELFQT  KV QR +MGV VL LQQLTG NYFFYYGT +FK+VGLED
Sbjct: 301 AVEKERAEGEAGWGELFQTHNKVFQRVIMGVAVLGLQQLTGANYFFYYGTTVFKSVGLED 360

Query: 351 SFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQD 410
            FQ +++FG+VNF STFVAL VVDK+GRRTCLL+GAAGM+CCM VFASVGVT+LWP+G+D
Sbjct: 361 GFQAAIVFGVVNFVSTFVALSVVDKFGRRTCLLFGAAGMICCMCVFASVGVTRLWPDGKD 420

Query: 411 QP-SSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNF 469
              SSKGAGN MIVFSCFFIFCFAT+WAPIPFVIISESFPLRVKAKGMALGTVSNQMWNF
Sbjct: 421 AGVSSKGAGNCMIVFSCFFIFCFATSWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNF 480

Query: 470 CIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKS 529
           CIGFFTPFITGAI+FYYGYVFLGCLVF + YVF FVPETKGLQLEDVN+MWEEGVLPWKS
Sbjct: 481 CIGFFTPFITGAIDFYYGYVFLGCLVFCWFYVFFFVPETKGLQLEDVNVMWEEGVLPWKS 540

Query: 530 ASWVPPSQRGTDYNAEALATDDKPIYKRMFSKN 562
           ASWVPPSQR  DY+ +A+A DD+P++K+MF ++
Sbjct: 541 ASWVPPSQRSADYDVDAMANDDQPVFKKMFGRH 573

>TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa]
           {ON} 
          Length = 575

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/549 (75%), Positives = 473/549 (86%), Gaps = 2/549 (0%)

Query: 13  HSSTAGSVHSSQSFQEMKKDSQDFNEID--SQIIEIPKKPASAYLSVCIMCLMVAFGGFI 70
           +S+ A    S +   ++K D     + D  S  IEIPKKPASAYLSVCIMCLMVAFGGFI
Sbjct: 24  NSADAYIAPSLKDEGDLKNDEYPIEQCDESSSQIEIPKKPASAYLSVCIMCLMVAFGGFI 83

Query: 71  SGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGD 130
           +GWD GTIGGF++ +D+I RFGS +SDG  YLSKVRTGLLV+IFNVGCAIGSV LGR+GD
Sbjct: 84  NGWDIGTIGGFVAQTDFIKRFGSLNSDGEPYLSKVRTGLLVAIFNVGCAIGSVTLGRVGD 143

Query: 131 TVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPK 190
             GRR G+++A  I++ G+VIQIAS DKWYQYFIGRIIAG+G G IAVLSPMLISE+SPK
Sbjct: 144 VYGRRLGLIMATVIFVAGVVIQIASTDKWYQYFIGRIIAGIGMGVIAVLSPMLISEVSPK 203

Query: 191 HLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPE 250
           HLRG +VSC+QLMITFG+FLG C NYGTKTYDNSIQWRV LG+ FAW L M+GAM  VPE
Sbjct: 204 HLRGAMVSCFQLMITFGIFLGNCCNYGTKTYDNSIQWRVGLGMQFAWCLFMVGAMLFVPE 263

Query: 251 SPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTK 310
           SPR+LVEKG+IEEAKRS+A+SNKV++DDP+TI E+E+VQ AVEAE+AAG A W ELFQT 
Sbjct: 264 SPRFLVEKGKIEEAKRSIARSNKVSVDDPSTIAEVEIVQAAVEAERAAGQAGWKELFQTS 323

Query: 311 TKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVAL 370
            KV QR +MG+ VL LQQLTG NYFFYYG  +F AVGLEDSFQT++IFG+VNFASTFVAL
Sbjct: 324 NKVFQRVIMGIAVLGLQQLTGANYFFYYGATVFNAVGLEDSFQTTIIFGVVNFASTFVAL 383

Query: 371 YVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIF 430
           YVVDK+GRR CLLWGAA M CCMVVFA+VGVT L+PNG+DQ S K AGN MIVFSC FIF
Sbjct: 384 YVVDKFGRRRCLLWGAAAMTCCMVVFATVGVTSLYPNGKDQASEKWAGNVMIVFSCLFIF 443

Query: 431 CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVF 490
           CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI+FYYGYVF
Sbjct: 444 CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIDFYYGYVF 503

Query: 491 LGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATD 550
           +GCLVF+Y YVF FVPETKGLQLEDVN+MWEEGVLPWKS SWVPPS+R  DY+ +ALA D
Sbjct: 504 MGCLVFAYFYVFFFVPETKGLQLEDVNIMWEEGVLPWKSNSWVPPSKRDDDYDVDALAND 563

Query: 551 DKPIYKRMF 559
           D+P++K+MF
Sbjct: 564 DQPMFKKMF 572

>TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa]
           {ON} 
          Length = 575

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/556 (74%), Positives = 476/556 (85%), Gaps = 3/556 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           +Q     DV+   A S+     F+  +   +  ++  SQI EIPKKPASAY+SVC+MCLM
Sbjct: 20  TQIENNNDVY--IAPSIKDDDEFKNDEYPLEQSDDSPSQI-EIPKKPASAYISVCVMCLM 76

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGGFI+GWD GTIGGF++ +D++ RFGS +S+G  YLSKVRTGLLV+IFN+GCAIGSV
Sbjct: 77  VAFGGFINGWDIGTIGGFVAQTDFVKRFGSLNSNGEPYLSKVRTGLLVAIFNIGCAIGSV 136

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
            LGR+GD  GRR G+++A  I++ G+VIQIAS DKWYQYFIGRIIAG+G G IAVLSPML
Sbjct: 137 TLGRVGDVYGRRLGLIMATIIFVAGVVIQIASTDKWYQYFIGRIIAGIGMGVIAVLSPML 196

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE+SPKHLRG +VSCYQLMITFG+FLG C NYGTKTYDNSIQWRV LGL FAW L M+G
Sbjct: 197 ISEVSPKHLRGAMVSCYQLMITFGIFLGNCCNYGTKTYDNSIQWRVGLGLQFAWCLFMVG 256

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
           AM  VPESPR+LVEKG+IEEAKRS+A+SNKV+IDDP+TI E+E+VQ AVEAE+AAG A W
Sbjct: 257 AMLFVPESPRFLVEKGKIEEAKRSIARSNKVSIDDPSTIAEVEIVQAAVEAERAAGEAGW 316

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            ELFQT  KV QR +MG+ VL LQQLTG NYFFYYG  +F AVGLEDSFQT++IFG+VNF
Sbjct: 317 KELFQTSNKVFQRVIMGIAVLGLQQLTGANYFFYYGATVFNAVGLEDSFQTTIIFGVVNF 376

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
           ASTFVALYVVDK+GRR CLLWGAA M CCMVVFA+VGVT L+PNG+DQ S K AGN MIV
Sbjct: 377 ASTFVALYVVDKFGRRRCLLWGAAAMTCCMVVFATVGVTSLYPNGKDQASEKWAGNVMIV 436

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           FSC FIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI+
Sbjct: 437 FSCLFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAID 496

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYN 543
           FYYGYVF+GCLVF+Y YVF FVPETKGLQLEDVN+MWEEGVLPWKS SWVPPS+R  DY+
Sbjct: 497 FYYGYVFMGCLVFAYFYVFFFVPETKGLQLEDVNIMWEEGVLPWKSNSWVPPSKRDDDYD 556

Query: 544 AEALATDDKPIYKRMF 559
            +ALA DD+P++K+MF
Sbjct: 557 VDALANDDQPMFKKMF 572

>TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/561 (73%), Positives = 472/561 (84%), Gaps = 4/561 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQI--IEIPKKPASAYLSVCIMC 61
           S S T E  H+    +  S +   E KK+   F + +     IEIPKKPASAYLSVC+MC
Sbjct: 16  SNSTTIE--HNEDVCATPSYKDDDEFKKNEFVFEQSNDTTSGIEIPKKPASAYLSVCLMC 73

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           LMVAFGGFI+GWD GTIGGF++ +D+I RFGS  S G   LSK+RTGLLV+IFNVGCAIG
Sbjct: 74  LMVAFGGFINGWDIGTIGGFVAQTDFIKRFGSPDSTGQVTLSKMRTGLLVAIFNVGCAIG 133

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
           SV LGR+GD  GRR G+++A  I++ G+VIQIAS DKWYQYFIGRIIAG+G G IAVLSP
Sbjct: 134 SVTLGRVGDVYGRRLGLIMATIIFVAGVVIQIASTDKWYQYFIGRIIAGIGMGVIAVLSP 193

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           MLISE+SPKHLRG +VSCYQLMITFG+FLG C NYGTKTYDNSIQWRV LGL FAW L M
Sbjct: 194 MLISEVSPKHLRGAMVSCYQLMITFGIFLGNCCNYGTKTYDNSIQWRVGLGLQFAWCLFM 253

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
           +GAM  VPESPR+LVEKG+IEEAKRS+A+SNKV+IDDP+TI E+E+VQ AVE E+ AG A
Sbjct: 254 VGAMLFVPESPRFLVEKGKIEEAKRSIARSNKVSIDDPSTIAEVEIVQAAVEVERIAGQA 313

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
            W EL QT  KV QR +MG+ VL LQQLTG NYFFYYG  IFKAVGLEDSFQT++IFGIV
Sbjct: 314 GWGELLQTGNKVFQRVIMGIAVLGLQQLTGANYFFYYGATIFKAVGLEDSFQTTIIFGIV 373

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           NFASTFVALYVVDK+GRR CLLWGAA M CCMVVFASVGVT L+PNG+DQPSSK AGN M
Sbjct: 374 NFASTFVALYVVDKFGRRMCLLWGAAAMTCCMVVFASVGVTSLYPNGKDQPSSKWAGNVM 433

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           IVFSCFFIF FATTWAP+PFVIISESFPLRVKAKGMALGTVSNQ+WNFCIGFFTPFIT A
Sbjct: 434 IVFSCFFIFSFATTWAPVPFVIISESFPLRVKAKGMALGTVSNQLWNFCIGFFTPFITNA 493

Query: 482 INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTD 541
           I F YGYVF+GCL+F+Y YVF FVPETKGLQLEDVN+MWEEGVLPWKS SWVPPS+R  D
Sbjct: 494 IGFNYGYVFMGCLIFAYFYVFFFVPETKGLQLEDVNIMWEEGVLPWKSNSWVPPSKRDDD 553

Query: 542 YNAEALATDDKPIYKRMFSKN 562
           Y+ +ALA DD+P++K+MF ++
Sbjct: 554 YDVDALANDDQPMFKKMFGRH 574

>TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}
          Length = 574

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/567 (71%), Positives = 471/567 (83%), Gaps = 14/567 (2%)

Query: 10  EDVHSSTAGSVHS------SQSFQEMKKDSQDF-------NEIDSQIIEIPKKPASAYLS 56
           ED  S   G V++      S +FQ+  +  QD+       +E     IEIPKKP SAY++
Sbjct: 8   EDPSSDHTGVVNTDTESVQSNNFQKEDELKQDYGVDNFSGDENSPHAIEIPKKPKSAYIT 67

Query: 57  VCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNV 116
           VC+ C+MVAFGGFI+GWD GTIGGF++ +D+  RFGS++ DG  YLSKVRTGLLVSIFNV
Sbjct: 68  VCLTCVMVAFGGFINGWDIGTIGGFIAQTDFKRRFGSTNKDGEHYLSKVRTGLLVSIFNV 127

Query: 117 GCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTI 176
           GCAIGSV LGRLGD  GRR G+++A  I++VG+VI+IASIDKWYQYFIGRIIAG+G G I
Sbjct: 128 GCAIGSVTLGRLGDIYGRRLGLIMATVIFVVGVVIEIASIDKWYQYFIGRIIAGIGMGVI 187

Query: 177 AVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFA 236
           AVLSPMLISE+SPK +RG +VSCYQLMIT G+FLG CT YG+KTY +S QWRV LGL FA
Sbjct: 188 AVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCTEYGSKTYSDSTQWRVGLGLQFA 247

Query: 237 WALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQ 296
           W L M+G M  VPESPR+L+EKG++EEAKRSVA SNK+  DDPA I E+E +QIAVE E+
Sbjct: 248 WCLFMVGGMMFVPESPRFLIEKGKLEEAKRSVATSNKLHADDPAVISEVEEIQIAVEKER 307

Query: 297 AAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSL 356
           A G A W ELFQT  KV QR +MG++VLALQQLTG NYFFYYGT IFK+VGLED F+ ++
Sbjct: 308 AEGQAGWGELFQTHNKVFQRVIMGIMVLALQQLTGANYFFYYGTTIFKSVGLEDGFEAAI 367

Query: 357 IFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSK 415
           +FG+VNF STF ALY++DK+GRRTCLLWGAAGMVCCMVVFASVGVT+LWP G++   SSK
Sbjct: 368 VFGVVNFVSTFFALYLIDKFGRRTCLLWGAAGMVCCMVVFASVGVTRLWPEGKNAGVSSK 427

Query: 416 GAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFT 475
           GAGN MIVFSCFFIFCFAT+WAP+PFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFT
Sbjct: 428 GAGNCMIVFSCFFIFCFATSWAPVPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFT 487

Query: 476 PFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPP 535
           PFITG+INFYYGYVFLGCLVF++ YVF FVPETKGLQLEDVN+MWEEGVLPWKSASWVPP
Sbjct: 488 PFITGSINFYYGYVFLGCLVFAWFYVFFFVPETKGLQLEDVNVMWEEGVLPWKSASWVPP 547

Query: 536 SQRGTDYNAEALATDDKPIYKRMFSKN 562
           SQRG DY+  A+A DD P +K++  K+
Sbjct: 548 SQRGADYDVAAMANDDTPAWKKVLGKH 574

>TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/567 (68%), Positives = 468/567 (82%), Gaps = 14/567 (2%)

Query: 10  EDVHSSTAGSVHS------SQSFQEMKKDSQDF-------NEIDSQIIEIPKKPASAYLS 56
           ED  S + G V++      +  FQ+  K  QD+       NE   Q IEIPKKP SAY++
Sbjct: 8   EDPSSDSTGVVNTDTESVQTNDFQKTDKLKQDYGVDNFSGNENSPQAIEIPKKPKSAYIT 67

Query: 57  VCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNV 116
           VC+ C+MVAFGGF+ GWD GTIGGF++  D+  RFGS+  +G  YLSKVRTGLLVSIFN+
Sbjct: 68  VCLTCIMVAFGGFMMGWDIGTIGGFIAQPDFKRRFGSTTKEGEHYLSKVRTGLLVSIFNI 127

Query: 117 GCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTI 176
           GCAIGSV LGRLGD  GRR G+++A  I++VG+VI+IASIDKWYQYFIGRIIAG+G G I
Sbjct: 128 GCAIGSVTLGRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVI 187

Query: 177 AVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFA 236
           A+LSPMLISE+SP+ +RG +VSC+QLMIT G+FLG CT YGTKTY NS+QWRV LGL FA
Sbjct: 188 AILSPMLISEVSPREMRGAMVSCFQLMITLGIFLGDCTEYGTKTYSNSVQWRVGLGLQFA 247

Query: 237 WALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQ 296
           W L M+G M  VPESPRYLVEKG++EEAKRSVA SNK+  DDPA I E+E +Q AVE E+
Sbjct: 248 WCLCMVGGMMFVPESPRYLVEKGKLEEAKRSVATSNKLNADDPAVISEVEEIQSAVEKER 307

Query: 297 AAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSL 356
           A G A W ELFQT  KV QR +MG++++ALQQL+G NYFFYYGT +FK+VGLED F+ ++
Sbjct: 308 AEGQAGWGELFQTHNKVFQRVIMGIMIMALQQLSGANYFFYYGTTVFKSVGLEDGFEAAI 367

Query: 357 IFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSK 415
           +FG+VNF STF ALY++D++GRRTCLLWGAAGMVCCMV+FASVGVT+LWP G++   +SK
Sbjct: 368 VFGVVNFVSTFFALYLIDRFGRRTCLLWGAAGMVCCMVIFASVGVTRLWPKGKNAGITSK 427

Query: 416 GAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFT 475
           GAGN MIVFSCFFIFCFAT+WAP+PFVIISE++PLRVKAKGMAL TVSNQ+WNFCIGFFT
Sbjct: 428 GAGNCMIVFSCFFIFCFATSWAPVPFVIISETYPLRVKAKGMALATVSNQLWNFCIGFFT 487

Query: 476 PFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPP 535
           PFITG+INFYYGYVFLGCLVF++ YVF FVPETKGLQLEDVN+MWEEGVLPWKS++WVPP
Sbjct: 488 PFITGSINFYYGYVFLGCLVFAWFYVFFFVPETKGLQLEDVNVMWEEGVLPWKSSTWVPP 547

Query: 536 SQRGTDYNAEALATDDKPIYKRMFSKN 562
           SQRG DY+ +A+A DD P +K M  K+
Sbjct: 548 SQRGADYDVDAMANDDTPAWKNMLGKH 574

>NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/560 (68%), Positives = 462/560 (82%), Gaps = 2/560 (0%)

Query: 4   SQSPTGEDVHSSTAGS--VHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMC 61
           SQ+    D+  S +GS  +  +QS +    + +DF + +    E+PKKPAS Y++V I+C
Sbjct: 14  SQNVNDNDLAPSDSGSHSILENQSNKGEDDEMKDFGDNEIAPHEMPKKPASEYVTVSILC 73

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           LM+AFGG++ GWDTGTI GF+S +D+I RFG  H DG+ YLSKVRTGLL++IFN+GCAIG
Sbjct: 74  LMIAFGGYVYGWDTGTISGFVSQTDWIRRFGQKHHDGTHYLSKVRTGLLLAIFNIGCAIG 133

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
            ++  RLGD  GRRK +V    +Y+VG++I IASIDKWYQYFIGRII+G+G G IAV SP
Sbjct: 134 GLLFSRLGDIYGRRKALVFVTVVYMVGLIISIASIDKWYQYFIGRIISGMGVGGIAVYSP 193

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           +LISE+SPKH+RGTLVSCYQLMIT G+FLGYCTNYGT+ Y NS+QWRVPLGL FAWAL M
Sbjct: 194 LLISEVSPKHVRGTLVSCYQLMITLGIFLGYCTNYGTRNYSNSVQWRVPLGLGFAWALFM 253

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
           I AMF VPESPRYL+E GQ EEAK SVA+SNK+T+DDP+ I E+E +   VEAE+AAGSA
Sbjct: 254 IAAMFFVPESPRYLIEVGQFEEAKLSVARSNKLTVDDPSVIAEVEFLTAGVEAEKAAGSA 313

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           SW ELFQTK K+L R +MG++V  LQQLTG NYFF+YGT+IF + GLED F+TS+I G+V
Sbjct: 314 SWGELFQTKGKILHRVIMGIMVQTLQQLTGANYFFFYGTLIFASSGLEDGFETSVIIGVV 373

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           NF STF A+Y+VD++GRRTCLLWGAAGM+CCMVVFASVGVT+LWPNGQDQPSSKGAGN M
Sbjct: 374 NFVSTFPAIYIVDRFGRRTCLLWGAAGMICCMVVFASVGVTRLWPNGQDQPSSKGAGNCM 433

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           I F+ FFIFCFATTWAP  +VI+SESFPLR+KAKGM+L   +N MWNF +GFFTPFITGA
Sbjct: 434 ICFTMFFIFCFATTWAPCAYVIVSESFPLRIKAKGMSLAIAANWMWNFLLGFFTPFITGA 493

Query: 482 INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTD 541
           INFYYGYVF+GCL FS+ YVF F+PETKGL LE+VN MWEEGVLPWKS+ WVPP++RG D
Sbjct: 494 INFYYGYVFMGCLCFSWVYVFFFIPETKGLTLEEVNTMWEEGVLPWKSSEWVPPNKRGAD 553

Query: 542 YNAEALATDDKPIYKRMFSK 561
           Y+  A+A DDKP++KRM  K
Sbjct: 554 YDVNAMANDDKPLFKRMLGK 573

>KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/554 (70%), Positives = 457/554 (82%), Gaps = 6/554 (1%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQ----IIEIPKKPASAYLSVCIMCLMVA 65
           +  H ST+   HS  S    K DS+D N         +IEIPKKPASAY+ V I+CLMVA
Sbjct: 4   QSSHESTS-EPHSVVSDPLAKTDSKDVNSFAEDNANAVIEIPKKPASAYVGVSIICLMVA 62

Query: 66  FGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVL 125
           FGGF+ GWDTGTIGG+LS +D++ RFG  H DGS Y SKVRTGL+VSIF +GCAIG +V 
Sbjct: 63  FGGFVFGWDTGTIGGYLSQTDFMRRFGMQHPDGSYYFSKVRTGLIVSIFCIGCAIGGIVF 122

Query: 126 GRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLIS 185
            +LGD  GRR  +VI   +Y+VGI+I IASIDKWYQYFIGRIIAGLG G IAV SP+LIS
Sbjct: 123 SKLGDQYGRRIALVIVTIVYMVGILISIASIDKWYQYFIGRIIAGLGVGGIAVYSPLLIS 182

Query: 186 EISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTK-TYDNSIQWRVPLGLCFAWALVMIGA 244
           E+SPKHLRGTLVSCYQLMIT G+F+GYCTNYGTK +Y NS QWRVPLGL FAWAL MIGA
Sbjct: 183 EVSPKHLRGTLVSCYQLMITLGIFIGYCTNYGTKESYSNSTQWRVPLGLGFAWALFMIGA 242

Query: 245 MFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS 304
           MF+VPESPRYL+E  ++EEAKRS+A SNKV+IDDP+ I E+EL+   +EAE+AAG+ASW 
Sbjct: 243 MFLVPESPRYLLEVNKVEEAKRSIAVSNKVSIDDPSVIAEVELLSAGIEAERAAGNASWG 302

Query: 305 ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFA 364
           ELF  K K+LQR +MG+ +  LQQLTG NYFFYYGT IFK++GLEDSF+TS+I G+VNFA
Sbjct: 303 ELFSPKGKILQRLIMGISIQTLQQLTGANYFFYYGTSIFKSIGLEDSFETSIIIGVVNFA 362

Query: 365 STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVF 424
           STFV +Y V+++GRR CLLWGA GM+CCMVVFASVGVT+L+PNG DQPSSKGAGN MIVF
Sbjct: 363 STFVGIYFVERFGRRRCLLWGAVGMICCMVVFASVGVTRLYPNGDDQPSSKGAGNCMIVF 422

Query: 425 SCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINF 484
           +CFFIFCFATTWAPI +VI+SE+FPLRVKAKGMAL T +N  WNF IGFFTPFITGAINF
Sbjct: 423 TCFFIFCFATTWAPIAYVIVSETFPLRVKAKGMALSTAANWFWNFLIGFFTPFITGAINF 482

Query: 485 YYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNA 544
           YYGYVF+GCL F++ YVF FVPETKGL LE+V++MW+EGVLPWKSA W+PP++RG D++ 
Sbjct: 483 YYGYVFMGCLCFAWFYVFFFVPETKGLTLEEVDVMWQEGVLPWKSADWIPPARRGADFDE 542

Query: 545 EALATDDKPIYKRM 558
            A   DDKP YKRM
Sbjct: 543 AAFTQDDKPFYKRM 556

>NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/560 (66%), Positives = 458/560 (81%), Gaps = 5/560 (0%)

Query: 2   DYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMC 61
           D+   P+    HS     +  + S +  +++++ FN+++    E+PKKPAS Y++V I+C
Sbjct: 20  DFQSQPSESGSHS-----IMEAPSNKGEEEENKGFNDVNIPPAEMPKKPASEYVTVSILC 74

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           LM+AFGG++ GWDTGTI GF+S +D+I RFG   +DG+ YLSKVRTGLL++IFN+GCAIG
Sbjct: 75  LMIAFGGYVYGWDTGTISGFVSQTDWIRRFGQQRADGTYYLSKVRTGLLLAIFNIGCAIG 134

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
            +   RLGD  GRRK +V    +Y+VG+VI IASIDKWYQYFIGRII+G+G G IAV SP
Sbjct: 135 GLAFSRLGDIYGRRKALVFVTIVYMVGLVISIASIDKWYQYFIGRIISGMGVGGIAVYSP 194

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           +LISE+SPKH+RGTLVSCYQLMIT G+FLGYCTNYGT+ Y NS+QWRVPLGL FAWAL M
Sbjct: 195 LLISEVSPKHVRGTLVSCYQLMITLGIFLGYCTNYGTRNYSNSVQWRVPLGLGFAWALFM 254

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
           I AM  VPESPR+L+E  Q +EA+RSVA+SNKV++DDP+ I E+E +   VE E+AAGSA
Sbjct: 255 IAAMLFVPESPRFLIEVSQFDEARRSVARSNKVSVDDPSVIAEVEFLTAGVELEKAAGSA 314

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           SW ELFQTK KVL R +MG+++  LQQLTG NYFF+YGT+IF +VGL D FQTS+I G+V
Sbjct: 315 SWGELFQTKGKVLHRVIMGIMIQTLQQLTGANYFFFYGTLIFASVGLNDGFQTSVIIGVV 374

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           NF STF A+Y+VD++GRRTCLLWGAAGM+CCMVVFASVGVT+LWPNG+DQPSSKGAGN M
Sbjct: 375 NFVSTFPAIYIVDRFGRRTCLLWGAAGMICCMVVFASVGVTRLWPNGKDQPSSKGAGNCM 434

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           I F+ FFIFCFATTWAP  +VI+SESFPLR+KAKGM+L   +N  WNF +GFFTPFITGA
Sbjct: 435 ICFTMFFIFCFATTWAPCAYVIVSESFPLRIKAKGMSLAIAANWFWNFLLGFFTPFITGA 494

Query: 482 INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTD 541
           I+FYYGYVF+GCL F++ YVF FVPETKGL LE+VN MWEEGVLPWKSA WVPPS+R  D
Sbjct: 495 IDFYYGYVFMGCLCFAWVYVFLFVPETKGLTLEEVNTMWEEGVLPWKSAQWVPPSRRDAD 554

Query: 542 YNAEALATDDKPIYKRMFSK 561
           Y+  A+A+DDKP+YKRM  K
Sbjct: 555 YDVNAMASDDKPLYKRMLGK 574

>TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {ON}
           Anc_5.394 YHR092C
          Length = 574

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/560 (70%), Positives = 472/560 (84%), Gaps = 2/560 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           S + T  +  +S   SV  + +    K  + + + +   ++EIPK+  + Y++VC+MCLM
Sbjct: 16  SSNSTEIEELNSILTSVQDNDALNVKKTQTPNLS-VGEPLLEIPKRNPTEYITVCLMCLM 74

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGGFI+GWD GTIGGF++H+D++ RFG+  +DG+ YLSKVRTGL+VSIFNVGCAIG V
Sbjct: 75  VAFGGFINGWDIGTIGGFINHTDFLIRFGTRRADGTYYLSKVRTGLIVSIFNVGCAIGCV 134

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
            LGRLGD  GRR G++IA  I+IVG VI+IAS++ WYQYFIGRI+AG+G G IAVLSPML
Sbjct: 135 ALGRLGDMYGRRMGLIIASIIFIVGNVIEIASVEAWYQYFIGRIVAGVGMGVIAVLSPML 194

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE+SPK +RG +VSCYQLMIT G+FLGYC NYGTKTYD+S QWR+PLGL FAW L M+ 
Sbjct: 195 ISEVSPKAMRGAMVSCYQLMITMGIFLGYCANYGTKTYDDSRQWRIPLGLQFAWCLFMVA 254

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            M  VPESPRYLV+KG+IEEA+RSV+KSNK+ +DDP  I E++++ +AVE E+A G A W
Sbjct: 255 GMLFVPESPRYLVQKGKIEEARRSVSKSNKLPVDDPVVISEVDMIMVAVEKERAEGEAGW 314

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            E+F TK KV QR LMGVIVL LQQLTG NYFFYYGT IFKAVGLEDS++TS++FG+VNF
Sbjct: 315 KEMFDTKNKVFQRVLMGVIVLGLQQLTGANYFFYYGTTIFKAVGLEDSYETSIVFGVVNF 374

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSKGAGNTMI 422
           ASTFVALYVVD++GRRTCLLWGA GM+CCMVV+ASVGVT+LWPNG++   +SKGAGN MI
Sbjct: 375 ASTFVALYVVDRFGRRTCLLWGATGMICCMVVYASVGVTELWPNGENGGVTSKGAGNCMI 434

Query: 423 VFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI 482
            F+CFFIFCFAT+WAPIPFVIISESFPLRVK KGMALGTVSNQMWNF IGFFTPFITGAI
Sbjct: 435 CFACFFIFCFATSWAPIPFVIISESFPLRVKTKGMALGTVSNQMWNFAIGFFTPFITGAI 494

Query: 483 NFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDY 542
           NFYYGYVFLGCLVF++ YVF FVPETKGL LEDVN+MWEEGVLPWKSASWVPPSQRG  Y
Sbjct: 495 NFYYGYVFLGCLVFAWFYVFFFVPETKGLVLEDVNVMWEEGVLPWKSASWVPPSQRGATY 554

Query: 543 NAEALATDDKPIYKRMFSKN 562
           + + LA DD+P++K+MFSK+
Sbjct: 555 DVDELAKDDQPVWKKMFSKH 574

>YDR343C Chr4 complement(1159608..1161320) [1713 bp, 570 aa] {ON}
           HXT6High-affinity glucose transporter of the major
           facilitator superfamily, nearly identical to Hxt7p,
           expressed at high basal levels relative to other HXTs,
           repression of expression by high glucose requires SNF3
          Length = 570

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/548 (70%), Positives = 466/548 (85%), Gaps = 2/548 (0%)

Query: 15  STAGSVHSSQSFQEMKKDSQDFNEIDSQ--IIEIPKKPASAYLSVCIMCLMVAFGGFISG 72
           S + SV S+ S +  + + + + E +    ++EIPK+PASAY++V IMC+M+AFGGF+ G
Sbjct: 21  SASHSVLSTPSNKAERDEIKAYGEGEEHEPVVEIPKRPASAYVTVSIMCIMIAFGGFVFG 80

Query: 73  WDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV 132
           WDTGTI GF++ +D+I RFG  H DG+ YLSKVRTGL+VSIFN+GCAIG ++L +LGD  
Sbjct: 81  WDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLIVSIFNIGCAIGGIILSKLGDMY 140

Query: 133 GRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHL 192
           GR+ G+++ V IYI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPMLISE+SPKHL
Sbjct: 141 GRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHL 200

Query: 193 RGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           RGTLVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWAL MIG M  VPESP
Sbjct: 201 RGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESP 260

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           RYL E G+IEEAKRS+A SNKV +DDP+ + E+E V   VEAE+ AG+ASW ELF +KTK
Sbjct: 261 RYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGVEAEKLAGNASWGELFSSKTK 320

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           VLQR +MG ++ +LQQLTG NYFFYYGT IFKAVGL DSF+TS++ GIVNFASTFV +YV
Sbjct: 321 VLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLGIVNFASTFVGIYV 380

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCF 432
           V++YGRRTCLLWGAA M  CMVV+ASVGVT+LWPNGQDQPSSKGAGN MIVF+CF+IFCF
Sbjct: 381 VERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCF 440

Query: 433 ATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLG 492
           ATTWAPIP+V++SE+FPLRVK+K M++ T +N +W F IGFFTPFITGAINFYYGYVF+G
Sbjct: 441 ATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFYYGYVFMG 500

Query: 493 CLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDK 552
           CLVF + YV   VPETKGL LE+VN MWEEGVLPWKSASWVPPS+RG +Y+AE +A DDK
Sbjct: 501 CLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRGANYDAEEMAHDDK 560

Query: 553 PIYKRMFS 560
           P+YKRMFS
Sbjct: 561 PLYKRMFS 568

>YDR342C Chr4 complement(1154216..1155928) [1713 bp, 570 aa] {ON}
           HXT7High-affinity glucose transporter of the major
           facilitator superfamily, nearly identical to Hxt6p,
           expressed at high basal levels relative to other HXTs,
           expression repressed by high glucose levels
          Length = 570

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/548 (70%), Positives = 465/548 (84%), Gaps = 2/548 (0%)

Query: 15  STAGSVHSSQSFQEMKKDSQDFNEIDSQ--IIEIPKKPASAYLSVCIMCLMVAFGGFISG 72
           S + SV S+ S +  + + + + E +    ++EIPK+PASAY++V IMC+M+AFGGF+ G
Sbjct: 21  SASHSVLSTPSNKAERDEIKAYGEGEEHEPVVEIPKRPASAYVTVSIMCIMIAFGGFVFG 80

Query: 73  WDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV 132
           WDTGTI GF++ +D+I RFG  H DG+ YLSKVRTGL+VSIFN+GCAIG ++L +LGD  
Sbjct: 81  WDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLIVSIFNIGCAIGGIILSKLGDMY 140

Query: 133 GRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHL 192
           GR+ G+++ V IYI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPMLISE+SPKHL
Sbjct: 141 GRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHL 200

Query: 193 RGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           RGTLVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWAL MIG M  VPESP
Sbjct: 201 RGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESP 260

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           RYL E G+IEEAKRS+A SNKV +DDP+ + E+E V   VEAE+ AG+ASW ELF +KTK
Sbjct: 261 RYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGVEAEKLAGNASWGELFSSKTK 320

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           VLQR +MG ++ +LQQLTG NYFFYYGT IFKAVGL DSF+TS++ GIVNFASTFV +YV
Sbjct: 321 VLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLGIVNFASTFVGIYV 380

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCF 432
           V++YGRRTCLLWGAA M  CMVV+ASVGVT+LWPNGQDQPSSKGAGN MIVF+CF+IFCF
Sbjct: 381 VERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCF 440

Query: 433 ATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLG 492
           ATTWAPIP+V++SE+FPLRVK+K M++ T +N +W F IGFFTPFITGAINFYYGYVF+G
Sbjct: 441 ATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFYYGYVFMG 500

Query: 493 CLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDK 552
           CLVF + YV   VPETKGL LE+VN MWEEGVLPWKSASWVPPS+RG +Y+AE +  DDK
Sbjct: 501 CLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRGANYDAEEMTHDDK 560

Query: 553 PIYKRMFS 560
           P+YKRMFS
Sbjct: 561 PLYKRMFS 568

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/544 (69%), Positives = 455/544 (83%), Gaps = 1/544 (0%)

Query: 19  SVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTI 78
           S  S++  +E K D Q  +E ++     P  P+     +CI+CLMVAFGG+ISGWD+GTI
Sbjct: 32  STPSNKELEEEKGDLQRPSEDETPASVSPLVPSGINWGICILCLMVAFGGYISGWDSGTI 91

Query: 79  GGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGI 138
           GGF +H+D++ RFGS+  +G +YLSKVRTGLL S+FNVG AIGS  LGRLGD  GRR G+
Sbjct: 92  GGFEAHTDFLARFGSTSGEGKRYLSKVRTGLLTSMFNVGQAIGSFFLGRLGDIYGRRIGL 151

Query: 139 VIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVS 198
           ++A  I+I+G VIQIAS+  WYQY IGRIIAGLG G IA+LSPMLISE+SPK++RG +VS
Sbjct: 152 IVASVIFIIGTVIQIASVKAWYQYMIGRIIAGLGCGLIAILSPMLISEVSPKNMRGAMVS 211

Query: 199 CYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEK 258
           CYQLMIT G+FLGYCTNYGTK Y NS QWR+PLGL FAW L MIGAM  VPESPR+L+EK
Sbjct: 212 CYQLMITLGIFLGYCTNYGTKKYHNSRQWRIPLGLQFAWCLFMIGAMLFVPESPRFLIEK 271

Query: 259 GQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTL 318
           G+IEEAKRS+AKSN V+ +DP TI E++ +Q AVE E+  G+ASW +L  T+ K+LQR +
Sbjct: 272 GRIEEAKRSIAKSNAVSAEDPVTIYELDEIQAAVEKERFVGTASWKDLLDTQHKILQRVV 331

Query: 319 MGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGR 378
           MG+++LALQQLTGCNYFFYYGT IFKAVGLED F+T+++FG+VNF STF AL++VD++GR
Sbjct: 332 MGIMILALQQLTGCNYFFYYGTTIFKAVGLEDGFETAIVFGVVNFFSTFCALFLVDRFGR 391

Query: 379 RTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSKGAGNTMIVFSCFFIFCFATTWA 437
           RTCLLWGAAGM CCMVVFASVGVT+LWP+G+     SKGAGN MIVFSCFFIFCFAT+WA
Sbjct: 392 RTCLLWGAAGMTCCMVVFASVGVTRLWPHGKKAGIVSKGAGNCMIVFSCFFIFCFATSWA 451

Query: 438 PIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFS 497
           PI FVIISESFPLRVKAKGMAL TVSNQMWNFCIGFFTPFI+G+INF YGYVF+GCLVF+
Sbjct: 452 PIAFVIISESFPLRVKAKGMALATVSNQMWNFCIGFFTPFISGSINFAYGYVFMGCLVFA 511

Query: 498 YCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKR 557
           + YVF FVPETKGL LE+V++MW+EGVLPWKSA WVPPSQR  DY+A+ LA DD+P++KR
Sbjct: 512 WFYVFFFVPETKGLVLEEVDVMWQEGVLPWKSAEWVPPSQRNADYDADVLANDDQPVWKR 571

Query: 558 MFSK 561
           +F K
Sbjct: 572 IFGK 575

>KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/550 (68%), Positives = 448/550 (81%), Gaps = 5/550 (0%)

Query: 15  STAGSVHSSQSFQEMKKDSQDFNEIDSQ----IIEIPKKPASAYLSVCIMCLMVAFGGFI 70
           S  GS HS  S    K +S +  E   Q    ++EIPK+PASAY++V ++CLM+AFGGFI
Sbjct: 20  SETGS-HSVMSNNSNKLESDNAREYPPQEQEPVVEIPKRPASAYITVSLICLMIAFGGFI 78

Query: 71  SGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGD 130
            GWDTGTI GF++ +D++ RFG  HSDG+ YLS+VRTGL+VSIFN+GCAIG +   +LGD
Sbjct: 79  FGWDTGTISGFVAQTDFLRRFGMQHSDGTYYLSRVRTGLMVSIFNIGCAIGGIAFSKLGD 138

Query: 131 TVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPK 190
             GRR  +VI   +YIVGIVI IASIDKWYQYFIGRIIAGLG G IAV SP+ ISEISPK
Sbjct: 139 QYGRRIALVIVTIVYIVGIVISIASIDKWYQYFIGRIIAGLGVGGIAVYSPLFISEISPK 198

Query: 191 HLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPE 250
           HLRGTLVSCYQLMIT G+FLGYCTNYGTK+Y NS+QWRVPLGL FAWAL MI AMF  PE
Sbjct: 199 HLRGTLVSCYQLMITLGIFLGYCTNYGTKSYSNSVQWRVPLGLGFAWALFMIAAMFFAPE 258

Query: 251 SPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTK 310
           SPRYL+E G++E+AK S+A+SNK++ +DPA   E+EL+   +EAE+ AG+ASW ELF  +
Sbjct: 259 SPRYLLEVGRVEDAKGSIARSNKISTEDPAVTSEVELITAGIEAERLAGTASWGELFSPR 318

Query: 311 TKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVAL 370
            KVLQR +MGV +  LQQLTG NYFFYYGT IFK+VGLEDSF+TS+I G+VNF STF  +
Sbjct: 319 GKVLQRLIMGVCIQTLQQLTGANYFFYYGTTIFKSVGLEDSFETSIIIGVVNFVSTFFGI 378

Query: 371 YVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIF 430
           Y V+++GRR CLLWGAA M+CCMVV+ASVGVT+L+PNG DQPSSKGAGN MIVF+CF+IF
Sbjct: 379 YFVERFGRRRCLLWGAATMMCCMVVYASVGVTRLYPNGMDQPSSKGAGNCMIVFTCFYIF 438

Query: 431 CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVF 490
           CFATTWAPI +VI+SE+FPLRVKAKGMA+   +N  WNF I FFTPFITGAINFYYGYVF
Sbjct: 439 CFATTWAPIAYVIVSETFPLRVKAKGMAISVGANWFWNFLISFFTPFITGAINFYYGYVF 498

Query: 491 LGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATD 550
           +GCL  ++ YVF FVPETKGL LE+VN MWEEGVLPWKSASW+PPS+R   Y+  A   D
Sbjct: 499 MGCLCVAWFYVFFFVPETKGLTLEEVNTMWEEGVLPWKSASWIPPSRRDAAYDEAAFTQD 558

Query: 551 DKPIYKRMFS 560
           +KPIYKR+FS
Sbjct: 559 EKPIYKRIFS 568

>Smik_4.606 Chr4 complement(1080999..1082711) [1713 bp, 570 aa] {ON}
           YFL011W (REAL)
          Length = 570

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/549 (70%), Positives = 461/549 (83%), Gaps = 2/549 (0%)

Query: 14  SSTAGSVHSSQSFQEMKKDSQDFNEIDSQ--IIEIPKKPASAYLSVCIMCLMVAFGGFIS 71
            S + SV S+ S +  + + +++ E ++Q  ++EIPK+PASAY++V IMC+M+AFGGF+ 
Sbjct: 20  DSASHSVLSTPSNKAERDELKEYGEDENQEPVVEIPKRPASAYVTVSIMCIMIAFGGFVF 79

Query: 72  GWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDT 131
           GWDTGTI GF++ SD+I RFG  H DG+ YLSKVRTGL+V+IFN+GCAIG ++L +LGD 
Sbjct: 80  GWDTGTISGFVNQSDFIRRFGMQHKDGTYYLSKVRTGLIVAIFNIGCAIGGIILAKLGDM 139

Query: 132 VGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKH 191
            GR+ G+++ V IYI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPMLISE+SPKH
Sbjct: 140 YGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKH 199

Query: 192 LRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPES 251
           LRGTLV+CYQLMIT G+FLGYCTNYGTKTY NS+QWRVPLGL FAWAL MIG M  VPES
Sbjct: 200 LRGTLVACYQLMITAGIFLGYCTNYGTKTYSNSVQWRVPLGLGFAWALFMIGGMTFVPES 259

Query: 252 PRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKT 311
           PRYL E G+IEEAKRS+A SNKV IDDP+ + E+E V   +EAE+ AG+ASW ELF TK 
Sbjct: 260 PRYLAEVGKIEEAKRSIAVSNKVAIDDPSVLAEVEAVLAGIEAEKLAGNASWGELFATKN 319

Query: 312 KVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALY 371
           K+ QR +MG ++ +LQQLTG NYFFYYGT IFKAVGL DSF+TS++ GIVNFASTFV +Y
Sbjct: 320 KIFQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLGIVNFASTFVGIY 379

Query: 372 VVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFC 431
           VVDKYGRRTCLLWGAA M  CMVV+ASVGVT+LWPNGQ QPSSKGAGN MI F+CF+IFC
Sbjct: 380 VVDKYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQSQPSSKGAGNCMICFACFYIFC 439

Query: 432 FATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFL 491
           FATTWAPIPFV+ SE+FPLRVK+K M++    N +W F IGFFTPFITGAINFYYGYVF+
Sbjct: 440 FATTWAPIPFVVNSETFPLRVKSKCMSIAQACNWIWGFLIGFFTPFITGAINFYYGYVFM 499

Query: 492 GCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDD 551
           GCLVF Y YV   VPETKGL LE+VN MWEEGVLPWKSASWVPPS+RG +Y+AE +  DD
Sbjct: 500 GCLVFMYFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRGANYDAEEMIHDD 559

Query: 552 KPIYKRMFS 560
           KP+YKRMFS
Sbjct: 560 KPLYKRMFS 568

>Smik_4.607 Chr4 complement(1085753..1087465) [1713 bp, 570 aa] {ON}
           YDR343C (REAL)
          Length = 570

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/548 (70%), Positives = 461/548 (84%), Gaps = 2/548 (0%)

Query: 14  SSTAGSVHSSQSFQEMKKDSQDF--NEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFIS 71
            S + SV S+ + +    + + +  NE    ++EIPK+PASAY++V IMC+M+AFGGF+ 
Sbjct: 20  DSASNSVLSTPTNKADNDELKAYGENEEHEPVVEIPKRPASAYVTVSIMCIMIAFGGFVF 79

Query: 72  GWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDT 131
           GWDTGTI GF++ +D+I RFG  H DG+ YLSKVRTGL+V+IFN+GCAIG ++L +LGD 
Sbjct: 80  GWDTGTISGFVNQTDFIRRFGMKHHDGTFYLSKVRTGLIVAIFNIGCAIGGIILSKLGDM 139

Query: 132 VGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKH 191
            GR+ G+++ V IYI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPMLISE+SPKH
Sbjct: 140 YGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKH 199

Query: 192 LRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPES 251
           LRGTLV+CYQLMIT G+FLGYCTNYGTKTY NS+QWRVPLGL FAWAL MIG M  VPES
Sbjct: 200 LRGTLVACYQLMITAGIFLGYCTNYGTKTYSNSVQWRVPLGLGFAWALFMIGGMTFVPES 259

Query: 252 PRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKT 311
           PRYL E G+IEEAKRS+A SNKV IDDP+ + E+E V   VEAE+ AG+ASW ELF TKT
Sbjct: 260 PRYLAEVGKIEEAKRSIAVSNKVAIDDPSVLAEVEAVLAGVEAEKLAGTASWGELFSTKT 319

Query: 312 KVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALY 371
           KVLQR +MG ++ +LQQLTG NYFFYYGT IFKAVGL DSF+TS++ GIVNFASTFV +Y
Sbjct: 320 KVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLGIVNFASTFVGIY 379

Query: 372 VVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFC 431
           VVDKYGRRTCLLWGAA M  CMVV+ASVGVT+LWPNGQ QPSSKGAGN MI F+CF+IFC
Sbjct: 380 VVDKYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQSQPSSKGAGNCMICFACFYIFC 439

Query: 432 FATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFL 491
           FATTWAPIP+V++SE+FPLRVK+K M++ T +N +W F IGFFTPFITGAINFYYGYVF+
Sbjct: 440 FATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFYYGYVFM 499

Query: 492 GCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDD 551
           GCLVF + YV   VPETKGL LE+VN MWEEGVLPWKSASWVPPS+RG +Y+AE +  DD
Sbjct: 500 GCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRGANYDAEEMIHDD 559

Query: 552 KPIYKRMF 559
           KP+YKR+F
Sbjct: 560 KPLYKRIF 567

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/548 (70%), Positives = 461/548 (84%), Gaps = 5/548 (0%)

Query: 19  SVHSSQSFQEMKKDSQDFNEIDSQI----IEIPKKPASAYLSVCIMCLMVAFGGFISGWD 74
            VHS  S ++ ++  QD++E DS++    I+IPKKPASAYLSVCIMC+MVAFGG+ISGWD
Sbjct: 22  DVHSISSGKDAEELKQDYSEEDSEVPEPAIDIPKKPASAYLSVCIMCVMVAFGGYISGWD 81

Query: 75  TGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGR 134
           +GTIGGF SH+D++ RFGS+   G +YLSKVRTGLL S+FN+G AIG   LGRLGD  GR
Sbjct: 82  SGTIGGFESHTDFLARFGSTSGSGKRYLSKVRTGLLTSMFNIGQAIGCFFLGRLGDMYGR 141

Query: 135 RKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRG 194
           R  I++A  I+IVG VIQIAS+  WYQY IGRI+AGLG G IA+ SPMLISE+SPKHLRG
Sbjct: 142 RIAIIVASIIFIVGTVIQIASVKAWYQYMIGRIVAGLGCGIIAISSPMLISEVSPKHLRG 201

Query: 195 TLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRY 254
            +VSCYQLMIT G+FLGYC NYGTK YD+S QWRVPLGL FAW L ++GAM  VPESPR+
Sbjct: 202 AMVSCYQLMITMGIFLGYCANYGTKRYDDSTQWRVPLGLQFAWCLFLVGAMLFVPESPRF 261

Query: 255 LVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVL 314
           L+EKG+ E+AKRS+AKSNKV+ DDPA I E + +Q A++ E+A G A+W +L  T+ K+L
Sbjct: 262 LIEKGRYEDAKRSIAKSNKVSPDDPAVIMEADEIQAAIDKERAEGEATWGDLLDTQHKIL 321

Query: 315 QRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVD 374
            R + G+++LALQQLTG NYFFYYGT+IFKAVGLED ++T+++FG+VNF STFVALY+VD
Sbjct: 322 PRVINGIMLLALQQLTGANYFFYYGTLIFKAVGLEDGYETAIVFGVVNFFSTFVALYLVD 381

Query: 375 KYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSKGAGNTMIVFSCFFIFCFA 433
           ++GRRTCLLWGAAGM CCMVVFASVGV +LWP G++   +S+GAGN MI FSCFFIFCFA
Sbjct: 382 RFGRRTCLLWGAAGMTCCMVVFASVGVARLWPKGKNGGVTSQGAGNCMICFSCFFIFCFA 441

Query: 434 TTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGC 493
            +WAP+PFVIISESFPL+VKAKGMAL TVSNQMWNFCIGFFTPFITGAINFYYGYVFLGC
Sbjct: 442 VSWAPVPFVIISESFPLKVKAKGMALATVSNQMWNFCIGFFTPFITGAINFYYGYVFLGC 501

Query: 494 LVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKP 553
           LVF++ YVF FVPETKGL LEDVN+MWEEGVLPWKSA+WVPPS+R  DY+  A+A DD P
Sbjct: 502 LVFAWFYVFFFVPETKGLVLEDVNVMWEEGVLPWKSAAWVPPSERSADYDVAAMANDDTP 561

Query: 554 IYKRMFSK 561
            +K+MF K
Sbjct: 562 AWKKMFGK 569

>Suva_2.512 Chr2 complement(911804..913516) [1713 bp, 570 aa] {ON}
           YHR094C (REAL)
          Length = 570

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/551 (70%), Positives = 461/551 (83%), Gaps = 2/551 (0%)

Query: 14  SSTAGSVHSSQSFQEMKKDSQDFNEIDSQ--IIEIPKKPASAYLSVCIMCLMVAFGGFIS 71
            S + S+ S+ + +  + + + + E + Q   IEIPK+PASAY++V IMC+M+AFGGF+ 
Sbjct: 20  DSASNSMLSTPTNKAERDELKAYGEDEGQEPAIEIPKRPASAYVTVSIMCIMIAFGGFVF 79

Query: 72  GWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDT 131
           GWDTGTI GF++ +D+I RFG  H DGS YLSKVRTGL+VSIFN+GCA G ++L +LGD 
Sbjct: 80  GWDTGTISGFVNQTDFIRRFGMKHKDGSYYLSKVRTGLIVSIFNIGCAFGGIILSKLGDM 139

Query: 132 VGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKH 191
            GRR G++I V IYI+GI+IQIASIDKWYQYFIGRII+GLG G IAVLSPMLISE+SPKH
Sbjct: 140 YGRRLGLIIVVVIYIIGIIIQIASIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKH 199

Query: 192 LRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPES 251
           LRGTLV+CYQLMIT G+FLGYCTNYGTKTY NS+QWRVPLGL FAWAL MIG M  VPES
Sbjct: 200 LRGTLVACYQLMITAGIFLGYCTNYGTKTYSNSVQWRVPLGLGFAWALFMIGGMTFVPES 259

Query: 252 PRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKT 311
           PRYL E G++EEAKRS+A SNKV +DDP+ + E+E V   +EAE+ AGSASW ELFQTK 
Sbjct: 260 PRYLAEVGKVEEAKRSIAISNKVAVDDPSVLAEVEGVLAGIEAEKLAGSASWGELFQTKN 319

Query: 312 KVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALY 371
           K+LQR +MG ++ +LQQLTG NYFFYYGT IFKAVG+ DSF+TS++ GIVNFASTFV +Y
Sbjct: 320 KILQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGMSDSFETSIVLGIVNFASTFVGIY 379

Query: 372 VVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFC 431
           VV++YGRRTCLLWGAA M  CMVVFASVGVT+LWPNG+DQPSSKGAGN MIVF+CF+IFC
Sbjct: 380 VVERYGRRTCLLWGAASMTACMVVFASVGVTRLWPNGKDQPSSKGAGNCMIVFACFYIFC 439

Query: 432 FATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFL 491
           FATTWAPIPFV+ SE+FPLRVK+K M++    N +W F IGFFTPFITGAI+FYYGYVF+
Sbjct: 440 FATTWAPIPFVVNSETFPLRVKSKCMSVAQACNWLWGFLIGFFTPFITGAIDFYYGYVFM 499

Query: 492 GCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDD 551
           GCL F + YV   VPETKGL LE+VN MWEEGVLPWKSASWVPPS+R  DY+A+A+  DD
Sbjct: 500 GCLAFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRNADYDADAMMHDD 559

Query: 552 KPIYKRMFSKN 562
           KP+YKRMFS+ 
Sbjct: 560 KPMYKRMFSRK 570

>NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/558 (67%), Positives = 456/558 (81%), Gaps = 2/558 (0%)

Query: 5   QSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFN-EIDSQIIEIPKKPASAYLSVCIMCLM 63
           ++P     HS  +   + ++   E K  S D + E++ +++EIPK+PASAY++V IMC+M
Sbjct: 13  ETPIESATHSVISTPSNKAERDDE-KYGSDDIDAEVNPEVVEIPKRPASAYVTVSIMCIM 71

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           +AFGGF+ GWDTGTI GF++ +D++ RFG  H +G+ YLSKVR GL+VSIFN+GCA G +
Sbjct: 72  IAFGGFVFGWDTGTISGFVAQTDFLRRFGQKHHNGTHYLSKVRMGLMVSIFNIGCAFGGI 131

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
           +L + GD  GR+ G++I V IYIVGIVIQIAS+  WYQYFIGRII+GLG G IAVLSPML
Sbjct: 132 ILAKSGDIYGRKMGLIIVVCIYIVGIVIQIASVKAWYQYFIGRIISGLGVGGIAVLSPML 191

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE+SPKH+RGTLVSCYQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWAL MIG
Sbjct: 192 ISEVSPKHMRGTLVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIG 251

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            M  VPESPRYLVE G+IEEAKRS+A SNK++ DDPA + E++ VQ  VEAE+ AG+ASW
Sbjct: 252 GMTFVPESPRYLVEVGKIEEAKRSIALSNKISADDPAVLAEVDNVQAGVEAEKLAGNASW 311

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            ELFQTK K+ QR +MG ++  LQQLTG NYFFYYGTI+FK+VGLEDSFQTS++ G+VNF
Sbjct: 312 GELFQTKNKIFQRLVMGCMIQCLQQLTGDNYFFYYGTIVFKSVGLEDSFQTSIVIGVVNF 371

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
            STF ALY VD++GRR CLLWGAA    C V++ASVGVT+L+PNG+DQPSSKGAGN MIV
Sbjct: 372 FSTFFALYTVDRFGRRRCLLWGAATTTVCFVIYASVGVTRLYPNGKDQPSSKGAGNCMIV 431

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           F+CF+IFCFATTWAPIPFVI SE+FPLRVK+K M+L    N +W F I FFTPFITGAIN
Sbjct: 432 FTCFYIFCFATTWAPIPFVINSETFPLRVKSKCMSLAQGCNWLWGFLISFFTPFITGAIN 491

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYN 543
           FYYGYVF+GCL FS+ YVF FVPETKGL LE+VN MWEEGVLPWKS  WVPPS+RG DYN
Sbjct: 492 FYYGYVFMGCLCFSFFYVFFFVPETKGLTLEEVNTMWEEGVLPWKSTEWVPPSRRGADYN 551

Query: 544 AEALATDDKPIYKRMFSK 561
            + L  D+KP+YKRMF +
Sbjct: 552 VDGLTKDEKPLYKRMFGR 569

>CAGL0A02211g Chr1 complement(229556..231214) [1659 bp, 552 aa] {ON}
           highly similar to uniprot|P39003 Saccharomyces
           cerevisiae YDR343c HXT6 or uniprot|P39004 Saccharomyces
           cerevisiae YDR342c HXT7
          Length = 552

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/548 (70%), Positives = 458/548 (83%), Gaps = 1/548 (0%)

Query: 11  DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQ-IIEIPKKPASAYLSVCIMCLMVAFGGF 69
           D  S +   + +S S  + + + + + + + Q ++EIPKKPASAY+S+ I CL +AFGGF
Sbjct: 3   DQESRSQSVLSASNSKADREDEFKAYVDEEGQPMVEIPKKPASAYVSISIFCLFIAFGGF 62

Query: 70  ISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
           + GWDTGTI GF++ +D+I R G + ++G+ YLSKVRTGL+VSIFN+GCAIG +VL +LG
Sbjct: 63  VFGWDTGTISGFVAQTDFIRRLGQTRANGTHYLSKVRTGLVVSIFNIGCAIGGIVLSKLG 122

Query: 130 DTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISP 189
           D  GR+ G++  V IYIVGIVIQIA+IDKWYQYFIGRII+GLG G IAVLSPMLISE+SP
Sbjct: 123 DMYGRKIGLISVVVIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSP 182

Query: 190 KHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVP 249
           KH+RG+LVSCYQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWAL MIG M  VP
Sbjct: 183 KHMRGSLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVP 242

Query: 250 ESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQT 309
           ESPRYL+E G++EEA+RS+A SNKV+ DDPA   E+E VQ AVEAE+ AGSASW ELF T
Sbjct: 243 ESPRYLIEVGRVEEARRSIAISNKVSPDDPAVTFEVENVQAAVEAERLAGSASWGELFST 302

Query: 310 KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVA 369
           KTKV QR +MG+++ +LQQLTG NYFFYYGT +FKAVGLEDSF+TS++ GIVNFASTFVA
Sbjct: 303 KTKVFQRLIMGIMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFETSIVIGIVNFASTFVA 362

Query: 370 LYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFI 429
           LYVVD++GRR CLLWGAA M  CMVVFASVGVT+LWPNGQDQPSSKGAGN MIVF+CF+I
Sbjct: 363 LYVVDRFGRRRCLLWGAAAMTACMVVFASVGVTRLWPNGQDQPSSKGAGNCMIVFTCFYI 422

Query: 430 FCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYV 489
           FCFATTWAPIPFV+ SE+FPLRVKAK MA+   SN +W F I FFTPFIT AINFYYGYV
Sbjct: 423 FCFATTWAPIPFVVNSETFPLRVKAKCMAIAQASNWIWGFLIAFFTPFITNAINFYYGYV 482

Query: 490 FLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALAT 549
           F+GCL FSY YVF F+PETKGL LE+VN +WEEGVLPWKS +WVPPS+R   Y+A+A+  
Sbjct: 483 FMGCLCFSYFYVFFFIPETKGLTLEEVNTLWEEGVLPWKSPNWVPPSKRDASYDADAMMH 542

Query: 550 DDKPIYKR 557
           DDKP YKR
Sbjct: 543 DDKPWYKR 550

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/555 (70%), Positives = 466/555 (83%), Gaps = 6/555 (1%)

Query: 13  HSSTAGSVHSSQSFQEMKKDSQ-----DFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFG 67
            +ST   V    S+ E +   +     D + I + +IEIPKKPASAY+SVCIMC+MVAFG
Sbjct: 10  RASTITPVELQDSYSEKEDHDEKEYYTDNDCIQTPVIEIPKKPASAYISVCIMCVMVAFG 69

Query: 68  GFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGR 127
           GFI GWDTGTIGGF SH+D++ RFGS++ +G  YLSKVRTGLL S+FNVGC+IGS  LGR
Sbjct: 70  GFILGWDTGTIGGFESHTDFLRRFGSTNKNGEHYLSKVRTGLLTSMFNVGCSIGSFFLGR 129

Query: 128 LGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEI 187
           LGD  GRR G++IA  I+IVG +IQ+AS+  WYQY IGRI+AG+G G IA+LSPMLISE+
Sbjct: 130 LGDMYGRRIGLIIATTIFIVGTIIQVASVKAWYQYMIGRIVAGVGCGVIAMLSPMLISEV 189

Query: 188 SPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFI 247
           SPKHLRG +VSCYQLM+T G+FLGYC NYGTK Y NS+QWRVP GL FAWAL MI AM  
Sbjct: 190 SPKHLRGAMVSCYQLMVTMGIFLGYCANYGTKRYSNSVQWRVPEGLQFAWALFMISAMLF 249

Query: 248 VPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELF 307
           VPESPRYLVEK +IEEAKRS+AKSNKV+ DDPA ++E++ ++IAV+ E+A G A WSE+ 
Sbjct: 250 VPESPRYLVEKNKIEEAKRSIAKSNKVSPDDPAVVREVDEIKIAVDRERAEGEAGWSEML 309

Query: 308 QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTF 367
            TKTKV QR + G+++LALQQLTGCNYFF+YGT+IFKAVGLED ++T+++FG+VNF STF
Sbjct: 310 DTKTKVFQRVVNGIMLLALQQLTGCNYFFFYGTLIFKAVGLEDGYETAIVFGVVNFFSTF 369

Query: 368 VALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSKGAGNTMIVFSC 426
           +ALYVVDK+GRR CLLWGAAGM CCMVVFASVGVT+LWP G++   +S+GAGN MI FSC
Sbjct: 370 IALYVVDKFGRRACLLWGAAGMTCCMVVFASVGVTRLWPKGKNAGITSQGAGNCMICFSC 429

Query: 427 FFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYY 486
           FFIFCFATTWAP+PFVIISESFPL+VKAKGMAL TVSNQMWNFCIGFFTPFI GAI+FYY
Sbjct: 430 FFIFCFATTWAPVPFVIISESFPLKVKAKGMALATVSNQMWNFCIGFFTPFIAGAIDFYY 489

Query: 487 GYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEA 546
           GYVF+GCLVFSY YVF FVPETKG+ LED+N+MWEEG LPWKSA+WVPPS+RG DY+ +A
Sbjct: 490 GYVFMGCLVFSYFYVFFFVPETKGMVLEDINVMWEEGTLPWKSANWVPPSERGADYDVDA 549

Query: 547 LATDDKPIYKRMFSK 561
           +A DD P +K++  K
Sbjct: 550 MANDDTPAWKKLIGK 564

>KNAG0B06940 Chr2 (1377486..1379168) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/559 (67%), Positives = 461/559 (82%), Gaps = 1/559 (0%)

Query: 3   YSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQII-EIPKKPASAYLSVCIMC 61
           Y     G   + + + S+ S  S++E  +  +D    + + I EIPKKPASAY++V ++C
Sbjct: 2   YHYESEGVPPNVTNSNSLGSDPSYKEDNEFLKDNGSENPEFIKEIPKKPASAYVTVSLLC 61

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           LMVAFGG+I GWDTGTI GF+  +D+I RFG   SDG+ YLSKVRTGL+V IF++GCAIG
Sbjct: 62  LMVAFGGYIFGWDTGTISGFIQQTDFIRRFGQQRSDGTYYLSKVRTGLIVGIFSIGCAIG 121

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
            +   ++GD VGRR  +V    +Y+VG+VI IASI+KWYQYFIGRII+GLG G IAV SP
Sbjct: 122 GIAFSKIGDQVGRRLALVFVTAVYMVGLVISIASINKWYQYFIGRIISGLGVGGIAVYSP 181

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           +LISE+SPKH+RGTLVSCYQLMIT G+FLGYCTNYGTK YDNS+QWRVPLGL FAWAL M
Sbjct: 182 LLISEVSPKHVRGTLVSCYQLMITLGIFLGYCTNYGTKNYDNSVQWRVPLGLGFAWALFM 241

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
           I AMF VPESPRYL+EKG++E+AKRSV++SNKV++DDPA + E+EL+   +E E+AAGSA
Sbjct: 242 IAAMFFVPESPRYLIEKGRMEDAKRSVSQSNKVSVDDPAVVSEVELLHAGIELERAAGSA 301

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           +W ELF TK KVLQR +MGVI+ +LQQLTG NYFFYYGT IFK+VGLEDSFQTS+I G+V
Sbjct: 302 TWDELFSTKGKVLQRLIMGVIIQSLQQLTGANYFFYYGTTIFKSVGLEDSFQTSIIIGVV 361

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           NFASTF  +Y V+++GRR CLLWGAA MV C VV+ASVGVT+L+PNG DQPSSKGAGN M
Sbjct: 362 NFASTFFGIYFVERFGRRRCLLWGAATMVACFVVYASVGVTRLYPNGMDQPSSKGAGNCM 421

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           IVF+CFFIFCFATTWAPI +VI++E+FPLR+KAKGM++   +N +WNF +GFFTPFITGA
Sbjct: 422 IVFTCFFIFCFATTWAPIAYVIVAETFPLRIKAKGMSISVAANWIWNFLLGFFTPFITGA 481

Query: 482 INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTD 541
           INFYYGYVF+GCLVF++ YVF FVPETKGL LE+VN MWEE VLPWKS SWVPPS+RG D
Sbjct: 482 INFYYGYVFMGCLVFAFFYVFFFVPETKGLTLEEVNTMWEENVLPWKSPSWVPPSRRGAD 541

Query: 542 YNAEALATDDKPIYKRMFS 560
           Y+  A+++D +P YK+M S
Sbjct: 542 YDVAAMSSDTRPWYKKMSS 560

>NDAI0C01750 Chr3 (382042..383772) [1731 bp, 576 aa] {ON} 
          Length = 576

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/559 (67%), Positives = 458/559 (81%), Gaps = 8/559 (1%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           S +P+G    S+ A         +E  +D ++F      + EIPKKPASAY++V IMC+M
Sbjct: 26  SATPSGLSTPSNKA----DRDDGKEYGEDGEEFE----AVAEIPKKPASAYITVSIMCIM 77

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           +AFGGF+ GWDTGTI GF++ +D++ RFG  H DGS YLSKVR GL+VSIFN+GCAIG +
Sbjct: 78  IAFGGFVFGWDTGTISGFVAQTDFLRRFGQKHHDGSHYLSKVRMGLVVSIFNIGCAIGGI 137

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
           +L + GD  GR+ G++I V IY+VGI+IQIAS+  WYQYFIGRII+G+G G IAVLSPML
Sbjct: 138 ILSKAGDMYGRKMGLIIVVVIYVVGIIIQIASVKAWYQYFIGRIISGMGVGGIAVLSPML 197

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE+SPKHLRGTLVSCYQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWA+ MIG
Sbjct: 198 ISEVSPKHLRGTLVSCYQLMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMIG 257

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            M  VPESPRYL+EKG +EEAKRS+A SNKV +DDPA + E+E +Q  VEAE+ AG+ASW
Sbjct: 258 GMTKVPESPRYLIEKGLVEEAKRSIALSNKVGVDDPAVMTEVENLQSGVEAERLAGNASW 317

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            ELF T TK+ QR +MG ++ +LQQLTG NYFFYYGT +FKAVG+EDSF+TS++ GIVNF
Sbjct: 318 GELFSTNTKIFQRLIMGCMLQSLQQLTGDNYFFYYGTTVFKAVGMEDSFETSIVLGIVNF 377

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
           ASTFV +++V++YGRRTCLLWGAA M  CMVVFASVGVT+LWPNG+D  SSKGAGN MI 
Sbjct: 378 ASTFVGIFLVERYGRRTCLLWGAATMTACMVVFASVGVTRLWPNGKDNGSSKGAGNCMIC 437

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           F+CF++FCFATTWAPIPFV+ SE+FPLRVK+K M++    N +W F IGFFTPFI+GAI+
Sbjct: 438 FTCFYLFCFATTWAPIPFVVNSETFPLRVKSKCMSVAQACNWLWGFLIGFFTPFISGAID 497

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYN 543
           FYYGYVF+GCL FSY YVF F+PETKGL LE+VN MWEEGVLPWKSA WVPPS+RG +YN
Sbjct: 498 FYYGYVFMGCLCFSYFYVFLFIPETKGLSLEEVNTMWEEGVLPWKSAEWVPPSRRGAEYN 557

Query: 544 AEALATDDKPIYKRMFSKN 562
           AE +A DDKP++KRMF + 
Sbjct: 558 AEDMAKDDKPLFKRMFGRK 576

>NDAI0G06310 Chr7 (1563437..1565134) [1698 bp, 565 aa] {ON} Anc_8.22
           YFL040W
          Length = 565

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/536 (68%), Positives = 440/536 (82%), Gaps = 3/536 (0%)

Query: 30  KKDSQDFNEIDSQ---IIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSD 86
           K D  D NE ++     IEIPKKPASAY+++ I C M+ FGGFI GWDTGTIGGFL+H D
Sbjct: 30  KNDKDDLNEFETHQEPAIEIPKKPASAYITISIFCTMIGFGGFICGWDTGTIGGFLAHPD 89

Query: 87  YINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYI 146
           Y+ RFGS H DG+ Y S VRTGL+VSIFN+G  IG + LG L + +GR+  +V  V I++
Sbjct: 90  YLRRFGSKHHDGTYYFSNVRTGLVVSIFNIGGLIGCLTLGDLANRIGRKMALVAVVIIFM 149

Query: 147 VGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITF 206
           VG+VIQIASIDKWYQYFIGRII+G+G G I++ SPML+SE++PKHLRGTL S YQLM+TF
Sbjct: 150 VGLVIQIASIDKWYQYFIGRIISGMGVGAISIFSPMLLSEVAPKHLRGTLGSMYQLMVTF 209

Query: 207 GMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKR 266
           G+FLG CTNYGTK YDNS+QWRVPLGL FAW L MI AMF VPESPRYL+E G+IEEAK+
Sbjct: 210 GIFLGDCTNYGTKAYDNSVQWRVPLGLSFAWCLFMIAAMFFVPESPRYLIEVGKIEEAKQ 269

Query: 267 SVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLAL 326
           S+A SNKV+IDDPA   E +L+Q  +EAE+AAG+ASW ELF TK KV+QR  M  ++ +L
Sbjct: 270 SIATSNKVSIDDPAVQGEADLIQAGIEAERAAGNASWGELFSTKGKVVQRLFMCCMLQSL 329

Query: 327 QQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGA 386
           QQLTGCNYFFYYGTI+F+AVGL DS++TS++FGIVNFASTFVA YVVD++GRR CL+WGA
Sbjct: 330 QQLTGCNYFFYYGTIVFQAVGLSDSYETSIVFGIVNFASTFVAFYVVDRFGRRRCLMWGA 389

Query: 387 AGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISE 446
           A MV C VV+ASVGVT+L P+G D P+SKGAGN MIVFSCFFIFCFA TWAPI +V++SE
Sbjct: 390 AAMVACYVVYASVGVTRLHPHGNDGPTSKGAGNCMIVFSCFFIFCFACTWAPICWVVVSE 449

Query: 447 SFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVP 506
           +FPL++K KGMA+    N  WNF I FFTPFITGAINFYYGYVF+GC+VF+YCYVF FVP
Sbjct: 450 TFPLKIKPKGMAIANGFNWFWNFLISFFTPFITGAINFYYGYVFMGCMVFAYCYVFFFVP 509

Query: 507 ETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMFSKN 562
           ETKGL LE+VN MWEEG+LPWKS  W+P S+R    + +AL  DDKP+YKRMFSKN
Sbjct: 510 ETKGLTLEEVNEMWEEGILPWKSPEWLPASKRDASVDMDALQHDDKPMYKRMFSKN 565

>TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {ON}
           Anc_5.395 YHR094C
          Length = 574

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/570 (67%), Positives = 465/570 (81%), Gaps = 10/570 (1%)

Query: 2   DYSQSPTGEDVHSSTAGSVHS--------SQSFQEMKKDSQDFNEIDSQI-IEIPKKPAS 52
           D +      D+ +   G++ S        S    +MKK+  D   +  +  I+IPKKPAS
Sbjct: 5   DKTHPVEQTDIATEIEGAIESQSMVSGSYSNRDDDMKKEFSDTGSLTPEAAIDIPKKPAS 64

Query: 53  AYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVS 112
           AYLSVCIMC+MVAFGG+ISGWD+GTIGGF SH+D++ RFGS+   G++YLSKVRTGLL S
Sbjct: 65  AYLSVCIMCVMVAFGGYISGWDSGTIGGFESHTDFLARFGSTSGSGTRYLSKVRTGLLTS 124

Query: 113 IFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLG 172
           +FN+G AIG   LGRLGD  GRR  I+IA  I++VG +IQIAS+  WYQY IGRI+AGLG
Sbjct: 125 MFNIGQAIGCFFLGRLGDMYGRRMAIIIASIIFVVGTIIQIASVKAWYQYMIGRIVAGLG 184

Query: 173 SGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLG 232
            G IA+ SPMLISE+SPKHLRG +VSCYQLMIT G+FLGYC NYGTK YD+S QWRVPLG
Sbjct: 185 CGIIAISSPMLISEVSPKHLRGAMVSCYQLMITMGIFLGYCANYGTKKYDDSRQWRVPLG 244

Query: 233 LCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAV 292
           L FAW L ++GAM  VPESPR+L+EKG+ E+ KRS+AKSNKV+ DDPA I E + +Q AV
Sbjct: 245 LQFAWCLFLVGAMLFVPESPRFLIEKGRYEDGKRSIAKSNKVSPDDPAVILEADEIQAAV 304

Query: 293 EAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSF 352
           + E+A G+A+W ++  TK K+L R + G+++LALQQLTG NYFFYYGT+IFKAVGLED +
Sbjct: 305 DKERAEGTATWGDMLDTKHKILPRVINGIMLLALQQLTGANYFFYYGTLIFKAVGLEDGY 364

Query: 353 QTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP 412
           +TS++FG+VNF STFVALY+VD++GRRTCLLWGAAGM CCMVVFASVGVT+LWP G++  
Sbjct: 365 ETSIVFGVVNFFSTFVALYLVDRFGRRTCLLWGAAGMTCCMVVFASVGVTRLWPKGKNGG 424

Query: 413 -SSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCI 471
            +S+GAGN MI FSCFFIFCFAT+WAP+PFVIISESFPL+VKAKGMAL TVSNQMWNF I
Sbjct: 425 VTSQGAGNCMICFSCFFIFCFATSWAPVPFVIISESFPLKVKAKGMALATVSNQMWNFAI 484

Query: 472 GFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSAS 531
           GFFT FITGAINFYYGYVFLGCLVF++ YVF FVPETKG+ LEDVN+MWEEGVLPWKSAS
Sbjct: 485 GFFTVFITGAINFYYGYVFLGCLVFAWFYVFFFVPETKGMVLEDVNVMWEEGVLPWKSAS 544

Query: 532 WVPPSQRGTDYNAEALATDDKPIYKRMFSK 561
           WVPPS+RG DY+  A+A DD+P +K+MF K
Sbjct: 545 WVPPSERGADYDVAAMANDDQPAWKKMFGK 574

>TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/553 (65%), Positives = 448/553 (81%), Gaps = 3/553 (0%)

Query: 11  DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFI 70
           D  SS +    S +  Q+   D+   +E     I+IPKKP S Y++VC+ C+M+AFGGF+
Sbjct: 21  DTESSDSQKEDSLK--QKFSADNFSGDEKSPHAIDIPKKPPSDYITVCLNCIMIAFGGFM 78

Query: 71  SGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGD 130
            GWD GTIGGF++  D+  RFGS++  G  YLSK RTGLLVSIFN+GCAIGSV LG +GD
Sbjct: 79  MGWDIGTIGGFIAQPDFKRRFGSTNKYGEHYLSKARTGLLVSIFNIGCAIGSVTLGNIGD 138

Query: 131 TVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPK 190
             GRR G++IA  I++ G+VI+IASIDKWYQYFIGRII+G+G G + +LSPMLISE+SPK
Sbjct: 139 IYGRRLGLIIATIIFVAGVVIEIASIDKWYQYFIGRIISGVGMGVVVILSPMLISEVSPK 198

Query: 191 HLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPE 250
            LRG +VS +QLMIT GMFLG CT YGTK Y NS QWRV LGL FAW+L M+G M  VPE
Sbjct: 199 ELRGAMVSSFQLMITLGMFLGDCTEYGTKKYSNSTQWRVGLGLQFAWSLCMVGGMLFVPE 258

Query: 251 SPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTK 310
           SPR+LVEKG+IEEAKRSVA SNK+   DPA I E+E +Q+AVE  +A G A WSE+F ++
Sbjct: 259 SPRFLVEKGKIEEAKRSVAISNKLNATDPAVIAEVEEIQVAVEQRRAEGEAGWSEVFDSR 318

Query: 311 TKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVAL 370
           TKVLQR ++G++++ALQQL+G NYFFYYGT +FK+VGLED F+ ++IFG++NF STFV+L
Sbjct: 319 TKVLQRVIIGIMIMALQQLSGANYFFYYGTTVFKSVGLEDGFEAAIIFGVINFFSTFVSL 378

Query: 371 YVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSKGAGNTMIVFSCFFI 429
           Y++D++GRRTCLLWGAAGM+CCMV+FASVGVT+LWP G+    SSKGAG+ MIVFSCFFI
Sbjct: 379 YLIDRFGRRTCLLWGAAGMICCMVIFASVGVTRLWPKGKSAGISSKGAGDCMIVFSCFFI 438

Query: 430 FCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYV 489
            CF  +WAP+PFVIISESFP+++K+KGMAL  VSNQ+W FCIGFFTPFITG+INFYYGYV
Sbjct: 439 LCFGASWAPVPFVIISESFPVKIKSKGMALAIVSNQIWTFCIGFFTPFITGSINFYYGYV 498

Query: 490 FLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALAT 549
           FLGCLVF++ YVF FVPETKGL LE+VN+MWEEG LPWKSA+WVPPSQR  DY+  A+A 
Sbjct: 499 FLGCLVFAWFYVFFFVPETKGLHLEEVNIMWEEGTLPWKSANWVPPSQRNADYDVNAMAN 558

Query: 550 DDKPIYKRMFSKN 562
           DD P +K++F K 
Sbjct: 559 DDSPAWKKIFGKQ 571

>KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/549 (67%), Positives = 454/549 (82%), Gaps = 1/549 (0%)

Query: 14  SSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGW 73
           S++  S  S+++ ++  KD  +   +D+QI EIPKKP SAY++V IMC+M+AFGGF+ GW
Sbjct: 17  SNSFASTTSNKADRDDLKDEYNDENVDNQI-EIPKKPGSAYVTVSIMCIMIAFGGFVFGW 75

Query: 74  DTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVG 133
           DTGTI GF++ +D+I R G   +DG+ YLSKVRTGL+VSIFN+GCAIG ++L + GD  G
Sbjct: 76  DTGTISGFVAQTDFIRRLGQRRADGTHYLSKVRTGLVVSIFNIGCAIGGIILSKAGDMYG 135

Query: 134 RRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLR 193
           R+KG++I + IYI GIVIQIA+I+KWYQYFIGRII+GLG G I+VLSPMLISE+SPKHLR
Sbjct: 136 RKKGLLIVLVIYIAGIVIQIATINKWYQYFIGRIISGLGVGGISVLSPMLISEVSPKHLR 195

Query: 194 GTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPR 253
           GTLVSC+QLMIT G+FLGYCTNYGTK Y NS QWRVPLGLCFAWAL MIG M  VPESPR
Sbjct: 196 GTLVSCFQLMITLGIFLGYCTNYGTKKYSNSTQWRVPLGLCFAWALFMIGGMTFVPESPR 255

Query: 254 YLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKV 313
           YL+EK  +EEAK S++ SNKV++DDPA   EI+ +   VEAE+ AG+ASW ELF TK K+
Sbjct: 256 YLLEKNLVEEAKHSISISNKVSVDDPAVQAEIDTLMAGVEAERLAGTASWGELFSTKNKI 315

Query: 314 LQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVV 373
            QR LMG ++ +LQQLTG NYFFYYGTI+FKAVGLEDSFQTS++ G+VNFASTFV +Y+V
Sbjct: 316 FQRLLMGCMLQSLQQLTGDNYFFYYGTIVFKAVGLEDSFQTSIVIGVVNFASTFVGIYLV 375

Query: 374 DKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFA 433
           +++GRR CLLWGA  M  CMV++ASVGVT+L+P+G+ QPSSKGAGN MI F+CF+IFCFA
Sbjct: 376 ERFGRRRCLLWGAGTMTACMVIYASVGVTRLYPHGRKQPSSKGAGNCMICFTCFYIFCFA 435

Query: 434 TTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGC 493
           TTWAPIPFV+ SE+FPLRVK+K MA+    N +W F I FFTPFITGAINFYYGYVF+GC
Sbjct: 436 TTWAPIPFVVNSETFPLRVKSKCMAIAQGCNWLWGFLISFFTPFITGAINFYYGYVFMGC 495

Query: 494 LVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKP 553
           L FS+ YVF FVPETKGL LE+VN MWEEG LPWKS +WVPPSQR  DY+ +A+  DDKP
Sbjct: 496 LCFSFFYVFFFVPETKGLSLEEVNTMWEEGTLPWKSPNWVPPSQRNADYDIDAMNHDDKP 555

Query: 554 IYKRMFSKN 562
           +YKRMFS+ 
Sbjct: 556 MYKRMFSRK 564

>KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/552 (67%), Positives = 455/552 (82%), Gaps = 1/552 (0%)

Query: 11  DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFI 70
           D  S++  S  S+++ ++  KD  +    ++++ EIPKKP SAY++V IMC+M+AFGGF+
Sbjct: 14  DSASNSEISTPSNKAERDDLKDEYNDENAENEV-EIPKKPGSAYVTVSIMCIMIAFGGFV 72

Query: 71  SGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGD 130
            GWDTGTI GF++ +D+I R G   +DG+ YLSKVR GL+VSIFN+GCAIG ++L + GD
Sbjct: 73  FGWDTGTISGFVAQTDFIRRLGQRRADGTHYLSKVRIGLVVSIFNIGCAIGGIILSKAGD 132

Query: 131 TVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPK 190
             GR+KG++I V IYIVGIVIQIA+I+KWYQYFIGRII+GLG G I+VLSPMLISE+SPK
Sbjct: 133 MYGRKKGLIIVVSIYIVGIVIQIATINKWYQYFIGRIISGLGVGGISVLSPMLISEVSPK 192

Query: 191 HLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPE 250
           HLRGTLVSC+QLMIT G+FLGYCTNYGTK Y NS QWRVPLGLCFAWAL MIG M  VPE
Sbjct: 193 HLRGTLVSCFQLMITLGIFLGYCTNYGTKKYSNSTQWRVPLGLCFAWALFMIGGMTFVPE 252

Query: 251 SPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTK 310
           SPRYL+EK  IEEAK S++ SNKV+IDDP+   EI+ +   VEAE+ AG+ASW ELF TK
Sbjct: 253 SPRYLLEKNLIEEAKHSISISNKVSIDDPSVQAEIDTLMAGVEAERLAGTASWGELFSTK 312

Query: 311 TKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVAL 370
            K+ QR LMG ++ +LQQLTG NYFFYYGTI+FKAVGLEDSFQTS++ G+VNFASTFV +
Sbjct: 313 NKIFQRLLMGCMLQSLQQLTGDNYFFYYGTIVFKAVGLEDSFQTSIVIGVVNFASTFVGI 372

Query: 371 YVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIF 430
           Y+V+++GRR CLLWGA  M  CMV++ASVGVT+L+P+G+ QPSSKGAGN MI F+CF+IF
Sbjct: 373 YLVERFGRRRCLLWGAGTMTACMVIYASVGVTRLYPHGRKQPSSKGAGNCMICFTCFYIF 432

Query: 431 CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVF 490
           CFATTWAPIPFV+ SE+FPLRVK+K MA+    N +W F I FFTPFITGAINFYYGYVF
Sbjct: 433 CFATTWAPIPFVVNSETFPLRVKSKCMAIAQGCNWLWGFLISFFTPFITGAINFYYGYVF 492

Query: 491 LGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATD 550
           +GCL FS+ YVF FVPETKGL LE+VN MWEEG LPWKS +WVPPSQR  DY+ +A+  D
Sbjct: 493 MGCLCFSFFYVFFFVPETKGLSLEEVNTMWEEGTLPWKSPNWVPPSQRNADYDIDAMNHD 552

Query: 551 DKPIYKRMFSKN 562
           DKPIYKRMFS+N
Sbjct: 553 DKPIYKRMFSRN 564

>CAGL0A02233g Chr1 complement(235820..237469) [1650 bp, 549 aa] {ON}
           highly similar to uniprot|P39003 Saccharomyces
           cerevisiae YDR343c HXT6 or uniprot|P39004 Saccharomyces
           cerevisiae YDR342c HXT7
          Length = 549

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/549 (69%), Positives = 455/549 (82%), Gaps = 1/549 (0%)

Query: 12  VHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQ-IIEIPKKPASAYLSVCIMCLMVAFGGFI 70
           +   +  ++ +S S  E + + + + + D Q ++EIPKKPASAY+++ I CL +AFGGF+
Sbjct: 1   MSEESQSALSASNSKVEREDEFKAYTDEDGQPMVEIPKKPASAYVAISIFCLFIAFGGFV 60

Query: 71  SGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGD 130
            GWDTGTI GF++ +D+I R G + ++G+ YLSKVRTGL+VSIFN+GCAIG VVL +LGD
Sbjct: 61  FGWDTGTISGFVAQTDFIRRMGQTRANGTHYLSKVRTGLIVSIFNIGCAIGGVVLSKLGD 120

Query: 131 TVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPK 190
             GR+ G++  V IYIVGIVIQIA+IDKWYQYFIGRII+GLG G IAVLSPMLISE+SPK
Sbjct: 121 VYGRKIGLISVVVIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPK 180

Query: 191 HLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPE 250
           H+RG+LVSCYQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWAL MIG M  VPE
Sbjct: 181 HMRGSLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPE 240

Query: 251 SPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTK 310
           SPRYL+E G++EEA+RS+A SNKV+ DDPA   E+E VQ  VEAE+ AGSASW ELF TK
Sbjct: 241 SPRYLIEVGRVEEARRSIAISNKVSPDDPAVTFEVENVQAGVEAERLAGSASWGELFSTK 300

Query: 311 TKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVAL 370
           TK+ QR +MG+++ +LQQLTG NYFFYYGT +FKAVGLEDSF+TS++ GIVNFASTFVAL
Sbjct: 301 TKIFQRLIMGIMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFETSIVIGIVNFASTFVAL 360

Query: 371 YVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIF 430
           YVVD++GRR CLLWGAA M  CMVVFASVGVT+L+P+G  QPSSKGAGN MIVF+CF+IF
Sbjct: 361 YVVDRFGRRRCLLWGAAAMTACMVVFASVGVTRLYPHGMKQPSSKGAGNCMIVFTCFYIF 420

Query: 431 CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVF 490
           CFATTWAPIPFV+ SE+FPLRVKAK MA+   SN +W F I FFTPFIT AINFYYGYVF
Sbjct: 421 CFATTWAPIPFVVNSETFPLRVKAKCMAIAQASNWIWGFLIAFFTPFITNAINFYYGYVF 480

Query: 491 LGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATD 550
           +GCL FSY YVF F+PETKGL LE+VN MWEEGVL WKS +WVPPS+R   Y+A+AL  D
Sbjct: 481 MGCLCFSYFYVFFFIPETKGLTLEEVNTMWEEGVLAWKSPNWVPPSKRDASYDADALMHD 540

Query: 551 DKPIYKRMF 559
           DKP YKR +
Sbjct: 541 DKPWYKRFY 549

>NDAI0C04560 Chr3 complement(1036823..1038535) [1713 bp, 570 aa]
           {ON} 
          Length = 570

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/564 (68%), Positives = 463/564 (82%), Gaps = 8/564 (1%)

Query: 2   DYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFN---EIDSQIIEIPKKPASAYLSVC 58
           + S SP   + HS T     S+ S +  + D +DF    E   + ++IPKKP+SAY++V 
Sbjct: 12  NQSASPLENESHSIT-----STPSNKAERDDQKDFTSDLEPADEGMDIPKKPSSAYVTVS 66

Query: 59  IMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGC 118
           IMC+MVAFGGF+ GWDTGTI GF++ +D++ RFG  H DG+ YLSKVR GL+VSIFN+GC
Sbjct: 67  IMCIMVAFGGFVFGWDTGTISGFVAQTDFLRRFGQKHHDGTHYLSKVRMGLIVSIFNIGC 126

Query: 119 AIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAV 178
           AIG ++L + GD  GR+ G++I V IYIVGIVIQIAS+  WYQYFIGRII+GLG G IAV
Sbjct: 127 AIGGIILSKAGDMYGRKMGLIIVVIIYIVGIVIQIASVKAWYQYFIGRIISGLGVGGIAV 186

Query: 179 LSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWA 238
           LSPMLISE+SPKHLRGTLV+CYQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWA
Sbjct: 187 LSPMLISEVSPKHLRGTLVACYQLMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWA 246

Query: 239 LVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAA 298
           L MIG M  VPESPRYLVE G+I+EAKRS++ SNKV IDDP+ I E+E+VQ  VEAE+ A
Sbjct: 247 LFMIGGMTFVPESPRYLVEVGKIDEAKRSISISNKVGIDDPSVIAEVEVVQAGVEAEKLA 306

Query: 299 GSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIF 358
           G+ASW ELFQTK K+ QR +MG ++  LQQLTG NYFFYYGTI+FK+VGLEDSFQTS+I 
Sbjct: 307 GNASWGELFQTKNKIFQRLIMGCVIQCLQQLTGDNYFFYYGTIVFKSVGLEDSFQTSIII 366

Query: 359 GIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAG 418
           G+VNFASTFV +YVV+++GRR CLLWGAA M  CMVV+ASVGVT+LWP+GQ   SSKGAG
Sbjct: 367 GVVNFASTFVGIYVVERFGRRRCLLWGAATMTACMVVYASVGVTRLWPHGQGNGSSKGAG 426

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MI F+CF+IFCFATTWAPIPFV+ SE+FPLRVK+K M++    N +W F I FFTPFI
Sbjct: 427 NCMICFTCFYIFCFATTWAPIPFVVNSETFPLRVKSKCMSVAQACNWLWGFLISFFTPFI 486

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           TGAINFYYGYVF+GCL FS+ YVF F+PETKGL LE+VN MWEEGVLPWKS SWVPPS+R
Sbjct: 487 TGAINFYYGYVFMGCLCFSFFYVFFFIPETKGLTLEEVNTMWEEGVLPWKSTSWVPPSKR 546

Query: 539 GTDYNAEALATDDKPIYKRMFSKN 562
           G DY+A ALA DDKP++KRMF+++
Sbjct: 547 GADYDAAALAQDDKPMFKRMFARD 570

>Suva_15.287 Chr15 complement(489708..491438) [1731 bp, 576 aa] {ON}
           YHR096C (REAL)
          Length = 576

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/557 (69%), Positives = 466/557 (83%), Gaps = 2/557 (0%)

Query: 6   SPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVA 65
           SP   D  S++A S  S+++ ++  KD  + +E  +  +EIPKKPASAY++V IMC+M+A
Sbjct: 22  SPVESD--SNSALSTPSNKAERDDLKDFDENHEESNNYVEIPKKPASAYVTVSIMCIMIA 79

Query: 66  FGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVL 125
           FGGF+ GWDTGTI GF++ +D+I RFG  H DGS YLSKVRTGL+V+IFN+GCA+G ++L
Sbjct: 80  FGGFVFGWDTGTISGFVAQTDFIRRFGMKHKDGSYYLSKVRTGLIVAIFNIGCAVGGILL 139

Query: 126 GRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLIS 185
            RLGD  GR+ G+++ V IYI+GI+IQIASIDKWYQYFIGRII+GLG G IAVLSPMLIS
Sbjct: 140 ARLGDMYGRKMGLIVVVVIYIIGIIIQIASIDKWYQYFIGRIISGLGVGGIAVLSPMLIS 199

Query: 186 EISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAM 245
           E+SPKH+RGTLVSCYQLMIT G+FLGYCTNYGTKTY NS+QWRVPLGL FAWAL MIG M
Sbjct: 200 EVSPKHIRGTLVSCYQLMITLGIFLGYCTNYGTKTYSNSVQWRVPLGLGFAWALFMIGGM 259

Query: 246 FIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSE 305
             VPESPRYLVE G+IEEAKRS+A SNKV++DDPA   EIE+VQ  +EAE+ AG+ASW E
Sbjct: 260 TFVPESPRYLVEVGKIEEAKRSIALSNKVSVDDPAIAAEIEVVQSGIEAEKLAGNASWGE 319

Query: 306 LFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAS 365
           LF TKTK+LQR +MG ++ +LQQLTG NYFFYYGT +F AVGL+DSF+TS++ GIVNFAS
Sbjct: 320 LFNTKTKILQRLIMGAMIQSLQQLTGDNYFFYYGTTVFTAVGLQDSFETSIVLGIVNFAS 379

Query: 366 TFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFS 425
           T V +++V++YGRR CLLWGAA MVCCMVVFASVGVT+LWPNG+   SSKGAGN MIVF+
Sbjct: 380 TLVGIFLVERYGRRRCLLWGAASMVCCMVVFASVGVTRLWPNGKKNGSSKGAGNCMIVFT 439

Query: 426 CFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFY 485
           CF++FCFATTWAPIPFV+ SE+FPLRVK+K M++    N +W F IGFFTPFI+GAI+FY
Sbjct: 440 CFYLFCFATTWAPIPFVVNSETFPLRVKSKCMSIAQACNWLWGFLIGFFTPFISGAIDFY 499

Query: 486 YGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAE 545
           YGYVF+GCLVFSY YVF FVPETKGL LE+VN +WEEGVLPWKSA WVPP++R  DYNA 
Sbjct: 500 YGYVFMGCLVFSYFYVFFFVPETKGLTLEEVNTLWEEGVLPWKSAEWVPPNKRNADYNAN 559

Query: 546 ALATDDKPIYKRMFSKN 562
            L  DD+P +K+MF K 
Sbjct: 560 DLKEDDQPFFKKMFGKK 576

>YHR092C Chr8 complement(287081..288811) [1731 bp, 576 aa] {ON}
           HXT4High-affinity glucose transporter of the major
           facilitator superfamily, expression is induced by low
           levels of glucose and repressed by high levels of
           glucose
          Length = 576

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/557 (69%), Positives = 466/557 (83%), Gaps = 2/557 (0%)

Query: 6   SPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVA 65
           SP   D  S++A S  S+++ ++  KD  + +E  +  +EIPKKPASAY++V I CLMVA
Sbjct: 22  SPVESD--SNSALSTPSNKAERDDMKDFDENHEESNNYVEIPKKPASAYVTVSICCLMVA 79

Query: 66  FGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVL 125
           FGGF+ GWDTGTI GF++ +D+I RFG  H DG+ YLSKVRTGL+VSIFN+GCAIG ++L
Sbjct: 80  FGGFVFGWDTGTISGFVAQTDFIRRFGMKHHDGTYYLSKVRTGLIVSIFNIGCAIGGIIL 139

Query: 126 GRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLIS 185
            +LGD  GR+ G+++ V IYI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPMLIS
Sbjct: 140 AKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLIS 199

Query: 186 EISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAM 245
           E+SPKH+RGTLVSCYQLMIT G+FLGYCTNYGTKTY NS+QWRVPLGL FAWAL MIG M
Sbjct: 200 EVSPKHIRGTLVSCYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGLGFAWALFMIGGM 259

Query: 246 FIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSE 305
             VPESPRYLVE G+IEEAKRS+A SNKV+ DDPA + E+E+VQ  VEAE+ AG+ASW E
Sbjct: 260 TFVPESPRYLVEVGKIEEAKRSIALSNKVSADDPAVMAEVEVVQATVEAEKLAGNASWGE 319

Query: 306 LFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAS 365
           +F TKTKV QR +MG ++ +LQQLTG NYFFYYGT +F AVGLEDSF+TS++ GIVNFAS
Sbjct: 320 IFSTKTKVFQRLIMGAMIQSLQQLTGDNYFFYYGTTVFTAVGLEDSFETSIVLGIVNFAS 379

Query: 366 TFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFS 425
           TFV +++V++YGRR CLLWGAA M  CMVVFASVGVT+LWPNG+   SSKGAGN MIVF+
Sbjct: 380 TFVGIFLVERYGRRRCLLWGAASMTACMVVFASVGVTRLWPNGKKNGSSKGAGNCMIVFT 439

Query: 426 CFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFY 485
           CF++FCFATTWAPIPFV+ SE+FPLRVK+K MA+    N +W F IGFFTPFI+GAI+FY
Sbjct: 440 CFYLFCFATTWAPIPFVVNSETFPLRVKSKCMAIAQACNWIWGFLIGFFTPFISGAIDFY 499

Query: 486 YGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAE 545
           YGYVF+GCLVFSY YVF FVPETKGL LE+VN +WEEGVLPWKS SWVPP++RGTDYNA+
Sbjct: 500 YGYVFMGCLVFSYFYVFFFVPETKGLTLEEVNTLWEEGVLPWKSPSWVPPNKRGTDYNAD 559

Query: 546 ALATDDKPIYKRMFSKN 562
            L  DD+P YK+MF K 
Sbjct: 560 DLMHDDQPFYKKMFGKK 576

>NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON} 
          Length = 575

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/557 (66%), Positives = 459/557 (82%), Gaps = 6/557 (1%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEI--DSQII--EIPKKPASAYLSVCIMCLMVA 65
           E ++ S +GS HS    Q  K D ++      D +I   E+PKKPASAY++V I+CLM+A
Sbjct: 20  EPLNDSASGS-HSVLEAQSNKDDDEEIKNYGEDGEIAPAEMPKKPASAYVTVSILCLMIA 78

Query: 66  FGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVL 125
           FGG++ GWDTGTI GF++ +DY+ R+G    DG+ YLSKVRTGLL++IFN+GCAIG ++ 
Sbjct: 79  FGGYVYGWDTGTISGFVAQTDYVRRYGQKKKDGTYYLSKVRTGLLLAIFNIGCAIGGLLW 138

Query: 126 GRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLIS 185
            RLGD  GRRK +V    +Y++G++I IA++  WYQYFIGRII+GLG G IAV SP+LIS
Sbjct: 139 SRLGDMWGRRKALVFVTTVYMIGLIISIAAVKHWYQYFIGRIISGLGVGGIAVYSPLLIS 198

Query: 186 EISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAM 245
           E++PKH+RGTLVSCYQLMIT G+FLGYCTN+GT+ Y NS+QWRVPLGL FAWAL MI AM
Sbjct: 199 EVAPKHVRGTLVSCYQLMITLGIFLGYCTNFGTRNYSNSVQWRVPLGLGFAWALFMIAAM 258

Query: 246 FIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSE 305
           F VPESPRYL+E GQ+EEAKRSVA+SN++T+DDP+ I E+E +   VEAE+ AGSASW E
Sbjct: 259 FFVPESPRYLIEVGQMEEAKRSVAQSNRLTVDDPSVIAEVEFLTAGVEAEREAGSASWME 318

Query: 306 LFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAS 365
           LFQTK K+L R +MG+++  LQQLTG NYFF+YGT+IF ++G+ D F+ S++ GIVNFAS
Sbjct: 319 LFQTKGKILHRVIMGIMIQTLQQLTGANYFFFYGTLIFASIGMNDGFKASVVIGIVNFAS 378

Query: 366 TFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNG-QDQPSSKGAGNTMIVF 424
           TF A+Y+VD++GRRTCLL+GAAGM+CCMVVFASVGVT+L P+G Q+  +SKGAGN MI F
Sbjct: 379 TFPAIYIVDRFGRRTCLLFGAAGMICCMVVFASVGVTRLHPDGDQNGVASKGAGNCMICF 438

Query: 425 SCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINF 484
           +CFFIFCFA TWAP  +VI+SESFPLR+KAKGMAL T +N MWNF +GFFTPFITGAINF
Sbjct: 439 TCFFIFCFANTWAPCAYVIVSESFPLRIKAKGMALATAANWMWNFLLGFFTPFITGAINF 498

Query: 485 YYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNA 544
           YYGYVF+GCL FS+CYVF F+PETKGL LE+VN MWEEGVLPWKS+ WVPPS+RG DY+A
Sbjct: 499 YYGYVFMGCLCFSWCYVFFFIPETKGLSLEEVNTMWEEGVLPWKSSEWVPPSRRGADYDA 558

Query: 545 EALATDDKPIYKRMFSK 561
            A+ATDDKP++KRM  K
Sbjct: 559 AAMATDDKPLFKRMLGK 575

>SAKL0G07678g Chr7 (645867..647570) [1704 bp, 567 aa] {ON} highly
           similar to uniprot|P39003 Saccharomyces cerevisiae
           YDR343C HXT6 High-affinity glucose transporter of the
           major facilitator superfamily nearly identical to Hxt7p
           expressed at high basal levels relative to other HXTs
           repression of expression by high glucose requires SNF3
          Length = 567

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/549 (69%), Positives = 459/549 (83%), Gaps = 1/549 (0%)

Query: 11  DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFI 70
           D HS  +GS  S+ S +  + D ++    +  + +IPKKPASAY++VCI+CL VAFGGF+
Sbjct: 18  DNHSFLSGSQLSTPSNKASRDDLKEQGLAEDNVPDIPKKPASAYITVCILCLFVAFGGFV 77

Query: 71  SGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
            GWDTGTI GF++ +D+  RFG   HS G+ YLS VR GL+VSIFN+GCA G ++L +LG
Sbjct: 78  FGWDTGTISGFVNQTDFKRRFGQYKHSTGTYYLSDVRVGLIVSIFNIGCAFGGIILSKLG 137

Query: 130 DTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISP 189
           D  GRR G++  V +YIVGI+IQIASIDKWYQYFIGRII+GLG G I+VLSPMLISE +P
Sbjct: 138 DMYGRRIGLMAVVVVYIVGIIIQIASIDKWYQYFIGRIISGLGVGGISVLSPMLISETAP 197

Query: 190 KHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVP 249
           KHLRGTL++ YQLMIT G+FLGYCTNYGTK Y+NS+QWRVPLGLCFAWA+ MI  M  VP
Sbjct: 198 KHLRGTLIASYQLMITAGIFLGYCTNYGTKNYENSVQWRVPLGLCFAWAIFMITGMLFVP 257

Query: 250 ESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQT 309
           ESPRYLVE G+IEEAKRS+A+SNKVTI+DPA   E++++   VEAE+ AGSASWSELF  
Sbjct: 258 ESPRYLVEAGKIEEAKRSIARSNKVTIEDPAVQTEVDMICAGVEAEKLAGSASWSELFSA 317

Query: 310 KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVA 369
           KTKVLQR +MG+++ +LQQLTG NYFFYYGT IFK+VG+EDSF+TS++ GIVNFASTF +
Sbjct: 318 KTKVLQRLIMGIMIQSLQQLTGDNYFFYYGTTIFKSVGMEDSFETSIVIGIVNFASTFFS 377

Query: 370 LYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFI 429
           LY VDK+GRR C+LWGA+ MV C VVFASVGVT+LWPNGQDQPSSKGAGN MIVF+CF+I
Sbjct: 378 LYTVDKFGRRKCMLWGASTMVACFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVFTCFYI 437

Query: 430 FCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYV 489
           FCFATTWAPI +VI++ESFPLRVK+KGMA+ T SN +W F IGFFTPFIT AINFYYGYV
Sbjct: 438 FCFATTWAPIAYVIVAESFPLRVKSKGMAIATASNWLWGFLIGFFTPFITSAINFYYGYV 497

Query: 490 FLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALAT 549
           F+GCLVF+Y YVF FVPETKGL LE+VN MWEEGVLPWKS+SW+P S+RG DYNA+ L  
Sbjct: 498 FMGCLVFAYFYVFFFVPETKGLTLEEVNEMWEEGVLPWKSSSWIPSSRRGADYNADDLQH 557

Query: 550 DDKPIYKRM 558
           D+KP +KRM
Sbjct: 558 DEKPWFKRM 566

>CAGL0A00737g Chr1 (74767..76416) [1650 bp, 549 aa] {ON} highly
           similar to uniprot|P39003 Saccharomyces cerevisiae
           YDR343c HXT6 or uniprot|P39004 Saccharomyces cerevisiae
           YDR342c HXT7
          Length = 549

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/549 (69%), Positives = 452/549 (82%), Gaps = 1/549 (0%)

Query: 12  VHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQ-IIEIPKKPASAYLSVCIMCLMVAFGGFI 70
           +   +  +  +S S  E ++D + + + D Q ++EIPKKPASAY  + I+CL +AFGGF+
Sbjct: 1   MSEESQSAFSASNSKVEREEDFKAYADEDGQPMVEIPKKPASAYTLIFILCLFIAFGGFV 60

Query: 71  SGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGD 130
            GWDTGTI GF++  D+I R G   ++ + YLSKVRTGL+VSIFN+GCAIG VVL + GD
Sbjct: 61  FGWDTGTISGFVAEEDFIKRLGQRRANNTYYLSKVRTGLIVSIFNIGCAIGGVVLSKFGD 120

Query: 131 TVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPK 190
             GR+ G++I + +YIVGIVIQIA+IDKWYQYFIGRI++GLG G IAVLSPMLISE+SPK
Sbjct: 121 MYGRKIGLIIVIVVYIVGIVIQIATIDKWYQYFIGRIVSGLGVGGIAVLSPMLISEVSPK 180

Query: 191 HLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPE 250
           H+RGTLVSCYQLM+T G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWAL MIG M  VPE
Sbjct: 181 HMRGTLVSCYQLMVTCGIFLGYCTNYGTKNYPNSVQWRVPLGLCFAWALFMIGGMLCVPE 240

Query: 251 SPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTK 310
           SPRYLVE G+ EEA+RS+A SNK+T +DPA   E+E VQ  VEAE+ AGSASW ELF TK
Sbjct: 241 SPRYLVEVGKFEEARRSIAISNKLTPEDPAVTFELENVQAGVEAERLAGSASWGELFSTK 300

Query: 311 TKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVAL 370
           TKVLQR +MG+++  LQQLTG NYFFYYGT +FKAVGLEDSFQTS++ GIVNFASTFVAL
Sbjct: 301 TKVLQRLIMGIMLQCLQQLTGDNYFFYYGTTVFKAVGLEDSFQTSIVIGIVNFASTFVAL 360

Query: 371 YVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIF 430
           YVVD++GRR CLLWGAA M  CMVVFASVGVT+L+PNG DQPSSKGAGN MIVF+CF+IF
Sbjct: 361 YVVDRFGRRKCLLWGAASMTACMVVFASVGVTRLYPNGMDQPSSKGAGNCMIVFTCFYIF 420

Query: 431 CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVF 490
           CFATTWAP P+VI SE+FPLRVKAK MA+   +N +W F I FFTPFITGAINFYYGYVF
Sbjct: 421 CFATTWAPTPWVINSETFPLRVKAKCMAICQAANWIWGFLIAFFTPFITGAINFYYGYVF 480

Query: 491 LGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATD 550
           +GCL FSY YVF F+PETKGL LE+VN MWEEGVLPWKS  W+PPS+R   Y+A+A+  D
Sbjct: 481 MGCLCFSYFYVFFFIPETKGLTLEEVNTMWEEGVLPWKSPDWIPPSKRDATYDADAMMHD 540

Query: 551 DKPIYKRMF 559
           DKP Y+RM+
Sbjct: 541 DKPWYRRMW 549

>Skud_8.153 Chr8 complement(261078..262808) [1731 bp, 576 aa] {ON}
           YHR096C (REAL)
          Length = 576

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/557 (69%), Positives = 465/557 (83%), Gaps = 2/557 (0%)

Query: 6   SPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVA 65
           SP   D  S++A S  S+++ ++  KD  + +E  +  +EIPKKPASAY++V I CLMVA
Sbjct: 22  SPVESD--SNSALSTPSNKAERDDMKDFDETHEESNNYVEIPKKPASAYVTVSICCLMVA 79

Query: 66  FGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVL 125
           FGGF+ GWDTGTI GF++ +D+I RFG  H DG+ YLSKVRTGL+VSIFN+GCAIG ++L
Sbjct: 80  FGGFVFGWDTGTISGFVAQTDFIRRFGMKHHDGTYYLSKVRTGLIVSIFNIGCAIGGIIL 139

Query: 126 GRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLIS 185
            RLGD  GR+ G+++ V IYI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPMLIS
Sbjct: 140 ARLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLIS 199

Query: 186 EISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAM 245
           E+SPKH+RGTLVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGL FAWAL MIG M
Sbjct: 200 EVSPKHIRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLGFAWALFMIGGM 259

Query: 246 FIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSE 305
             VPESPRYLVE G+IEEAKRS+A SNKV+ DDPA + E+E+VQ AVEAE+ AG+A+W E
Sbjct: 260 TFVPESPRYLVEVGKIEEAKRSIALSNKVSADDPAVMAEVEVVQSAVEAEKLAGNATWGE 319

Query: 306 LFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAS 365
           +F TKTKV QR +MG ++ +LQQLTG NYFFYYGT +F AVGLEDSF+TS++ GIVNFAS
Sbjct: 320 IFSTKTKVFQRLIMGAMIQSLQQLTGDNYFFYYGTTVFTAVGLEDSFETSIVLGIVNFAS 379

Query: 366 TFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFS 425
           T V +++V++YGRR CLLWGAA MVCCMVVFASVGVT+LWPNG+   SSKGAGN MIVF+
Sbjct: 380 TLVGIFLVERYGRRRCLLWGAASMVCCMVVFASVGVTRLWPNGKKNGSSKGAGNCMIVFT 439

Query: 426 CFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFY 485
           CF++FCFATTWAPIPFV+ SE+FPLRVK+K MA+    N +W F IGFFTPFI+ AI+FY
Sbjct: 440 CFYLFCFATTWAPIPFVVNSETFPLRVKSKCMAIAQACNWIWGFLIGFFTPFISAAIDFY 499

Query: 486 YGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAE 545
           YGYVF+GCLVFSY YVF FVPETKGL LE+VN +WEEGVLPWKS SWVPPS+R  DYNAE
Sbjct: 500 YGYVFMGCLVFSYFYVFFFVPETKGLTLEEVNTLWEEGVLPWKSPSWVPPSRRNADYNAE 559

Query: 546 ALATDDKPIYKRMFSKN 562
            LA DD+P +K+MF + 
Sbjct: 560 ELAEDDQPFFKKMFGRK 576

>KNAG0I00110 Chr9 complement(5329..7020) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/536 (69%), Positives = 448/536 (83%), Gaps = 1/536 (0%)

Query: 27  QEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSD 86
            EMK    D N ++    E+PKKPASAY++V I+CLM+AFGG++ GWDTGTIGGFL+H D
Sbjct: 28  DEMKAFGTDANGMEVAAAEMPKKPASAYVTVSILCLMIAFGGYVYGWDTGTIGGFLNHED 87

Query: 87  YINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYI 146
           ++ RFG  HSDG+ Y S  R GL+V+IFN+GCAIG +   RLGD  GRR  +V    +Y+
Sbjct: 88  FLRRFGQKHSDGTYYFSNPRMGLIVAIFNIGCAIGGLAWSRLGDIYGRRLALVWVTIVYM 147

Query: 147 VGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITF 206
           +G+VI IASIDKWYQYFIGRII+G G G IAV SP+LISE+SPKH+RGTLVSCYQLMIT 
Sbjct: 148 IGLVISIASIDKWYQYFIGRIISGCGVGGIAVYSPLLISEVSPKHVRGTLVSCYQLMITL 207

Query: 207 GMFLGYCTNYGTKT-YDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAK 265
           G+FLGYCTNYGT+  Y NS QWRVPLGL FAWAL MI AM  VPESPR+L+E G++E+AK
Sbjct: 208 GIFLGYCTNYGTEHGYTNSTQWRVPLGLGFAWALFMIAAMLFVPESPRFLIEVGRMEDAK 267

Query: 266 RSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLA 325
            SVA+SNK+T+DDP+ I E+E +   +EAE+ AGSA+W ELF TK KVLQRT++GV++ +
Sbjct: 268 VSVARSNKLTVDDPSVIAEVEFLAAGIEAEREAGSANWGELFSTKGKVLQRTILGVMIQS 327

Query: 326 LQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWG 385
           LQQLTG NYFF+YGT IF+AVGL+DS+QT++I G+VNFASTF A+Y V+++GRRT LLWG
Sbjct: 328 LQQLTGANYFFFYGTQIFEAVGLKDSYQTAIIIGVVNFASTFPAIYFVERFGRRTGLLWG 387

Query: 386 AAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIIS 445
           AAGM+CC VVFASVGVT+L+PNG+DQPSSKGAG+ MI F+CFFIFCFATTWAP  +VI+S
Sbjct: 388 AAGMICCFVVFASVGVTRLYPNGKDQPSSKGAGDCMICFTCFFIFCFATTWAPTAYVIVS 447

Query: 446 ESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFV 505
           ESFPLRVKAKGMAL   +N +WNF +GFFTPFITGAINFYYGYVF+GCL FS+ YVF FV
Sbjct: 448 ESFPLRVKAKGMALSIAANWIWNFLLGFFTPFITGAINFYYGYVFMGCLCFSWVYVFFFV 507

Query: 506 PETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMFSK 561
           PETKGL LE+VN+MWEEGVLPWKSASWVPPS+R +DY+A+A+A DD P YKRM  K
Sbjct: 508 PETKGLSLEEVNIMWEEGVLPWKSASWVPPSKRDSDYDADAMAHDDVPFYKRMLGK 563

>TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/554 (64%), Positives = 443/554 (79%), Gaps = 3/554 (0%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
           E VHS+   S       Q +  DS   ++I   +IEI K+P S Y++VC  C+++ FGGF
Sbjct: 23  ESVHSND--SQREDNQKQTISVDSFSEDDISPNVIEILKRPLSTYITVCFNCILIGFGGF 80

Query: 70  ISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
           + GWD GTIGGF++  D+  RFGS+  +G  YLSKVRTGLLVSIFN+GCAIGSV LGRLG
Sbjct: 81  MMGWDIGTIGGFIAQPDFKRRFGSTTKEGEHYLSKVRTGLLVSIFNIGCAIGSVTLGRLG 140

Query: 130 DTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISP 189
           D  GRR G+++A  I++VG+VI+IASIDKWYQYFIGRIIAG+G G IA+LSPMLISE+SP
Sbjct: 141 DIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVIAILSPMLISEVSP 200

Query: 190 KHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVP 249
           K +RG +VSC+Q+MIT G+FLG CT YG+K Y NS QWRV LGL FAW+L M+  M  VP
Sbjct: 201 KEVRGGMVSCFQMMITLGIFLGDCTEYGSKEYSNSAQWRVGLGLQFAWSLCMVAGMLFVP 260

Query: 250 ESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQT 309
           ESP YLVEKG+IEEAKRSVA SNK+  DDPA I E+E +Q AVE ++A G A W++LF+T
Sbjct: 261 ESPIYLVEKGKIEEAKRSVAISNKLNADDPAVISEVEEIQSAVEKKRAEGEAGWNDLFET 320

Query: 310 KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVA 369
             K+ QR ++G++++ALQQL+G NYFFYYGT IFK+VGLED F  ++IFG++NF +TF++
Sbjct: 321 HNKIFQRVIIGIMLMALQQLSGANYFFYYGTTIFKSVGLEDGFVAAIIFGVINFFATFLS 380

Query: 370 LYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSKGAGNTMIVFSCFF 428
           +Y++DK+GRRTCLLWGAAGMVCCMV+FASVGVT+LWP G++    SKGAGN MIVFSCFF
Sbjct: 381 IYLIDKFGRRTCLLWGAAGMVCCMVIFASVGVTRLWPKGKNAGIISKGAGNCMIVFSCFF 440

Query: 429 IFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGY 488
           I CF T+WAP+PFV I+ESFP ++K+KGMAL  VSNQ+W FCIGFFTPFITG+INFYYGY
Sbjct: 441 ILCFGTSWAPVPFVFIAESFPSKIKSKGMALAIVSNQIWTFCIGFFTPFITGSINFYYGY 500

Query: 489 VFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALA 548
           VFLGCLVF++ YVF FVPETKGL LE+VN+MWEEG LPWKSASWVPPSQR  DY+   + 
Sbjct: 501 VFLGCLVFAWFYVFFFVPETKGLHLEEVNIMWEEGTLPWKSASWVPPSQRDADYDVSTMT 560

Query: 549 TDDKPIYKRMFSKN 562
            DD P +K +  K 
Sbjct: 561 NDDTPAWKNILGKR 574

>TDEL0E02310 Chr5 (450790..452493) [1704 bp, 567 aa] {ON} Anc_5.394
           YHR092C
          Length = 567

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/551 (68%), Positives = 449/551 (81%), Gaps = 4/551 (0%)

Query: 15  STAGSVHSSQSFQEMKKDSQDFNEIDSQ--IIEIPKKPASAYLSVCIMCLMVAFGGFISG 72
           S +GS  S+ S +  + D +DF+    +   ++IPK+PAS+Y+ V I+CLMVAFGGF+ G
Sbjct: 17  SASGSGLSTPSNKAERDDIKDFDAAADREAAVDIPKRPASSYIGVSILCLMVAFGGFVFG 76

Query: 73  WDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV 132
           WDTGTI GF++ SD++ RFG    DG  YLSKVR GL+VSIFN+GCAIG ++L ++GD  
Sbjct: 77  WDTGTISGFVNLSDFLQRFGQRSKDGVYYLSKVRMGLIVSIFNIGCAIGGIILSKIGDIY 136

Query: 133 GRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHL 192
           GRR G+V    IY+VGI+IQI S DKWYQYFIGRII+GLG G IAVLSPMLISE+SPK +
Sbjct: 137 GRRIGLVAVTVIYVVGILIQICSFDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKQI 196

Query: 193 RGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           RGTLV+CYQLMIT G+FLGYCTNYGTKTY++S QWRV LGLCFAWA+ MIG M  VPESP
Sbjct: 197 RGTLVACYQLMITLGIFLGYCTNYGTKTYNDSTQWRVGLGLCFAWAIFMIGGMLFVPESP 256

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           RYLVE G IEEAKRS+++SNK+++DDPA + E++ +   VEAE+ AGSASW ELF TKTK
Sbjct: 257 RYLVEHGNIEEAKRSLSRSNKLSVDDPAVLAELDAISAGVEAEKLAGSASWGELFSTKTK 316

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           V QR +MGV++ +LQQLTG NYFFYYGT +FK+VGL+DSFQTS+I G+VNF STFV ++ 
Sbjct: 317 VFQRLIMGVMLQSLQQLTGDNYFFYYGTTVFKSVGLKDSFQTSIIIGVVNFFSTFVGIFC 376

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSKGAGNTMIVFSCFFIF 430
           ++++GRRTCLLWGAA MVCC VVFASVGVTKLWP G      SSKGAGN MIVF+ FFIF
Sbjct: 377 IERFGRRTCLLWGAASMVCCFVVFASVGVTKLWPEGPSHQDISSKGAGNCMIVFTMFFIF 436

Query: 431 CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVF 490
           CFATTWA   +VI+SESFPLRVK+KGMA+ T +N +W F I FFTPFITGAINFYYGYVF
Sbjct: 437 CFATTWAGGCYVIVSESFPLRVKSKGMAIATAANWLWGFLIAFFTPFITGAINFYYGYVF 496

Query: 491 LGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATD 550
           +GCLVF Y YVF FVPETKGL LE+V  MW EGVLPWKSASWVPP +RG DYNAE +A D
Sbjct: 497 MGCLVFGYFYVFFFVPETKGLTLEEVETMWLEGVLPWKSASWVPPDRRGADYNAEGMAHD 556

Query: 551 DKPIYKRMFSK 561
           DKP+YKR FSK
Sbjct: 557 DKPMYKRFFSK 567

>Smik_8.170 Chr8 complement(263829..265556) [1728 bp, 575 aa] {ON}
           YDR342C (REAL)
          Length = 575

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/551 (69%), Positives = 461/551 (83%), Gaps = 2/551 (0%)

Query: 14  SSTAGSVHSSQSFQEMKKDSQDFNEI--DSQIIEIPKKPASAYLSVCIMCLMVAFGGFIS 71
            S + S  S+ S +  + D +DF+E   +S  +EIPKKPASAY++V I CLMVAFGGF+ 
Sbjct: 25  ESDSNSALSTPSNKAERDDIKDFDENHEESNYVEIPKKPASAYVTVSICCLMVAFGGFVF 84

Query: 72  GWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDT 131
           GWDTGTI GF++ +D+I RFG  H DG+ YLSKVRTGL+VSIFN+GCAIG ++L +LGD 
Sbjct: 85  GWDTGTISGFVAQTDFIRRFGMRHHDGTYYLSKVRTGLIVSIFNIGCAIGGIILAKLGDM 144

Query: 132 VGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKH 191
            GR+ G+++ V IYI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPMLISE+SPKH
Sbjct: 145 YGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKH 204

Query: 192 LRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPES 251
           +RGTLVSCYQLMIT G+FLGYCTNYGTKTY NS+QWRVPLGL FAWAL MIG M  VPES
Sbjct: 205 IRGTLVSCYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGLGFAWALFMIGGMTFVPES 264

Query: 252 PRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKT 311
           PRYLVE G+IEEAKRS+A SNKV+ DDPA + E+E+VQ  VEAE+ AG+ASW ELF TKT
Sbjct: 265 PRYLVEVGKIEEAKRSIALSNKVSADDPAVMAEVEVVQATVEAEKLAGNASWGELFNTKT 324

Query: 312 KVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALY 371
           K+ QR +MG ++ +LQQLTG NYFFYYGT +F AVGLEDSF+TS++ GIVNFAST V ++
Sbjct: 325 KIFQRLIMGAMIQSLQQLTGDNYFFYYGTTVFTAVGLEDSFETSIVLGIVNFASTLVGIF 384

Query: 372 VVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFC 431
           +V++YGRR CLLWGAA MV CMVVFASVGVT+LWPNG+   SSKGAGN MIVF+CF++FC
Sbjct: 385 LVERYGRRRCLLWGAASMVACMVVFASVGVTRLWPNGKKNGSSKGAGNCMIVFTCFYLFC 444

Query: 432 FATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFL 491
           FATTWAPIPFV+ SE+FPLRVK+K MA+    N +W F IGFFTPFI+GAI+FYYGYVF+
Sbjct: 445 FATTWAPIPFVVNSETFPLRVKSKCMAIAQACNWIWGFLIGFFTPFISGAIDFYYGYVFM 504

Query: 492 GCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDD 551
           GCLVFSY YVF FVPETKGL LE+VN +WEEGVLPWKS SW+PP++RG DYNA  LA DD
Sbjct: 505 GCLVFSYFYVFFFVPETKGLTLEEVNTLWEEGVLPWKSPSWIPPNRRGADYNANDLAEDD 564

Query: 552 KPIYKRMFSKN 562
           +P +K+MF + 
Sbjct: 565 QPFFKKMFGRK 575

>KAFR0A05550 Chr1 complement(1107647..1109341) [1695 bp, 564 aa]
           {ON} Anc_5.394 YHR092C
          Length = 564

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/558 (68%), Positives = 456/558 (81%)

Query: 5   QSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMV 64
           Q+P      +S+  S  S++   +  K   + N+ D   IEIPKKPASAY++V IMC+M+
Sbjct: 7   QNPQTSVQDASSFTSTPSNKVENDELKAFNESNDDDQVAIEIPKKPASAYITVSIMCIMI 66

Query: 65  AFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVV 124
           AFGGF+ GWDTGTI GF++ +D++ RFG   S+G  YLSKVRTGL+VSIFN+GCAIG ++
Sbjct: 67  AFGGFVFGWDTGTISGFVNQTDFLRRFGELDSEGVPYLSKVRTGLVVSIFNIGCAIGGII 126

Query: 125 LGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLI 184
           L + GD  GR+KG++I V IYIVG VI IAS+  WYQYFIGRIIAGLG G IAVLSPMLI
Sbjct: 127 LAKAGDMYGRKKGLIIVVVIYIVGQVICIASVKAWYQYFIGRIIAGLGVGGIAVLSPMLI 186

Query: 185 SEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGA 244
           SE+SPKHLRGTLVSCYQLMIT G+FLGYCTNYGTKTY +S QWR+PLGLCFAWAL MIG 
Sbjct: 187 SEVSPKHLRGTLVSCYQLMITLGIFLGYCTNYGTKTYSDSRQWRIPLGLCFAWALFMIGG 246

Query: 245 MFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS 304
           M  VPESPRYLVE GQIEEAKRS++ SNKV ++DP+ + EIE++Q  VEAE+ AG+ASW 
Sbjct: 247 MTFVPESPRYLVEVGQIEEAKRSISISNKVGMEDPSVLAEIEIIQAGVEAEKLAGNASWG 306

Query: 305 ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFA 364
           ELF TKTK+ QR LMG ++ +LQQLTG NYFFYYGT IF++VG+ DSF+TS++ GIVNFA
Sbjct: 307 ELFSTKTKIFQRLLMGAMIQSLQQLTGDNYFFYYGTTIFQSVGMNDSFETSIVLGIVNFA 366

Query: 365 STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVF 424
           STFV +YVV++YGRR CLLWG+A M  CMVVFASVGVT+LWPNG+   SSKGAGN MIVF
Sbjct: 367 STFVGIYVVERYGRRRCLLWGSASMTACMVVFASVGVTRLWPNGKGNGSSKGAGNCMIVF 426

Query: 425 SCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINF 484
           +CF+IFCFATTWAPIPFVI SE+FPLRVK+K MA+    N +W F IGFFTPFITGAI+F
Sbjct: 427 TCFYIFCFATTWAPIPFVINSETFPLRVKSKCMAVAQACNWLWGFLIGFFTPFITGAIDF 486

Query: 485 YYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNA 544
           YYGYVF+GCL FSY YVF FVPETKGL LE+VN MWEEGVLPWKS SWVPP++RG DY+A
Sbjct: 487 YYGYVFMGCLCFSYFYVFFFVPETKGLTLEEVNTMWEEGVLPWKSDSWVPPTRRGADYDA 546

Query: 545 EALATDDKPIYKRMFSKN 562
           EAL  D+KP YK +  +N
Sbjct: 547 EALKHDNKPFYKSLMGRN 564

>TDEL0E02300 Chr5 (447834..449537) [1704 bp, 567 aa] {ON}  YIL170W
          Length = 567

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/563 (67%), Positives = 458/563 (81%), Gaps = 6/563 (1%)

Query: 5   QSPTGE-DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQ--IIEIPKKPASAYLSVCIMC 61
            +P G     +S + SV S+ S +  + D++D N + +    I+IPK+PAS+Y+ V I+C
Sbjct: 6   NTPVGHLTPRASGSHSVLSTPSNKAERDDAKDLNSMAAPEPAIDIPKRPASSYVGVSILC 65

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           LM+AFGGF+ GWDTGTI GF++ SD++ RFG  +S  + YLSKVR GL+VSIFN+GCAIG
Sbjct: 66  LMIAFGGFVFGWDTGTISGFVNLSDFLKRFGQRNS-ANTYLSKVRMGLIVSIFNIGCAIG 124

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
            +VL ++GD  GRR G+V    IY+VGI+IQI S DKWYQYFIGRII+GLG G IAVLSP
Sbjct: 125 GLVLSKIGDVYGRRIGLVAVTVIYVVGILIQICSFDKWYQYFIGRIISGLGVGGIAVLSP 184

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           MLISE+SPK +RGTLVSCYQLMIT G+FLGYCTNYGTKTYD+S QWRV LGLCFAWA+ M
Sbjct: 185 MLISEVSPKQIRGTLVSCYQLMITLGIFLGYCTNYGTKTYDDSTQWRVGLGLCFAWAIFM 244

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
           I AMF VPESPRYLVE G  EEAKRS+++SNKV++DDPA + E++ +   VEAE+ AG+A
Sbjct: 245 IAAMFFVPESPRYLVEVGNFEEAKRSLSRSNKVSVDDPALLAELDAISAGVEAERLAGNA 304

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           S  ELF TKTKV QR +MGV++ +LQQLTG NYFFYYGT IFK+VGL+DSFQTS+I G+V
Sbjct: 305 SIGELFSTKTKVFQRLIMGVMLQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSIIIGVV 364

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSKGAGN 419
           NF STFV +Y ++++GRRTCLLWGAA MVCC VVFASVGVTKLWP G      SSKGAGN
Sbjct: 365 NFFSTFVGIYCIERFGRRTCLLWGAASMVCCFVVFASVGVTKLWPEGPSHQDISSKGAGN 424

Query: 420 TMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFIT 479
            MIVF+ FFIFCFATTWA   +VI+SESFPLRVK+KGMA+ T +N +W F I FFTPFIT
Sbjct: 425 CMIVFTMFFIFCFATTWAGGCYVIVSESFPLRVKSKGMAIATGANWLWGFLISFFTPFIT 484

Query: 480 GAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRG 539
           GAINFYYGYVF+GCLVFS+ YVF FVPETKGL LE+VN MW EGVLPWKSASWVPP +RG
Sbjct: 485 GAINFYYGYVFMGCLVFSFFYVFFFVPETKGLTLEEVNTMWLEGVLPWKSASWVPPDRRG 544

Query: 540 TDYNAEALATDDKPIYKRMFSKN 562
            DYNAE +A DDKP+YKR+FS+N
Sbjct: 545 ADYNAEEMAHDDKPMYKRLFSRN 567

>NCAS0H01880 Chr8 complement(361743..363464) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/561 (67%), Positives = 465/561 (82%), Gaps = 2/561 (0%)

Query: 4   SQSPTGE-DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQII-EIPKKPASAYLSVCIMC 61
             +P G+     S + S  S+ S ++ + D +++ E D QII EIPKKPASAY++V IMC
Sbjct: 13  ENTPVGDLSPVESISNSGMSTPSNKDDRDDVKEYVEEDPQIIAEIPKKPASAYVTVSIMC 72

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           +M+AFGGF+ GWDTGTI GF++ +D++ RFG  HS+G  YLSKVR GL+VSIFN+GCA+G
Sbjct: 73  VMIAFGGFVFGWDTGTISGFVAQTDFLQRFGQHHSNGKHYLSKVRMGLIVSIFNIGCAVG 132

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
            ++L +LGD  GR+ G++  V IY++GI+IQIAS+  WYQYFIGRII+GLG G IAVLSP
Sbjct: 133 GIILSKLGDIYGRKIGLITVVVIYVIGIIIQIASVKAWYQYFIGRIISGLGVGGIAVLSP 192

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           MLISE+SPKHLRGTLVSCYQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWAL M
Sbjct: 193 MLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFM 252

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
           IG M  VPESPR+LVE G+I+EAKRSVA SNKV++DDPA + E+E +Q  VEAE+ AG+A
Sbjct: 253 IGGMTFVPESPRFLVEVGRIDEAKRSVAMSNKVSVDDPAVLGELETLQAGVEAEKLAGNA 312

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           SW E+FQTKTKVLQR +MG ++ +LQQLTG NYFFYYGT +F +VG++DSF+TS++ GIV
Sbjct: 313 SWGEIFQTKTKVLQRLIMGSMIQSLQQLTGDNYFFYYGTTVFTSVGMQDSFETSIVLGIV 372

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           NFASTFV +++V++YGRRTCLLWGAA M  CMVVFASVGVT+LWPNG+D  +SKGAGN M
Sbjct: 373 NFASTFVGIFLVERYGRRTCLLWGAATMTSCMVVFASVGVTRLWPNGKDGEASKGAGNCM 432

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           I F+CF++FCFATTWAPIPFV+ SE+FPLRVK+K M++    N +W F IGFFTPFITGA
Sbjct: 433 ICFTCFYLFCFATTWAPIPFVVNSETFPLRVKSKCMSITQGCNWLWGFLIGFFTPFITGA 492

Query: 482 INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTD 541
           I+FYYGYVF+GCL FSY YVF FVPETKGL LE+VN MWEEGVLPWKSA WVPPS+RG +
Sbjct: 493 IDFYYGYVFMGCLCFSYFYVFFFVPETKGLTLEEVNTMWEEGVLPWKSAEWVPPSRRGEN 552

Query: 542 YNAEALATDDKPIYKRMFSKN 562
           Y+   +A DDKP++KRMF + 
Sbjct: 553 YDVAEMAKDDKPLFKRMFGRK 573

>Smik_12.140 Chr12 (270030..271751) [1722 bp, 573 aa] {ON} YLR081W
           (REAL)
          Length = 573

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/561 (64%), Positives = 442/561 (78%), Gaps = 5/561 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQ-----IIEIPKKPASAYLSVC 58
            Q    ED+ SS +   H S   Q+   D     E + +      +EIPKKP S Y++V 
Sbjct: 13  EQPQAAEDLVSSFSKDSHLSAQSQKYSNDELKAGEANPEGSESVPMEIPKKPMSEYVTVS 72

Query: 59  IMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGC 118
           ++CL VAFGGF+ GWDTGTI GF++ +D++ RFG  H DG+ YLS VRTGL+V+IFN+GC
Sbjct: 73  LLCLCVAFGGFMFGWDTGTISGFVAQTDFLRRFGMKHKDGTHYLSNVRTGLIVAIFNIGC 132

Query: 119 AIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAV 178
           A G ++L + GD  GR+KG+ I V +YIVGI+IQIASI+KWYQYFIGRII+GLG G IAV
Sbjct: 133 AFGGIILSKAGDMYGRKKGLSIVVSVYIVGIIIQIASINKWYQYFIGRIISGLGVGGIAV 192

Query: 179 LSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWA 238
           LSPMLISEI+PKHLRGTLVSCYQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAW+
Sbjct: 193 LSPMLISEIAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWS 252

Query: 239 LVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAA 298
           L MIGA+ +VPESPRYL E  ++E+AK S+AKSNKV+ +DPA   E++L+   VEAE+ A
Sbjct: 253 LFMIGALTLVPESPRYLCEMNRVEDAKHSIAKSNKVSPEDPAVQAELDLIMAGVEAEKLA 312

Query: 299 GSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIF 358
           G+ASW ELF TKTKV QR LMGV+V   QQLTG NYFFYYGTI+FK+VGL DSFQTS++ 
Sbjct: 313 GNASWGELFSTKTKVFQRLLMGVLVQMFQQLTGNNYFFYYGTIVFKSVGLNDSFQTSIVI 372

Query: 359 GIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAG 418
           G+VNFASTF +L+ V+  GRR CLL GAA M+ CMV+FASVGVT+L+P+G+ QPSSKGAG
Sbjct: 373 GVVNFASTFFSLWTVENLGRRKCLLLGAATMMACMVIFASVGVTRLYPHGKSQPSSKGAG 432

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MIVF+CF+IFC+ATTWAP+ +VI +ESFPLRVK+K MA+ + SN +W F I FFTPFI
Sbjct: 433 NCMIVFTCFYIFCYATTWAPVAWVITAESFPLRVKSKCMAMASASNWVWGFLIAFFTPFI 492

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           T AINFYYGYVF+GCLV  + YVF FVPETKGL LE++  +WEEGVLPWKS  W+P S+R
Sbjct: 493 TSAINFYYGYVFMGCLVAMFFYVFFFVPETKGLSLEEIQELWEEGVLPWKSEGWIPSSRR 552

Query: 539 GTDYNAEALATDDKPIYKRMF 559
           G DYN E L  D+KP YK M 
Sbjct: 553 GNDYNLEDLQHDNKPWYKAML 573

>Ecym_1317 Chr1 complement(643844..645484) [1641 bp, 546 aa] {ON}
           similar to Ashbya gossypii AFL207C/AFL205C/AFL204C
          Length = 546

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/549 (66%), Positives = 445/549 (81%), Gaps = 6/549 (1%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
           E V  + +G    S S Q  K     + E +   +EIP KPASAYL+V IMCL VAFGGF
Sbjct: 3   EAVIPAESGGSKDSLSLQNNK-----YGE-EPAAVEIPAKPASAYLTVSIMCLFVAFGGF 56

Query: 70  ISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
           + GWDTGTI GF+  +D++ RFG + +DGS YLS VRTGL+VSIFN+GCAIG +VL +LG
Sbjct: 57  VFGWDTGTISGFVRQTDFVRRFGQTRADGSHYLSDVRTGLIVSIFNIGCAIGGIVLSKLG 116

Query: 130 DTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISP 189
           D  GRR G++    +Y+VGIVIQI+S DKWYQYFIGRI++GLG G IAVLSPMLISE SP
Sbjct: 117 DMYGRRIGLMCVTLVYVVGIVIQISSTDKWYQYFIGRIVSGLGVGGIAVLSPMLISETSP 176

Query: 190 KHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVP 249
           KHLRGTLVSCYQLMIT G+FLGYCTNYGTK + +++QWRVPLGLCF WA  M+  M +VP
Sbjct: 177 KHLRGTLVSCYQLMITAGIFLGYCTNYGTKKHSDAVQWRVPLGLCFVWAAFMVAGMAMVP 236

Query: 250 ESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQT 309
           ESPRYLVE  +IEEAKRS+A+SNKV+++DP+   EI+ +Q  VE E+ AG+ASW ELF T
Sbjct: 237 ESPRYLVEVNKIEEAKRSLARSNKVSMEDPSIQAEIDNIQAGVEIERMAGNASWGELFST 296

Query: 310 KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVA 369
           KTK+LQR +MG+++ +LQQLTG NYFFYYGT IF++VG+EDS+QT+++ G+VNFASTFVA
Sbjct: 297 KTKILQRLIMGIMIQSLQQLTGNNYFFYYGTTIFQSVGMEDSYQTAIVLGVVNFASTFVA 356

Query: 370 LYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFI 429
           +YVVDK+GRR CLLWGAA M  CMV+FASVGVTKLWPNG DQP+SK AGN MIVF+CF+I
Sbjct: 357 IYVVDKFGRRKCLLWGAAAMAVCMVIFASVGVTKLWPNGDDQPASKSAGNIMIVFTCFYI 416

Query: 430 FCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYV 489
           F FATTWAPI +VI++E+FPLRVKAKGMA+ T +N +W F IGFFTPFIT AI FYYGYV
Sbjct: 417 FSFATTWAPIAYVIVAETFPLRVKAKGMAIATAANWIWGFLIGFFTPFITTAIKFYYGYV 476

Query: 490 FLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALAT 549
           F+G L+FS+ Y+F FVPETKGL LE+V  MW+EGVLPWKS+ WVP S+R   Y+AEA   
Sbjct: 477 FMGSLIFSFFYIFFFVPETKGLTLEEVEEMWQEGVLPWKSSQWVPASRRDAGYDAEAFKH 536

Query: 550 DDKPIYKRM 558
           D+KP YKRM
Sbjct: 537 DEKPWYKRM 545

>NDAI0K02970 Chr11 (678231..679943) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/558 (65%), Positives = 447/558 (80%)

Query: 5   QSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMV 64
           ++P    V +S + S  S+ S ++ K +  DF+     ++EIP KPASAY+++ I C M+
Sbjct: 13  ETPVEPTVSNSGSQSNMSAPSVKDAKDELNDFDVDQQPVLEIPIKPASAYVTISIFCTMI 72

Query: 65  AFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVV 124
            FGGFISGWDTGTIGGFL+H DY+ RFGS H DGS Y S VRTGL+VSIFN+G  IG + 
Sbjct: 73  GFGGFISGWDTGTIGGFLAHPDYLRRFGSKHHDGSYYFSNVRTGLVVSIFNIGGLIGCLT 132

Query: 125 LGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLI 184
           LG L + +GR+  +V  V I+I+G++IQIASIDKWYQYFIGRII+G+G G I++ SPML+
Sbjct: 133 LGDLANRIGRKMALVAVVIIFIIGLIIQIASIDKWYQYFIGRIISGMGVGAISIFSPMLL 192

Query: 185 SEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGA 244
           SE++PKHLRGTL S YQLM+TFG+FLG CTNYGTK YDNS+QWRVPLGL FAW L MI A
Sbjct: 193 SEVAPKHLRGTLGSMYQLMVTFGIFLGDCTNYGTKAYDNSVQWRVPLGLSFAWCLFMIAA 252

Query: 245 MFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS 304
           MF VPESPRYL+E G++EEAK S+A SNKV+++DP    EI+L+   +EAE+AAGSASW 
Sbjct: 253 MFFVPESPRYLMEVGKVEEAKASIATSNKVSVEDPGVQAEIDLITAGIEAEKAAGSASWM 312

Query: 305 ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFA 364
           ELF  K KV  R  M  ++  LQQLTGCNYFFYYGT++F+AVGL+DS++TS++FGIVNFA
Sbjct: 313 ELFSRKGKVFPRLFMCCMLQTLQQLTGCNYFFYYGTVVFQAVGLKDSYETSIVFGIVNFA 372

Query: 365 STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVF 424
           STFVA YVVD++GRR CL+WGAA MV C VV+ASVGVT+L P+G D P+SKGAGN MIVF
Sbjct: 373 STFVAFYVVDRFGRRRCLMWGAAAMVACYVVYASVGVTRLHPHGDDGPTSKGAGNCMIVF 432

Query: 425 SCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINF 484
           SCFFIFCFA TWAPI ++I+SE+FPLR+K KGMAL    N  WNF I FFTPFITGAINF
Sbjct: 433 SCFFIFCFACTWAPIAWIIVSETFPLRIKPKGMALANGCNWFWNFLISFFTPFITGAINF 492

Query: 485 YYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNA 544
           YYGYVF+GC+VF+Y YVF FVPETKGL LE+VN MWEEG+LPWKS +WVP ++R    + 
Sbjct: 493 YYGYVFMGCMVFAYGYVFFFVPETKGLTLEEVNEMWEEGILPWKSPNWVPSAKRDASMDM 552

Query: 545 EALATDDKPIYKRMFSKN 562
           EAL  DDKP+YKRMFS+N
Sbjct: 553 EALQHDDKPMYKRMFSRN 570

>KNAG0E04270 Chr5 (849856..851529) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/544 (68%), Positives = 449/544 (82%), Gaps = 2/544 (0%)

Query: 19  SVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTI 78
           SV S +S +     + DF+  D    E+PKKPASAY++V I+CLM+AFGG++ GWDTGTI
Sbjct: 15  SVLSHESNKIDDYQTNDFSA-DVAPTEMPKKPASAYVTVSILCLMIAFGGYVYGWDTGTI 73

Query: 79  GGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGI 138
           GGFLSH D++ RFG    DG+ Y S  R GL+V+IFN+GCAIG +   RLGD  GRR  +
Sbjct: 74  GGFLSHEDFLRRFGQKKEDGTYYFSNPRMGLIVAIFNIGCAIGGLAWSRLGDIYGRRLAL 133

Query: 139 VIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVS 198
           V    +Y++G+VI IASIDKWYQYFIGRII+G G G IAV SP+LISE+SPKH+RGTLVS
Sbjct: 134 VWVTIVYMIGLVISIASIDKWYQYFIGRIISGCGVGGIAVYSPLLISEVSPKHVRGTLVS 193

Query: 199 CYQLMITFGMFLGYCTNYGT-KTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVE 257
           CYQLMIT G+FLGYCTNY T   Y NS+QWRVPLGL FAWAL MI AM  VPESPR+L+E
Sbjct: 194 CYQLMITLGIFLGYCTNYATDHHYTNSVQWRVPLGLGFAWALFMIAAMLFVPESPRFLIE 253

Query: 258 KGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRT 317
            G+IEEAK SVA+SNK+T+DDP+ I E+E +   +EAE+ AG+ASW ELF TK K+LQRT
Sbjct: 254 VGKIEEAKVSVARSNKLTVDDPSVIAEVEFLAAGIEAEREAGTASWMELFSTKGKILQRT 313

Query: 318 LMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYG 377
           ++GV++ +LQQLTG NYFF+YGT IF+AVGLEDS+QT+++ G+VNFASTF A+Y V+++G
Sbjct: 314 ILGVMIQSLQQLTGANYFFFYGTQIFQAVGLEDSYQTAIVIGVVNFASTFPAIYFVERFG 373

Query: 378 RRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWA 437
           RRT LLWGAAGM+CC VVFASVGVT+L+PNG+DQPSSKGAGN MI F+CFFIFCFATTWA
Sbjct: 374 RRTGLLWGAAGMICCFVVFASVGVTRLYPNGRDQPSSKGAGNCMICFTCFFIFCFATTWA 433

Query: 438 PIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFS 497
           P  +VI+SESFPLRVKAKGMAL   +N +WNF +GFFTPFITGAINFYYGYVF+GCL FS
Sbjct: 434 PTAYVIVSESFPLRVKAKGMALSIAANWIWNFLLGFFTPFITGAINFYYGYVFMGCLCFS 493

Query: 498 YCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKR 557
           + YVF FVPETKGL LE+VN+MWEEGVLPWKSASWVPPS+R +DY+A+A+A DD P YKR
Sbjct: 494 WVYVFFFVPETKGLSLEEVNIMWEEGVLPWKSASWVPPSKRDSDYDADAMAHDDVPFYKR 553

Query: 558 MFSK 561
           M  K
Sbjct: 554 MLGK 557

>SAKL0B12540g Chr2 complement(1075772..1077490) [1719 bp, 572 aa]
           {ON} highly similar to uniprot|P39003 Saccharomyces
           cerevisiae YDR343C HXT6 High-affinity glucose
           transporter of the major facilitator superfamily nearly
           identical to Hxt7p expressed at high basal levels
           relative to other HXTs repression of expression by high
           glucose requires SNF3
          Length = 572

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/563 (65%), Positives = 454/563 (80%), Gaps = 5/563 (0%)

Query: 1   MDYSQSPTGEDVHSSTAG----SVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLS 56
           ++ +   T  D+HS+ +     S  S+++ ++  KD +   E   ++ EIP KP SAY++
Sbjct: 9   LEAAGQDTPVDLHSNLSEVSQLSTPSNKASRDDLKDVRFPEEATEKVNEIPAKPTSAYIT 68

Query: 57  VCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFN 115
           VC++CL VAFGGF+ GWDTGTI GF++ +D+  RFG  +H  G  YLS VRTGLLV IFN
Sbjct: 69  VCLLCLCVAFGGFVFGWDTGTISGFVNQTDFKRRFGQHNHKTGGYYLSNVRTGLLVGIFN 128

Query: 116 VGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGT 175
           +GCAIG ++L ++GD  GRR G++  + +Y+V ++I IA+ DKWYQYFIGRII+GLG G 
Sbjct: 129 IGCAIGGIILSKIGDLYGRRIGLMSVILVYVVSVIISIAASDKWYQYFIGRIISGLGVGG 188

Query: 176 IAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCF 235
           IAVL+PMLISE +PKHLRGTLVSCYQLMIT G+FLGYCTNYGTK YDNS+QWRVPLGL F
Sbjct: 189 IAVLAPMLISETAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKNYDNSVQWRVPLGLGF 248

Query: 236 AWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAE 295
           AWAL +I  M  VPESPRYLVE G+IEEA+RSVA+SNKVTI+DP    E++L+   VEAE
Sbjct: 249 AWALFVIAGMMFVPESPRYLVEVGKIEEARRSVARSNKVTIEDPGVQAEVDLITAGVEAE 308

Query: 296 QAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTS 355
           + +GSASWSELF TKTKVLQR +MG ++  LQQLTG NYFFYYGT IFK+VGL DSFQTS
Sbjct: 309 KLSGSASWSELFSTKTKVLQRLIMGAMLQCLQQLTGNNYFFYYGTTIFKSVGLTDSFQTS 368

Query: 356 LIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSK 415
           ++ G+VNFASTFV +YVV+K+GRR CLLWGAA M+ CMVV+ASVGVT+LWPNG+DQPSSK
Sbjct: 369 IVIGVVNFASTFVGIYVVEKFGRRKCLLWGAASMMVCMVVYASVGVTRLWPNGEDQPSSK 428

Query: 416 GAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFT 475
           GAGN MIVF+CF+IFC+ATTWAPI +V+ +ESFPLRVK+K MA+ + SN +W F I FFT
Sbjct: 429 GAGNCMIVFTCFYIFCYATTWAPIAWVVTAESFPLRVKSKCMAIASASNWIWGFLIAFFT 488

Query: 476 PFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPP 535
           PFIT AINFYYGYVF+GCLVF Y YVF FVPETKGL LE++  +WEEGVLPWKSASWVPP
Sbjct: 489 PFITSAINFYYGYVFMGCLVFMYFYVFFFVPETKGLTLEEIQELWEEGVLPWKSASWVPP 548

Query: 536 SQRGTDYNAEALATDDKPIYKRM 558
           S+R   Y+ EAL  DDKP YKR+
Sbjct: 549 SKRDKGYDVEALQHDDKPWYKRV 571

>YLR081W Chr12 (290212..291936) [1725 bp, 574 aa] {ON}
           GAL2Galactose permease, required for utilization of
           galactose; also able to transport glucose
          Length = 574

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/563 (64%), Positives = 444/563 (78%), Gaps = 6/563 (1%)

Query: 4   SQSP-TGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQ-----IIEIPKKPASAYLSV 57
           SQ P  GEDV SS +   H S   Q+   D     E  S+      IEIPKKP S Y++V
Sbjct: 12  SQQPQAGEDVISSLSKDSHLSAQSQKYSNDELKAGESGSEGSQSVPIEIPKKPMSEYVTV 71

Query: 58  CIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVG 117
            ++CL VAFGGF+ GWDTGTI GF+  +D++ RFG  H DG+ YLS VRTGL+V+IFN+G
Sbjct: 72  SLLCLCVAFGGFMFGWDTGTISGFVVQTDFLRRFGMKHKDGTHYLSNVRTGLIVAIFNIG 131

Query: 118 CAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIA 177
           CA G ++L + GD  GR+KG+ I V +YIVGI+IQIASI+KWYQYFIGRII+GLG G IA
Sbjct: 132 CAFGGIILSKGGDMYGRKKGLSIVVSVYIVGIIIQIASINKWYQYFIGRIISGLGVGGIA 191

Query: 178 VLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAW 237
           VL PMLISEI+PKHLRGTLVSCYQLMIT G+FLGYCTNYGTK+Y NS+QWRVPLGLCFAW
Sbjct: 192 VLCPMLISEIAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKSYSNSVQWRVPLGLCFAW 251

Query: 238 ALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQA 297
           +L MIGA+ +VPESPRYL E  ++E+AKRS+AKSNKV+ +DPA   E++L+   +EAE+ 
Sbjct: 252 SLFMIGALTLVPESPRYLCEVNKVEDAKRSIAKSNKVSPEDPAVQAELDLIMAGIEAEKL 311

Query: 298 AGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLI 357
           AG+ASW ELF TKTKV QR LMGV V   QQLTG NYFFYYGT+IFK+VGL+DSF+TS++
Sbjct: 312 AGNASWGELFSTKTKVFQRLLMGVFVQMFQQLTGNNYFFYYGTVIFKSVGLDDSFETSIV 371

Query: 358 FGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGA 417
            G+VNFASTF +L+ V+  G R CLL GAA M+ CMV++ASVGVT+L+P+G+ QPSSKGA
Sbjct: 372 IGVVNFASTFFSLWTVENLGHRKCLLLGAATMMACMVIYASVGVTRLYPHGKSQPSSKGA 431

Query: 418 GNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPF 477
           GN MIVF+CF+IFC+ATTWAP+ +VI +ESFPLRVK+K MAL + SN +W F I FFTPF
Sbjct: 432 GNCMIVFTCFYIFCYATTWAPVAWVITAESFPLRVKSKCMALASASNWVWGFLIAFFTPF 491

Query: 478 ITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQ 537
           IT AINFYYGYVF+GCLV  + YVF FVPETKGL LE++  +WEEGVLPWKS  W+P S+
Sbjct: 492 ITSAINFYYGYVFMGCLVAMFFYVFFFVPETKGLSLEEIQELWEEGVLPWKSEGWIPSSR 551

Query: 538 RGTDYNAEALATDDKPIYKRMFS 560
           RG +Y+ E L  DDKP YK M  
Sbjct: 552 RGNNYDLEDLQHDDKPWYKAMLE 574

>Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/558 (63%), Positives = 437/558 (78%), Gaps = 9/558 (1%)

Query: 5   QSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMV 64
            SP  + V S ++         +E+++++ +         ++  K  S  L V I CLMV
Sbjct: 43  DSPQVKPVSSYSSHGGPPKDELEELQREADN---------QLETKSKSDLLFVSICCLMV 93

Query: 65  AFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVV 124
           AFGGF+ GWDTGTI GF+  +DYI RFG++ ++G+ YLS VRTGLLVSIFN+GCAIG +V
Sbjct: 94  AFGGFVFGWDTGTISGFVRQTDYIRRFGTTRANGTSYLSNVRTGLLVSIFNIGCAIGGIV 153

Query: 125 LGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLI 184
           L RLGD  GR+ G+VI V IY VGI+IQIASIDKWYQYFIGRII+GLG G I VLSPMLI
Sbjct: 154 LSRLGDMYGRKIGLVIVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVGGITVLSPMLI 213

Query: 185 SEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGA 244
           SE+SPK LRGTLVSCYQLMITFG+FLGYCTN+GTK Y NS+QWRVPLGLCFAW++ MI  
Sbjct: 214 SEVSPKQLRGTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWSIFMIFG 273

Query: 245 MFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS 304
           M  VPESPRYLVE G+++EAKR++A+ NK T D P    E+E  Q ++EAE+ AGSASW 
Sbjct: 274 MSFVPESPRYLVEVGKMDEAKRALARVNKTTEDSPLVTLEMENYQSSIEAERLAGSASWG 333

Query: 305 ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFA 364
           EL   K ++L+RT+MG+++ +LQQLTG NYFFYYGT IF+AVGL DSF+T+++ G+VNF 
Sbjct: 334 ELVTGKPQMLRRTIMGMMIQSLQQLTGDNYFFYYGTTIFQAVGLSDSFETAIVLGVVNFV 393

Query: 365 STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVF 424
           STF +LY VD++GRR CLLWG  GM+CC VV+ASVGVT+LWPNGQ QPSSKGAGN MIVF
Sbjct: 394 STFFSLYTVDRFGRRNCLLWGCVGMICCYVVYASVGVTRLWPNGQSQPSSKGAGNCMIVF 453

Query: 425 SCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINF 484
           +CF+IFCFATTWAP+ +V+ISES+PLRV+ K M++ +  N +W F I FFTPFIT AINF
Sbjct: 454 ACFYIFCFATTWAPVAYVLISESYPLRVRGKAMSIASACNWIWGFLISFFTPFITSAINF 513

Query: 485 YYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNA 544
           YYGYVF+GC+VF+Y YVF FVPETKGL LE+VN M+EE VLPWKS  WVPPS+R  DY+ 
Sbjct: 514 YYGYVFMGCMVFAYIYVFFFVPETKGLTLEEVNEMYEENVLPWKSTKWVPPSRRTEDYDL 573

Query: 545 EALATDDKPIYKRMFSKN 562
            A   D +P YKRMF+K 
Sbjct: 574 NAARNDSRPFYKRMFTKE 591

>SAKL0G19844g Chr7 (1708176..1709894) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011W HXT2 High-affinity glucose transporter of the
           major facilitator superfamily expression is induced by
           low levels of glucose and repressed by high levels of
           glucose
          Length = 572

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/549 (66%), Positives = 443/549 (80%), Gaps = 1/549 (0%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
           +D  S+   ++ +S    +  +D  D    +    EIP+K  S Y+ V  +CLMVAFGGF
Sbjct: 22  KDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQKKLSEYILVMCLCLMVAFGGF 81

Query: 70  ISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRL 128
           + GWDTGTI GF++ +D+  RFG+ S S+G+ YLS VRTGL+V+IFN+GCA G + LGRL
Sbjct: 82  VFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRL 141

Query: 129 GDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEIS 188
           GD  GRR G++  V +Y+VGI+IQIA+ DKWYQYFIGRII+GLG G IAVLSP LISE +
Sbjct: 142 GDIYGRRLGLMCVVCVYVVGIIIQIATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETA 201

Query: 189 PKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIV 248
           PKHLRGT V+ YQLMIT G+FLGYCTNYGTKTY NS+QWRVPLG+CFAWA+ MI  M +V
Sbjct: 202 PKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLV 261

Query: 249 PESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQ 308
           PESPR+L+EKG+ EEA+RS+AKSNK+T++DP    E+EL+   VEAE+ AGSA+W ELF 
Sbjct: 262 PESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFS 321

Query: 309 TKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFV 368
           +K K+LQR +MGV++ +LQQLTG NYFFYYGT IF+AVG++DSFQTS++ GIVNFASTFV
Sbjct: 322 SKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFV 381

Query: 369 ALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFF 428
            L+ V+K+GRR CLLWG+A M  C VVFASVGVT+LWPNGQDQPSSKGAGN MIVF+CFF
Sbjct: 382 GLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVFTCFF 441

Query: 429 IFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGY 488
           IFCFATTWAPI +VI+SES+PLRVK + MA+   SN +W F IGFFTPFIT AINFYYGY
Sbjct: 442 IFCFATTWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGY 501

Query: 489 VFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALA 548
           VF+GCLVFSY YVF FV ETKGL LE+VN M+EEGVLPWKS SW+P  +RGTDYN E   
Sbjct: 502 VFMGCLVFSYFYVFFFVCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAH 561

Query: 549 TDDKPIYKR 557
           TDDKP+YKR
Sbjct: 562 TDDKPLYKR 570

>TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/503 (69%), Positives = 422/503 (83%), Gaps = 1/503 (0%)

Query: 60  MCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCA 119
           MC+MVAFGG+ISGW +GTIGGF SH+D++ RFGS+   G +YLSKVRTGLL S+FNVG A
Sbjct: 1   MCVMVAFGGYISGWASGTIGGFESHTDFLARFGSTSGSGKRYLSKVRTGLLTSMFNVGQA 60

Query: 120 IGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVL 179
           I    LGR+GD  GRR GI++A  I+IVG VIQI S+  WYQY IGRI+AGLG G IA+L
Sbjct: 61  IDCFFLGRIGDMYGRRFGIIVASIIFIVGTVIQIVSVKAWYQYMIGRIVAGLGCGLIAIL 120

Query: 180 SPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWAL 239
           SPMLISE+SPKH+RG +VSCYQLMIT G+ LGY +NYGTK YD+S QWRVPLGL FAW L
Sbjct: 121 SPMLISEVSPKHMRGAMVSCYQLMITLGILLGYGSNYGTKRYDDSRQWRVPLGLQFAWCL 180

Query: 240 VMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAG 299
            ++GAM  VPESPR+L+EKG+ ++ KRS+AKSNKV+ DDPA I E + +Q A++ E+A  
Sbjct: 181 FLVGAMLFVPESPRFLIEKGRYKDGKRSIAKSNKVSPDDPAVIMEADEIQAAIDRERAED 240

Query: 300 SASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFG 359
            A+W +L  TK K+LQR + G+++LALQQLTGCNYFFYYGTIIFKAVGLED ++T++IFG
Sbjct: 241 EATWGDLLDTKHKILQRVINGIMLLALQQLTGCNYFFYYGTIIFKAVGLEDGYETAIIFG 300

Query: 360 IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSKGAG 418
           +VNF STFVALY+VD++GRR CLLWGAAGM CCMVVFASVGV++LWP G+    +S+GAG
Sbjct: 301 VVNFFSTFVALYLVDRFGRRACLLWGAAGMTCCMVVFASVGVSRLWPKGKKAGITSQGAG 360

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MIVFSCFF+FCFAT+WAP+ FVIISESFPL+VKAKGMAL  VSNQMWNFCIGFFTPFI
Sbjct: 361 NCMIVFSCFFLFCFATSWAPVAFVIISESFPLKVKAKGMALAIVSNQMWNFCIGFFTPFI 420

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           TGAINF YGYVF+GCLVF++ YVF FVPETKG+ LEDVN+MWEEGVLPWK ASWVPPS R
Sbjct: 421 TGAINFAYGYVFVGCLVFAWFYVFFFVPETKGMVLEDVNVMWEEGVLPWKPASWVPPSDR 480

Query: 539 GTDYNAEALATDDKPIYKRMFSK 561
              Y+  A+A D +P++K+MF K
Sbjct: 481 DATYDVNAMANDYQPVWKKMFGK 503

>TBLA0A03420 Chr1 (824716..826449) [1734 bp, 577 aa] {ON} 
          Length = 577

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/537 (67%), Positives = 438/537 (81%), Gaps = 2/537 (0%)

Query: 22  SSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGF 81
           S +   ++K+DS D  E  SQ + IPKKPASAY++V ++C+M+AFGGFI G+DTGTIGGF
Sbjct: 27  SGKEADDIKEDSLDLQE-SSQELVIPKKPASAYVTVSLVCIMIAFGGFIPGYDTGTIGGF 85

Query: 82  LSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIA 141
            SH+D++ RFGS   DG+ YL +VR GLL ++ N+G A G   LGR+GD  GRR GIV A
Sbjct: 86  ESHTDFLRRFGSLRKDGTHYLPRVRAGLLTAMQNIGQACGCFFLGRVGDLYGRRIGIVFA 145

Query: 142 VFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQ 201
             I+IVG +IQIAS+  WYQY IGRI+AG+G G   VL PMLISE+SPKHLRG LVSCYQ
Sbjct: 146 TTIFIVGTIIQIASVKAWYQYMIGRIVAGVGCGLFPVLCPMLISEVSPKHLRGALVSCYQ 205

Query: 202 LMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQI 261
           LM+T G+FLG CTNYGTK Y +S QWR+ LGL FAWAL +I AM  VPESPRYL+EKG++
Sbjct: 206 LMVTMGIFLGDCTNYGTKVYHDSRQWRIGLGLQFAWALFLITAMLFVPESPRYLIEKGRL 265

Query: 262 EEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGV 321
           E+AKRS+AKSNKV+ DDPA I E + +Q A+  E+A G A+W +L  TK  +LQR L  +
Sbjct: 266 EDAKRSLAKSNKVSADDPAIIVEADHIQAAIAKEEAEGKAAWRDLLDTKHFILQRVLNSI 325

Query: 322 IVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTC 381
           +VLALQQLTG NYFFYYGT IFKAVGL+D +QT+++FG+VNF STF+ALYVV+K GRRT 
Sbjct: 326 MVLALQQLTGANYFFYYGTTIFKAVGLQDGYQTAIVFGVVNFFSTFIALYVVEKAGRRTG 385

Query: 382 LLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSKGAGNTMIVFSCFFIFCFATTWAPIP 440
           LLWGAA M+CCM VFASVGVT+LWP G+    SSKGAGN MIVFSCFFIFCFATTWAPI 
Sbjct: 386 LLWGAAAMICCMCVFASVGVTRLWPEGKKAGISSKGAGNCMIVFSCFFIFCFATTWAPIA 445

Query: 441 FVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCY 500
            VII+ESFPLRVK+KGMAL TVSNQ+WNFC+GFFTPFI GAINFYYGYVF+GCLVFS+ +
Sbjct: 446 HVIIAESFPLRVKSKGMALATVSNQLWNFCVGFFTPFIAGAINFYYGYVFMGCLVFSWFF 505

Query: 501 VFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKR 557
           VF F+PETKG+ LED+N+MWEEG LPWKSA+WVPPS+RG DY+  A+A DD+P++K+
Sbjct: 506 VFFFIPETKGMVLEDINVMWEEGTLPWKSANWVPPSERGADYDVNAMANDDQPVWKK 562

>CAGL0A01782g Chr1 complement(175018..176724) [1707 bp, 568 aa] {ON}
           highly similar to uniprot|P39003 Saccharomyces
           cerevisiae YDR343c HXT6 or uniprot|P39004 Saccharomyces
           cerevisiae YDR342c HXT7
          Length = 568

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/552 (67%), Positives = 454/552 (82%), Gaps = 2/552 (0%)

Query: 6   SPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVA 65
           SP  +   S +     +S    ++KK  ++  +  + I++IPKKPASAY++V I CL +A
Sbjct: 17  SPENDFSPSLSQQDSSASPYENDVKKLEEEAEQ--TPIVDIPKKPASAYVTVSIFCLFIA 74

Query: 66  FGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVL 125
           FGGF+ GWDTGTI GF++ +D+I R G   ++G+ YLSKVRTGL+VSIFN+GCAIG V+L
Sbjct: 75  FGGFVFGWDTGTISGFVAQTDFIRRLGQKRANGTHYLSKVRTGLVVSIFNIGCAIGGVIL 134

Query: 126 GRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLIS 185
            +LGD  GR+ G++I V IY+VGI+IQIA+IDKWYQYFIGRII+GLG G IAVLSPMLIS
Sbjct: 135 SKLGDVYGRKPGLIIVVVIYVVGIIIQIATIDKWYQYFIGRIISGLGVGGIAVLSPMLIS 194

Query: 186 EISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAM 245
           E+SPKHLR TLV+CYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWA+ MI  M
Sbjct: 195 EVSPKHLRATLVACYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWAIFMISGM 254

Query: 246 FIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSE 305
             VPESPR+LVEKG+IE+AKRS+A SNKV++DDPA + E++ VQ AVEAE+ AGSASW E
Sbjct: 255 TFVPESPRFLVEKGRIEDAKRSIASSNKVSVDDPAVVAEVDSVQAAVEAERLAGSASWGE 314

Query: 306 LFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAS 365
           LF TKTK+ QR +MG+++ +LQQLTG NYFFYYGTI+FKAVGLEDSF+TS++ G+VNF S
Sbjct: 315 LFSTKTKIFQRLVMGIMIQSLQQLTGDNYFFYYGTIVFKAVGLEDSFETSIVIGVVNFFS 374

Query: 366 TFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFS 425
           TFV +++V ++GRRTCLLWGAA M  CMVVFASVGVT+LWP+G+   SSKGAGN MIVF+
Sbjct: 375 TFVGIFLVGRFGRRTCLLWGAATMTACMVVFASVGVTRLWPHGKGNGSSKGAGNCMIVFT 434

Query: 426 CFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFY 485
           CF+IFCFATTWAP+ FVI SE+FPLRVKAK MAL   SN +W F I FFTPFIT AINF 
Sbjct: 435 CFYIFCFATTWAPLAFVICSETFPLRVKAKCMALAQASNWIWGFLISFFTPFITDAINFN 494

Query: 486 YGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAE 545
           YGYVF+GCL FSY YVF FVPETKGL LE+VN MWEEGVLPWK++ WVPPS+RG DY+A+
Sbjct: 495 YGYVFMGCLCFSYFYVFFFVPETKGLTLEEVNTMWEEGVLPWKASQWVPPSRRGADYDAD 554

Query: 546 ALATDDKPIYKR 557
           AL  DD P YKR
Sbjct: 555 ALMHDDTPWYKR 566

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/566 (65%), Positives = 456/566 (80%), Gaps = 12/566 (2%)

Query: 7   PTGEDVHS-----STAGSVHSSQSFQEMKKDSQDFNEIDSQIIE-----IPKKPASAYLS 56
           P    +HS     S   SV SS S +E+  D +   E +S+  E      P  P+     
Sbjct: 14  PVRATMHSNELSYSDGHSVLSSPSNKELD-DMKGEGEFNSETEEHSPVSPPPAPSGTNWG 72

Query: 57  VCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNV 116
           VCI+CL+VAFGG+ISGWD+GTIGGF + +D++ RFGS+ SDG++YLSKVRTGLL S+FNV
Sbjct: 73  VCILCLLVAFGGYISGWDSGTIGGFEAQTDFLARFGSTSSDGTRYLSKVRTGLLTSMFNV 132

Query: 117 GCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTI 176
           G AIGS  LGRLGD  GRR G+++A  I+I G +IQIASI  WYQY IGRI+AGLG G I
Sbjct: 133 GQAIGSFFLGRLGDIYGRRIGLIVASVIFIAGTIIQIASIKAWYQYMIGRIVAGLGCGLI 192

Query: 177 AVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFA 236
           A+LSPMLISE+SPK++RG +VSCYQLMIT G+FLGYCTNYGTK Y +S QWRV LGL FA
Sbjct: 193 AILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKRYHDSTQWRVGLGLQFA 252

Query: 237 WALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQ 296
           W L+MIGAM  VPESPR+LVEKG+IEEAKRS+ KSN V+ DDP T+ E++ +Q+ V+ E+
Sbjct: 253 WCLLMIGAMLFVPESPRFLVEKGRIEEAKRSIGKSNGVSPDDPVTLWELDEIQVVVDKER 312

Query: 297 AAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSL 356
           A G A WS+LF ++TKVLQR +MG++++ALQQLTG NYFFYYGT IF+AVG++D F+ ++
Sbjct: 313 AEGEAGWSDLFDSQTKVLQRVIMGIMIMALQQLTGANYFFYYGTTIFQAVGMQDGFEAAI 372

Query: 357 IFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQD-QPSSK 415
           +FG+VNF ST  +L  VD  GRRTCLLWGAAGM CCMVVFASVGVT+LWP G++   +S+
Sbjct: 373 VFGVVNFFSTCCSLLFVDSLGRRTCLLWGAAGMTCCMVVFASVGVTRLWPKGKNGGETSQ 432

Query: 416 GAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFT 475
           GAGN MI FSCFF+FCFAT+WAP+ FVIISESFPL+VKAKGMAL TVSNQMWNFCIGFFT
Sbjct: 433 GAGNCMICFSCFFLFCFATSWAPVAFVIISESFPLKVKAKGMALATVSNQMWNFCIGFFT 492

Query: 476 PFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPP 535
           PFI+GAINF YGYVF+GCLVF++ YVF FVPETKGL LEDV++MW+EGVLPWKSASWVPP
Sbjct: 493 PFISGAINFAYGYVFMGCLVFAWFYVFFFVPETKGLVLEDVDVMWQEGVLPWKSASWVPP 552

Query: 536 SQRGTDYNAEALATDDKPIYKRMFSK 561
           SQRG DY+  A+A DD P++K++F K
Sbjct: 553 SQRGADYDVAAMANDDTPVWKKLFGK 578

>KLTH0E02772g Chr5 (252118..253833) [1716 bp, 571 aa] {ON} highly
           similar to uniprot|P39003 Saccharomyces cerevisiae
           YDR343C HXT6 High-affinity glucose transporter of the
           major facilitator superfamily nearly identical to Hxt7p
           expressed at high basal levels relative to other HXTs
           repression of expression by high glucose requires SNF3
          Length = 571

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/562 (66%), Positives = 453/562 (80%), Gaps = 5/562 (0%)

Query: 2   DYSQSPTGEDVHSSTAGSVHSSQSFQEMKKD---SQDFNEIDSQIIEIPKKPASAYLSVC 58
           + + + T  D+HS+ +     S    +  +D   + +  E  +  +EIPKKPASAY++V 
Sbjct: 9   ETAATATPVDLHSTVSNGSQLSTPSNKASRDELKAANMAEDAADQVEIPKKPASAYVTVV 68

Query: 59  IMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGC 118
           I+CLMVAFGGF+ GWDTGTI GF++ SD++ RFG  HSDG+ YLS VR GL+V+IFN+GC
Sbjct: 69  ILCLMVAFGGFVFGWDTGTISGFVNQSDFLRRFGQKHSDGTHYLSNVRMGLIVAIFNIGC 128

Query: 119 AIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAV 178
           A G ++L ++GD  GRR G++  V IY+VGI+IQIASIDKWYQYFIGRII+GLG G IAV
Sbjct: 129 AFGGIILSKIGDVYGRRIGLMAVVVIYVVGIIIQIASIDKWYQYFIGRIISGLGVGGIAV 188

Query: 179 LSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWA 238
           LSPMLISE +PKHLRG +V+CYQLMIT G+FLGYCTNYG K Y NS+QWRVPLGLCFAWA
Sbjct: 189 LSPMLISETAPKHLRGAMVACYQLMITAGIFLGYCTNYGVKNYSNSVQWRVPLGLCFAWA 248

Query: 239 LVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAA 298
           L MI  M  VPESPRYL+E G+IE+AKRS+AKSNKVT++DPA + E++L+   VEAE+ A
Sbjct: 249 LFMITGMSFVPESPRYLIENGRIEDAKRSLAKSNKVTVEDPAILVEVDLILAGVEAERLA 308

Query: 299 GSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIF 358
           GSAS  ELF TKTKVLQR +MG+++ +LQQLTG NYFFYYGT IFKAVGL DSFQTS++ 
Sbjct: 309 GSASIKELFSTKTKVLQRLIMGIMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFQTSIVI 368

Query: 359 GIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSKG 416
           GIVNFASTFV+L  V+K+GRR C+LWG+A MV C VV+ASVGVTKL+PNG D P  ++KG
Sbjct: 369 GIVNFASTFVSLVTVEKFGRRGCMLWGSAAMVACFVVYASVGVTKLYPNGADHPEVTNKG 428

Query: 417 AGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTP 476
           AGN MI F+CF+IFCFATTWAPI +V++SESFPLRVK+K MA+ T SN +W F I FFTP
Sbjct: 429 AGNCMICFTCFYIFCFATTWAPIAYVVVSESFPLRVKSKCMAIATASNWLWGFLIAFFTP 488

Query: 477 FITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPS 536
           FIT AI+FYYGYVF+GCLVF+Y YVF FVPETKGL LE+V  +WEEGVLPWKS SWVP S
Sbjct: 489 FITSAIHFYYGYVFMGCLVFAYFYVFFFVPETKGLTLEEVQELWEEGVLPWKSTSWVPSS 548

Query: 537 QRGTDYNAEALATDDKPIYKRM 558
           +RG DYN E L  DDKP Y+R+
Sbjct: 549 RRGKDYNVEELKHDDKPWYRRV 570

>Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)
          Length = 569

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/551 (64%), Positives = 450/551 (81%), Gaps = 1/551 (0%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
           ++  SS   S H S    E  KDS ++N  +++ I +P+KPASAY++V IMCL +AFGGF
Sbjct: 19  DNSRSSAENSSHLSAPTVEENKDSSEYNGEEAEEIVLPEKPASAYVTVSIMCLCMAFGGF 78

Query: 70  ISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRL 128
           +SGWDTGTI GF++ +D++ RFG+ +HS  + YLS VRTGL+VSIFNVG AIG + L +L
Sbjct: 79  MSGWDTGTISGFVNQTDFLRRFGNYNHSKDTYYLSNVRTGLIVSIFNVGSAIGCLFLSKL 138

Query: 129 GDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEIS 188
           GD  GR  G++I + +Y+VGI+IQIAS+DKWYQYFIGRIIAG+G+G+I+VL+PMLISE +
Sbjct: 139 GDIYGRCMGLIIVIVVYMVGIIIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETA 198

Query: 189 PKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIV 248
           PK +RGTL++C+QLM+TF +FLGYCTNYGTK+Y NS+QWRVPLGLCFAWA++MIG M  V
Sbjct: 199 PKQIRGTLLACWQLMVTFAIFLGYCTNYGTKSYSNSVQWRVPLGLCFAWAIIMIGGMMFV 258

Query: 249 PESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQ 308
           PESPR+LV+  + E+A+ S AKSNK+++DDPA I EI+L+   VEAE+A G+ASW ELF 
Sbjct: 259 PESPRFLVQVKKTEQARASFAKSNKLSVDDPAVIAEIDLLVAGVEAEEAMGTASWKELFS 318

Query: 309 TKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFV 368
           TKTKV QR  M V++ +LQQLTG NYFFYYGT IFK+VG+ DSF+TS++ GIVNFAS F 
Sbjct: 319 TKTKVFQRLSMTVMINSLQQLTGDNYFFYYGTTIFKSVGMTDSFETSIVLGIVNFASCFF 378

Query: 369 ALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFF 428
           +LY VDK GRR CLL GAA M  CMV++ASVGVTKL+PNG++QPSSKGAGN MIVF+CF+
Sbjct: 379 SLYSVDKLGRRKCLLLGAATMTACMVIYASVGVTKLYPNGKNQPSSKGAGNCMIVFTCFY 438

Query: 429 IFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGY 488
           IFCF+ TW P+ +VIISE+FP+RV++K M++ T +N +W F IGFFTPFIT AI+FYYGY
Sbjct: 439 IFCFSCTWGPVCYVIISETFPIRVRSKCMSVATAANLLWGFLIGFFTPFITSAIDFYYGY 498

Query: 489 VFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALA 548
           VF+GCL FSY YVF FVPETKGL LE+V+ MW +GVLPWKS SWVP S+R  DY+ E L 
Sbjct: 499 VFMGCLAFSYFYVFFFVPETKGLSLEEVDEMWIDGVLPWKSTSWVPASRRNADYDNEKLQ 558

Query: 549 TDDKPIYKRMF 559
            D+KP+YKR+F
Sbjct: 559 HDEKPLYKRLF 569

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/548 (66%), Positives = 444/548 (81%), Gaps = 1/548 (0%)

Query: 15  STAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWD 74
           S A S  SS S +E+     +F+  ++  +  P  P      VCI+CLMVAFGG+ISGWD
Sbjct: 21  SDAHSAISSPSNKEIDDMKDEFHSEEATPMTPPPAPTGTNWGVCILCLMVAFGGYISGWD 80

Query: 75  TGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGR 134
           +GTIGGF + +D++ RFGS+   G +YLSKVRTGLL S+FNVG AIGS  LGRLGD  GR
Sbjct: 81  SGTIGGFEAQTDFLARFGSTSGSGKRYLSKVRTGLLTSMFNVGQAIGSFFLGRLGDIYGR 140

Query: 135 RKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRG 194
           R G+++A FI+IVG VIQIAS+  WYQY IGRI+AGLG G IA+LSPMLISE+SPK++RG
Sbjct: 141 RIGLIVASFIFIVGTVIQIASVKAWYQYMIGRIVAGLGCGLIAILSPMLISEVSPKNMRG 200

Query: 195 TLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRY 254
            +VSCYQLMIT G+FLGYCTNYGTK Y +S QWRV LGL FAW L MI AM  VPESPR+
Sbjct: 201 AMVSCYQLMITLGIFLGYCTNYGTKRYHDSTQWRVGLGLQFAWCLCMIVAMLFVPESPRF 260

Query: 255 LVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVL 314
           LVEKG+IEEAKRS+ KSN V+ DDP T+ E++ +Q  V+ E+A G A WS+LF ++TK+L
Sbjct: 261 LVEKGRIEEAKRSIGKSNGVSPDDPVTLWELDEIQAVVDKERAQGEAGWSDLFDSQTKIL 320

Query: 315 QRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVD 374
           QR +MG++++ALQQLTG NYFFYYGT IF+AVG++D F+ +++FG+VNF ST  +L  VD
Sbjct: 321 QRVIMGIMIMALQQLTGANYFFYYGTTIFQAVGMQDGFEAAIVFGVVNFFSTCCSLLFVD 380

Query: 375 KYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQD-QPSSKGAGNTMIVFSCFFIFCFA 433
             GRRTCLLWGAAGM CCMVVFASVGVT+LWP G++   +S+GAGN MI FSCFF+FCFA
Sbjct: 381 SLGRRTCLLWGAAGMTCCMVVFASVGVTRLWPKGKNGGETSQGAGNCMICFSCFFLFCFA 440

Query: 434 TTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGC 493
           T+WAP+ FVIISESFPL+VKAKGMAL  VSNQMWNFCIGFFTPFI+G+INF YGYVF+GC
Sbjct: 441 TSWAPVAFVIISESFPLKVKAKGMALAIVSNQMWNFCIGFFTPFISGSINFAYGYVFMGC 500

Query: 494 LVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKP 553
           LVF++ YVF FVPETKGLQLEDV+LMW EG LPWKSASWVPPS+RG DY+ +A+A DD P
Sbjct: 501 LVFAWFYVFFFVPETKGLQLEDVDLMWREGTLPWKSASWVPPSERGADYDVDAMANDDTP 560

Query: 554 IYKRMFSK 561
            +K+MF K
Sbjct: 561 AWKKMFGK 568

>TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.395
           YHR094C
          Length = 571

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/561 (63%), Positives = 449/561 (80%), Gaps = 5/561 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPAS--AYLSVCIMC 61
           + S +  ++ S+ +  +++ +  +   +D  D + I ++  E+PK   S  AY+S C+ C
Sbjct: 14  TSSNSNGELESNGSKYMNTPEGKKGEGRD--DLSNIKNEP-EVPKPDNSRTAYISTCLCC 70

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           +MVAFGGF+ GWDTGTI GF++ SD++ RFG  +S+G  YLSKVR GL+V+IFNVGCAIG
Sbjct: 71  IMVAFGGFVFGWDTGTISGFVNQSDFLRRFGQVNSEGEHYLSKVRMGLIVAIFNVGCAIG 130

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
            ++L R+GD  GRR G++  V IY+VGI+IQI S DKWYQYFIGRII+GLG G I+VLSP
Sbjct: 131 GIILSRIGDVYGRRVGLITVVIIYVVGILIQICSFDKWYQYFIGRIISGLGVGGISVLSP 190

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           MLISE+SPK +RG +VS YQLMIT G+FLGYC NYGTKTY +S QWRVPLGLCFAWAL M
Sbjct: 191 MLISEVSPKEMRGAMVSSYQLMITLGIFLGYCCNYGTKTYSDSTQWRVPLGLCFAWALFM 250

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
           IG M  VPESPRYL+E G+ +EA+RS+A+ NK  ID   T  E +L++ ++E  +AAGSA
Sbjct: 251 IGGMLFVPESPRYLIEAGKHDEARRSLARVNKCPIDSAFTQHEFDLIEASIEEMKAAGSA 310

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           SW ELF  K  + +RT+MG+++ +LQQLTG NYFFYYGT +FKAVG+EDSF+TS++FGIV
Sbjct: 311 SWGELFTGKPAMCRRTIMGIMIQSLQQLTGDNYFFYYGTTVFKAVGMEDSFETSIVFGIV 370

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           NFA T ++LY VDK+GRR CLLWG  GMVCC VV+ASVGVT+LWP+GQDQPSSKGAGN M
Sbjct: 371 NFACTALSLYTVDKFGRRKCLLWGCIGMVCCYVVYASVGVTRLWPDGQDQPSSKGAGNCM 430

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           IVF+CF+IFCFATTWAPI +VIISESFPLR+K+K M++ + SN +W F I FFTPFITGA
Sbjct: 431 IVFACFYIFCFATTWAPIAYVIISESFPLRIKSKAMSIASASNWLWGFLIAFFTPFITGA 490

Query: 482 INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTD 541
           INFYYGYVF+GC+VF+Y YVF FVPETKGL LE+VN M+ EGVLPWKS+ WVP S+RG D
Sbjct: 491 INFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYAEGVLPWKSSGWVPASRRGAD 550

Query: 542 YNAEALATDDKPIYKRMFSKN 562
           Y+AE +  DD+P YKRMF KN
Sbjct: 551 YDAEFMLHDDQPFYKRMFGKN 571

>TDEL0E00200 Chr5 complement(25701..27407) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/550 (66%), Positives = 442/550 (80%), Gaps = 2/550 (0%)

Query: 10  EDVHSSTA-GSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGG 68
           + VHS  +  S   ++   E+K    + +E  + + ++P KP SAYL+ C++CL VAFGG
Sbjct: 19  QPVHSDVSRASTPINKVLDELKNGELNPDEALNSV-DLPVKPFSAYLTTCLLCLCVAFGG 77

Query: 69  FISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRL 128
           F+ GWDTGTI GF++ +D++ RFGS H+DG+ YLSKVRTGL+VSIFNVGCA+G ++L +L
Sbjct: 78  FMFGWDTGTISGFINQTDFLRRFGSRHTDGTYYLSKVRTGLVVSIFNVGCAMGGIILSKL 137

Query: 129 GDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEIS 188
           GD  GR+ G++  V IYIVGI+IQI S DKWYQYFIGRII+GLG G IAVLSPMLISE S
Sbjct: 138 GDIYGRKIGLMTVVVIYIVGILIQICSFDKWYQYFIGRIISGLGVGGIAVLSPMLISESS 197

Query: 189 PKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIV 248
           PKHLRG LVS YQLMIT G+FLGYCTNYGT+ Y +S QWRVPLGLCFAW+L M+  +  V
Sbjct: 198 PKHLRGPLVSSYQLMITAGIFLGYCTNYGTRNYSDSTQWRVPLGLCFAWSLFMLAGLTRV 257

Query: 249 PESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQ 308
           PESPRYLV  G+IEEAKRSVAKSNKV+IDDPA + EIE++   VEAE+ AGSAS  ELF 
Sbjct: 258 PESPRYLVGAGKIEEAKRSVAKSNKVSIDDPALLLEIEMISAGVEAEKVAGSASIGELFS 317

Query: 309 TKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFV 368
           TKTKV  R +MG+++ ALQQLTG NYFFYYGT IFK+VGLEDSFQTS+I G++NFASTF 
Sbjct: 318 TKTKVFNRLVMGILLQALQQLTGNNYFFYYGTSIFKSVGLEDSFQTSIIIGVINFASTFG 377

Query: 369 ALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFF 428
           ALY V+K+GRRTCLLWG+A M+ CMV++ASVGVT+L+PNG DQP+SKGAGN MI F+ F+
Sbjct: 378 ALYTVEKFGRRTCLLWGSATMMACMVIYASVGVTRLYPNGMDQPTSKGAGNCMICFTMFY 437

Query: 429 IFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGY 488
           IFC+A +WAPI +V+ +E FPLRVK+K MAL + SN +W F I FFTPFITGAINFYYGY
Sbjct: 438 IFCYALSWAPIAWVVTAEVFPLRVKSKCMALASASNWLWGFLISFFTPFITGAINFYYGY 497

Query: 489 VFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALA 548
           VF+GCL FSY YVF FVPE+KGL LE+++ MW EGVLPW+S  WVP ++R   YN E L 
Sbjct: 498 VFVGCLCFSYFYVFFFVPESKGLTLEEIDEMWVEGVLPWRSTEWVPAARRNDQYNPEDLK 557

Query: 549 TDDKPIYKRM 558
            DDKP YKRM
Sbjct: 558 HDDKPWYKRM 567

>Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)
          Length = 569

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/551 (64%), Positives = 447/551 (81%), Gaps = 1/551 (0%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
           E    S   S H S    E  KD  +    +++ I +P+KPASAY++V IMCL +AFGGF
Sbjct: 19  EGSRLSADNSSHLSAPTVEENKDFPNSTGEEAEEIVLPEKPASAYVTVSIMCLCMAFGGF 78

Query: 70  ISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRL 128
           +SGWDTGTI GF++ +D++ RFG+ SHS G+ YLS VRTGL+VSIFNVG AIG + L +L
Sbjct: 79  MSGWDTGTISGFVNQTDFLRRFGNYSHSKGTYYLSNVRTGLIVSIFNVGSAIGCLFLSKL 138

Query: 129 GDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEIS 188
           GD  GR  G++I + +Y+VGIVIQIAS+DKWYQYFIGRIIAG+G+G+I+VL+PMLISE +
Sbjct: 139 GDIYGRCMGLIIVIVVYMVGIVIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETA 198

Query: 189 PKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIV 248
           PKH+RGTL++C+QLM+TF +FLGYCTNYGTKTY NS+QWRVPLGLCFAWA++MIG M  V
Sbjct: 199 PKHIRGTLLACWQLMVTFAIFLGYCTNYGTKTYSNSVQWRVPLGLCFAWAIIMIGGMMFV 258

Query: 249 PESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQ 308
           PESPR+LV+  + E+A+ S AKSNK+++DDPA I EI+L+   VEAE+A G+ASW ELF 
Sbjct: 259 PESPRFLVQVKKTEQARASFAKSNKLSVDDPAVIAEIDLLVAGVEAEEAMGTASWKELFS 318

Query: 309 TKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFV 368
           TKTKV QR  M V++ +LQQLTG NYFFYYGT IFK+VG+ DSF+TS++ GIVNFAS F 
Sbjct: 319 TKTKVFQRLSMTVMINSLQQLTGDNYFFYYGTTIFKSVGMTDSFETSIVLGIVNFASCFF 378

Query: 369 ALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFF 428
           +LY VDK GRR CLL GAA M  CMV++ASVGVT+L+PNG++QPSSKGAGN MIVF+CF+
Sbjct: 379 SLYSVDKLGRRKCLLLGAATMTACMVIYASVGVTRLYPNGKNQPSSKGAGNCMIVFTCFY 438

Query: 429 IFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGY 488
           IFCF+ TW P+ +VIISE+FPLRV++K M++ T +N +W F IGFFTPFIT AI+FYYGY
Sbjct: 439 IFCFSCTWGPVCYVIISETFPLRVRSKCMSVATAANLLWGFLIGFFTPFITSAIDFYYGY 498

Query: 489 VFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALA 548
           VF+GCL FSY YVF FVPETKGL LE+V+ MW +GVLPWKS SWVP S+R  DY+ E L 
Sbjct: 499 VFMGCLAFSYFYVFFFVPETKGLSLEEVDEMWIDGVLPWKSTSWVPASRRNADYDNEKLQ 558

Query: 549 TDDKPIYKRMF 559
            D+KP+YKR+F
Sbjct: 559 HDEKPLYKRLF 569

>Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/555 (64%), Positives = 441/555 (79%), Gaps = 9/555 (1%)

Query: 7   PTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAF 66
           P  + V S  +         +E++K      E+D+Q+     K  S  L V I CLMVAF
Sbjct: 45  PQVKPVSSYVSHEGPPKDELEELQK------EVDNQL---ESKSKSDLLFVSICCLMVAF 95

Query: 67  GGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLG 126
           GGF+ GWDTGTI GF+  +D+I RFGS+ +DG+ YLS VRTGL+VSIFN+GCAIG +VL 
Sbjct: 96  GGFVFGWDTGTISGFVRQTDFIRRFGSTRADGTSYLSDVRTGLMVSIFNIGCAIGGIVLS 155

Query: 127 RLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISE 186
           RLGD  GR+ G++  V IY VGI+IQIASIDKWYQYFIGRII+GLG G I VL+PMLISE
Sbjct: 156 RLGDMYGRKIGLMSVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVGGITVLAPMLISE 215

Query: 187 ISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMF 246
           +SPK LRGTLVSCYQLMITFG+FLGYCTN+GTK Y NS+QWRVPLGLCFAW++ MI  M 
Sbjct: 216 VSPKQLRGTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWSIFMIVGMS 275

Query: 247 IVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSEL 306
            VPESPRYLVE G++EEAKRS+A++NK + D P    E+E  Q ++EAE+ AGSASWSEL
Sbjct: 276 FVPESPRYLVEVGKMEEAKRSLARANKTSEDSPLVTLEMENYQSSIEAERLAGSASWSEL 335

Query: 307 FQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAST 366
              K ++ +RTLMG+++ +LQQLTG NYFFYYGT IF+AVGLEDSF+T+++ G+VNF ST
Sbjct: 336 VTGKPQMFRRTLMGMMIQSLQQLTGDNYFFYYGTTIFQAVGLEDSFETAIVLGVVNFVST 395

Query: 367 FVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSC 426
           F +LY VD++GRR CLLWG  GM+CC VV+ASVGVT+LWPNGQDQPSSKGAGN MIVF+C
Sbjct: 396 FFSLYTVDRFGRRNCLLWGCIGMICCYVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFAC 455

Query: 427 FFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYY 486
           F+IFCFATTWAP+ +V+ISES+PLRV+ K M++ +  N +W F I FFTPFIT AINFYY
Sbjct: 456 FYIFCFATTWAPVAYVLISESYPLRVRGKAMSIASACNWIWGFLISFFTPFITSAINFYY 515

Query: 487 GYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEA 546
           GYVF+GC+VF+Y YVF FVPETKGL LE+VN M+EE VLPWKS+ W+PPS+R  DY+ +A
Sbjct: 516 GYVFMGCMVFAYFYVFFFVPETKGLTLEEVNEMYEEHVLPWKSSQWIPPSRRSADYDLDA 575

Query: 547 LATDDKPIYKRMFSK 561
             TD +P YKRMF+K
Sbjct: 576 TRTDPRPFYKRMFTK 590

>NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/555 (65%), Positives = 443/555 (79%), Gaps = 3/555 (0%)

Query: 8   TGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFG 67
           TG D    T+ +V+  +S  +  +D +   +   + +E   K    ++S+C  CLMV+FG
Sbjct: 37  TGRDSGYGTS-AVNPKESLDQDNEDLKTLQKEADEQLESKSKKDLIFVSIC--CLMVSFG 93

Query: 68  GFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGR 127
           GFI GWDTGTI GF++ +DY+ RFG + S+GS YLS VR GLLVSIFNVG AIG V+L R
Sbjct: 94  GFIFGWDTGTISGFVNQTDYVRRFGQTRSNGSHYLSNVRMGLLVSIFNVGAAIGGVMLAR 153

Query: 128 LGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEI 187
            GD  GRR G++  V IY VGIVIQIASIDKW+QYFIGRII+GLG G IAVL+PMLISE+
Sbjct: 154 TGDMWGRRLGLITVVSIYTVGIVIQIASIDKWFQYFIGRIISGLGVGGIAVLAPMLISEV 213

Query: 188 SPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFI 247
           +PK LRGTLVSCYQLMIT G+FLGYC+N+GTK Y NS+QWRVPLGL FAWAL MIG M +
Sbjct: 214 APKQLRGTLVSCYQLMITLGIFLGYCSNFGTKNYSNSVQWRVPLGLSFAWALFMIGGMLM 273

Query: 248 VPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELF 307
           VPESPRYLVE G++E+AKRS++K+NKV ++ P    E+E  + +VEAE+ AG+A+W+EL 
Sbjct: 274 VPESPRYLVEVGRLEDAKRSLSKTNKVEVNSPFVTLEMEKFEASVEAERLAGTANWNELV 333

Query: 308 QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTF 367
             +  + +RT+MG+++ +LQQLTG NYFFYYGT IF+AVGLEDSF+TS++ G+VNF STF
Sbjct: 334 TGRPAMFKRTVMGMMIQSLQQLTGANYFFYYGTTIFRAVGLEDSFETSIVLGVVNFVSTF 393

Query: 368 VALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCF 427
            ALY VD YGRRTCLLWG  GM+CC VV+ASVGVT+LWPNGQ QPSSKGAGN MIVF+CF
Sbjct: 394 FALYFVDHYGRRTCLLWGCVGMICCYVVYASVGVTRLWPNGQSQPSSKGAGNCMIVFACF 453

Query: 428 FIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYG 487
           FIFCFATTWAPI +V+ SE +PLRV+ K +++ T  N MW F I FFTPFITGAINFYYG
Sbjct: 454 FIFCFATTWAPIAYVVTSEIYPLRVRGKAISVATACNCMWGFLISFFTPFITGAINFYYG 513

Query: 488 YVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEAL 547
           YVF+GC+VF+Y +VF  VPETKGL LE+VN M+EEGVLPWKSASWVPPS+R  DYN E L
Sbjct: 514 YVFMGCMVFAYFFVFFLVPETKGLTLEEVNEMYEEGVLPWKSASWVPPSRRDVDYNVEEL 573

Query: 548 ATDDKPIYKRMFSKN 562
            TDD+P YK++FSKN
Sbjct: 574 KTDDRPAYKKIFSKN 588

>KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly
           similar to uniprot|P32466 Saccharomyces cerevisiae
           YDR345C HXT3 Low affinity glucose transporter of the
           major facilitator superfamily expression is induced in
           low or high glucose conditions
          Length = 567

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/561 (62%), Positives = 440/561 (78%), Gaps = 14/561 (2%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQE---MKKDSQDFNEIDSQIIEIPKKPASAYLSVCIM 60
            Q     +V ++ A  ++  +S  E   +KKD++          ++  K +S ++ V + 
Sbjct: 16  DQGSHNSNVMNAPAPKLNREESHDEIDALKKDAEQ---------QLASKGSSDFVFVSMC 66

Query: 61  CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAI 120
           CLMVAFGGF+ GWDTGTI GF+  +D++ RFG  HSDG+ YLS VRTGL+V+IFN+GCAI
Sbjct: 67  CLMVAFGGFVFGWDTGTISGFVQQTDFLRRFGQKHSDGTHYLSNVRTGLIVAIFNIGCAI 126

Query: 121 GSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLS 180
           G +VLG+LG+  GRR G+ I V IY VGI+IQIASIDKWYQYFIGRII+GLG G I +LS
Sbjct: 127 GGIVLGKLGEVYGRRLGLTIVVIIYSVGIIIQIASIDKWYQYFIGRIISGLGVGAITILS 186

Query: 181 PMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALV 240
           PMLISE+SPKHLRGTLVSCYQ M+T G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWAL 
Sbjct: 187 PMLISEVSPKHLRGTLVSCYQFMVTGGIFLGYCTNYGTKRYSNSVQWRVPLGLCFAWALF 246

Query: 241 MIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGS 300
           MIG M  VPESPR+LVE G++EEA+RS+A+ NK +++D     E+E ++ +VEAE+ AG 
Sbjct: 247 MIGGMVFVPESPRFLVEAGRLEEARRSLARVNKASLEDAVVTLELENIEASVEAEKMAGK 306

Query: 301 ASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGI 360
           ASW+EL   K ++ +RTL G+I+++LQQLTG NYFFYYGT IFKAVG+ DSF+T+++FG+
Sbjct: 307 ASWAELITGKPQMFKRTLNGIIIMSLQQLTGDNYFFYYGTTIFKAVGMTDSFETAIVFGV 366

Query: 361 VNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSKGAG 418
           VNF  T ++LY VD++GRR CL++GA GMV C VV+ASVGVT+L+P G + P  SSKGAG
Sbjct: 367 VNFFCTSLSLYTVDRFGRRNCLIYGAIGMVACYVVYASVGVTRLYPEGANHPDISSKGAG 426

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N +IVF+CF+IFCFATTWAPI +V+ISE++PLRVK K M++ +  N +W F I FFTPFI
Sbjct: 427 NCLIVFACFYIFCFATTWAPIAYVLISETYPLRVKGKAMSIASACNWIWGFLIAFFTPFI 486

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           T AINFYYGYVF+GC+VF+  YVF F+PETKGL LE+VN M+ EGVLPWKSASWVP S+R
Sbjct: 487 TSAINFYYGYVFMGCMVFAIFYVFFFIPETKGLTLEEVNDMYAEGVLPWKSASWVPASRR 546

Query: 539 GTDYNAEALATDDKPIYKRMF 559
           G DYNA+ L  DDKP YKR F
Sbjct: 547 GADYNADDLMHDDKPWYKRFF 567

>Kwal_55.20075 s55 (239263..240978) [1716 bp, 571 aa] {ON} YDR343C
           (HXT6) - Hexose transporter [contig 155] FULL
          Length = 571

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/543 (67%), Positives = 450/543 (82%), Gaps = 3/543 (0%)

Query: 19  SVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTI 78
           S  S+++ ++  KD+Q + + + ++I IPKKPASAY++V I+CL VAFGGF+ GWDTGTI
Sbjct: 30  STPSNKASRDDLKDAQFYEDAEKEVI-IPKKPASAYITVVILCLCVAFGGFVFGWDTGTI 88

Query: 79  GGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGI 138
            GF++ SD+  RFG ++S G  YLS VRTGL+VSIFN+GCA G ++L ++GD  GRR G+
Sbjct: 89  SGFVAQSDFKRRFGQTNSKGQHYLSNVRTGLIVSIFNIGCAFGGILLSKIGDVWGRRIGL 148

Query: 139 VIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVS 198
           +  V +Y+VGI+IQIAS DKWYQYFIGRII+GLG G IAVLSPMLISE +PKHLRGTLV+
Sbjct: 149 MAVVVVYVVGIIIQIASQDKWYQYFIGRIISGLGVGGIAVLSPMLISETAPKHLRGTLVA 208

Query: 199 CYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEK 258
           CYQLMIT G+FLGYCTNYG K Y NSIQWRVPLGLCFAWAL MIG M  VPESPRYLVEK
Sbjct: 209 CYQLMITCGIFLGYCTNYGVKNYSNSIQWRVPLGLCFAWALFMIGGMMFVPESPRYLVEK 268

Query: 259 GQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTL 318
           G+IE+AK S+A+SNK++++DP+   E++L+   VEAE+ AGSAS+ ELF  KTKVLQR +
Sbjct: 269 GRIEDAKVSIARSNKISVEDPSVQVEVDLISAGVEAEKLAGSASFKELFSAKTKVLQRLI 328

Query: 319 MGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGR 378
           MG+++ +LQQLTG NYFFYYGTIIFK+VGL DSFQTS+I GIVNFASTFV ++ V+K+GR
Sbjct: 329 MGIMLQSLQQLTGDNYFFYYGTIIFKSVGLNDSFQTSIIIGIVNFASTFVGIFTVEKFGR 388

Query: 379 RTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSKGAGNTMIVFSCFFIFCFATTW 436
           R CLLWGAA MV C V++ASVGVT+L+P+G + P  S+KGAGN MIVF+CF+IFCFATTW
Sbjct: 389 RRCLLWGAASMVVCFVIYASVGVTRLYPDGANHPQNSNKGAGNCMIVFTCFYIFCFATTW 448

Query: 437 APIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVF 496
           API +V++SESFPLRVK+K MAL T +N +W F I FFTPFIT AI+FYYGYVF+GCLVF
Sbjct: 449 APIAYVVVSESFPLRVKSKAMALATAANWLWGFLIAFFTPFITSAIHFYYGYVFMGCLVF 508

Query: 497 SYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYK 556
           +Y YVF FVPETKGL LE+V  +WEEGVLPWKS SWVP S RG +YNAE L  DDKP YK
Sbjct: 509 AYFYVFFFVPETKGLTLEEVQELWEEGVLPWKSTSWVPSSSRGVNYNAEDLKHDDKPWYK 568

Query: 557 RMF 559
           R+ 
Sbjct: 569 RVL 571

>TBLA0A03410 Chr1 complement(815181..816950) [1770 bp, 589 aa] {ON} 
          Length = 589

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/573 (61%), Positives = 438/573 (76%), Gaps = 16/573 (2%)

Query: 5   QSPTGEDVHSSTAGSVHSS--QSFQEMK--------KDSQDFNEIDSQ-----IIEIPKK 49
           + P G+ + +       S+  +S  E+K        KD  +F+E D+       I +PKK
Sbjct: 17  EGPVGKRIGNELENDNFSTTPESDSEIKTDYSAKDAKDKDNFSENDADEDTVSHIALPKK 76

Query: 50  PASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGL 109
           PASAY++V I+C+M+AFGG+I G+DTGTIGGF SH D+  RFGS +  G  YLSKVR GL
Sbjct: 77  PASAYIAVSIICVMIAFGGYIPGYDTGTIGGFESHPDFKRRFGSRNKSGVYYLSKVRAGL 136

Query: 110 LVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIA 169
           L +  N+G A G   LGR+GD  GRR GI  A  I+I G++I+IASI  WYQY IGRI++
Sbjct: 137 LTATQNLGQACGVFFLGRVGDLYGRRIGIAFAASIFIAGVIIEIASIHAWYQYMIGRIVS 196

Query: 170 GLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRV 229
           GLG G  AVL PMLISE++PKHLRG LV+ YQLM+T G+FLGYC+NYGT+ YD+S QWR+
Sbjct: 197 GLGCGLFAVLCPMLISEVAPKHLRGALVATYQLMVTMGIFLGYCSNYGTQYYDDSRQWRI 256

Query: 230 PLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQ 289
           PLGL FAWAL +I AM  VPESPRYL+E G+ E+AKRS+ +SN+V  DDPA I E E +Q
Sbjct: 257 PLGLQFAWALFLITAMVFVPESPRYLIENGRFEDAKRSIGRSNRVNPDDPAVIYEAEYIQ 316

Query: 290 IAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLE 349
           +A+E E+  G A W +L   + K+LQR + G+ V+ LQQLTG NYFFYYGT++F  VG++
Sbjct: 317 VAIEKEREEGKAKWKDLLDVEHKILQRVINGIAVMGLQQLTGANYFFYYGTLLFHTVGMK 376

Query: 350 DSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQ 409
           + ++ ++I G VNF STF+ LY+++++GRRTCLLWG AGM+CCMVVFASVGVT+LWP G+
Sbjct: 377 NGYEGAIIIGTVNFFSTFIGLYIIERFGRRTCLLWGCAGMICCMVVFASVGVTRLWPEGK 436

Query: 410 DQP-SSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWN 468
           +   SSKGAGN MIVF+ FF+FCFA TW P+P VII+ESFPLRVKAK MAL TVSNQ+WN
Sbjct: 437 NAGISSKGAGNCMIVFTSFFLFCFAATWGPVPHVIIAESFPLRVKAKCMALATVSNQLWN 496

Query: 469 FCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWK 528
           FCIGFFTPFITG+INFYYGYVFLGCL  ++ YVF  VPETKGL LEDVN+MWEEGVL WK
Sbjct: 497 FCIGFFTPFITGSINFYYGYVFLGCLCLAWLYVFFLVPETKGLILEDVNVMWEEGVLAWK 556

Query: 529 SASWVPPSQRGTDYNAEALATDDKPIYKRMFSK 561
           SA+WVPPSQR  DY+  A+ATDDKPI+KRMF K
Sbjct: 557 SANWVPPSQREADYDINAMATDDKPIWKRMFGK 589

>ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly
           similar to uniprot|P39003 Saccharomyces cerevisiae
           YDR343C HXT6 High-affinity glucose transporter of the
           major facilitator superfamily nearly identical to Hxt7p
           expressed at high basal levels relative to other HXTs
           repression of expression by high glucose requires SNF3
          Length = 589

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/565 (62%), Positives = 446/565 (78%), Gaps = 4/565 (0%)

Query: 1   MDYSQSPTGEDVHSSTAGSVHSSQSFQE---MKKDSQDFNEIDSQIIEIPKKPASAYLSV 57
           +++++  T  D   + + S +     Q    M  D  +  + +   + +PKKP S YLSV
Sbjct: 25  VEHARESTASDSLENRSLSKNEKDDLQPVEGMNYDGHNGIQEEENDVALPKKPLSDYLSV 84

Query: 58  CIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNV 116
            I C+++AFGGF+ GWDTGTI GF++ +D+I RFG  +H  G  YLSKVRTGL+VS+FN+
Sbjct: 85  FIFCVLIAFGGFVFGWDTGTISGFVNQTDFIERFGQLNHRTGEHYLSKVRTGLIVSLFNI 144

Query: 117 GCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTI 176
           GCA G ++L +  D  GR+  + IA   Y+VG VI IASIDKWYQY IGRII+GLG G++
Sbjct: 145 GCAFGGLILTKPADVYGRKLAVTIAAVFYVVGTVISIASIDKWYQYMIGRIISGLGVGSL 204

Query: 177 AVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFA 236
           AVLSPMLISE++PK LRGTLVS YQLM+T G+FLGYC NYGTKTYDNS+QWRVPLGL FA
Sbjct: 205 AVLSPMLISEVAPKQLRGTLVSIYQLMVTAGIFLGYCANYGTKTYDNSVQWRVPLGLNFA 264

Query: 237 WALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQ 296
           WA++M+  M  VPESPRYLV+ G+++EAKRS+++SNKV+ +DP  + E+E ++  +EAE+
Sbjct: 265 WAILMVAGMTFVPESPRYLVQIGKVQEAKRSLSRSNKVSPEDPGLLAELEQIETGIEAER 324

Query: 297 AAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSL 356
           AAG AS  ELF T+ KVLQR +M  ++ +LQQLTG NYFFYYGT +FK+VGL DSF+TS+
Sbjct: 325 AAGKASLQELFSTRGKVLQRVIMAAVIQSLQQLTGDNYFFYYGTTVFKSVGLNDSFETSI 384

Query: 357 IFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKG 416
           + G+VNF STF  +Y V+++GRRTCLLWGAA MVCC VVFASVGVT+LWPNGQ   SSKG
Sbjct: 385 VLGVVNFFSTFFGIYYVERFGRRTCLLWGAATMVCCFVVFASVGVTRLWPNGQGNGSSKG 444

Query: 417 AGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTP 476
           AGN MIVF+CF+I+CFA++WAPI FV++SE+FPLRVK+KGMA+  V+N +W F IGFFTP
Sbjct: 445 AGNCMIVFTCFYIYCFASSWAPICFVVVSETFPLRVKSKGMAIAMVANWVWGFLIGFFTP 504

Query: 477 FITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPS 536
           FITGAINFYYGYVF+GCLVF++ YVF FVPETKGL LE+V+ MWEE VLPWKS SWVPP 
Sbjct: 505 FITGAINFYYGYVFMGCLVFAFFYVFFFVPETKGLTLEEVSTMWEENVLPWKSTSWVPPD 564

Query: 537 QRGTDYNAEALATDDKPIYKRMFSK 561
           +RG  Y++EALA DDKP YK MF+K
Sbjct: 565 RRGRGYDSEALAHDDKPWYKAMFTK 589

>TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/503 (70%), Positives = 425/503 (84%), Gaps = 1/503 (0%)

Query: 60  MCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCA 119
           MC+MV FGG+IS   +GTIGGF SH+D++ RFGS+   G +YLSKVRTGLL S+FN+G A
Sbjct: 1   MCVMVRFGGYISVGSSGTIGGFESHTDFLARFGSTSGSGKRYLSKVRTGLLTSMFNIGQA 60

Query: 120 IGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVL 179
           IG   LGRLGD  GRR  I++A  I++VG VIQIAS+  WYQY IGRI+AGLG G IA+ 
Sbjct: 61  IGCFFLGRLGDMYGRRIAIIVASIIFVVGTVIQIASVKAWYQYMIGRIVAGLGCGIIAIS 120

Query: 180 SPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWAL 239
           SPMLISE+SPKHLRG +VSCYQLMIT G+FLGYC NYGTK YD+S QWRVPLGL FAW L
Sbjct: 121 SPMLISEVSPKHLRGAMVSCYQLMITMGIFLGYCANYGTKRYDDSTQWRVPLGLQFAWCL 180

Query: 240 VMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAG 299
            ++GAM  VPESPR+L+EKG+ E+AKRS+A+SNKV+ DDPA I E + +Q A++ E+A G
Sbjct: 181 FLVGAMLFVPESPRFLIEKGRYEDAKRSIAESNKVSPDDPAVIMEADEIQAAIDKERAEG 240

Query: 300 SASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFG 359
            A+W +L  T+ K+L R + G+++LALQQLTG NYFFYYGT+IFKAVGLED ++T+++FG
Sbjct: 241 EATWGDLLDTQHKILPRVINGIMLLALQQLTGANYFFYYGTLIFKAVGLEDGYETAIVFG 300

Query: 360 IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSKGAG 418
           +VNF STFVALY+VD++GRRTCLLWGAAGM CCMVVFASVGVT+LWP G++   +S+GAG
Sbjct: 301 VVNFFSTFVALYLVDRFGRRTCLLWGAAGMTCCMVVFASVGVTRLWPKGKNGGVTSQGAG 360

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MI FSCFFIFCFA +WAP+PFVIISESFPL+VKAKGMAL TVSNQMWNFCIGFFTPFI
Sbjct: 361 NCMICFSCFFIFCFAVSWAPVPFVIISESFPLKVKAKGMALATVSNQMWNFCIGFFTPFI 420

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           TGAINFYYGYVFLGCLVF++ YVF FVPETKGL LEDVN+MWEEGVLPWKSA+WVPPS+R
Sbjct: 421 TGAINFYYGYVFLGCLVFAWFYVFFFVPETKGLVLEDVNVMWEEGVLPWKSAAWVPPSER 480

Query: 539 GTDYNAEALATDDKPIYKRMFSK 561
             DY+  A+A DD P +K+MF K
Sbjct: 481 SADYDVAAMANDDTPAWKKMFGK 503

>TPHA0P00120 Chr16 complement(23525..25201) [1677 bp, 558 aa] {ON}
           Anc_8.22 YFL040W
          Length = 558

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/560 (65%), Positives = 443/560 (79%), Gaps = 9/560 (1%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKD-----SQDFNEIDSQIIEIPKKPASAYLSVC 58
           S++   E++  S+  S  S+ S +E  +D       D N  D      PK   S YLS  
Sbjct: 2   SENIHDEELERSSQNSHLSTPSVKEDYEDIKAQTPDDLNMEDPA----PKSSKSKYLSAS 57

Query: 59  IMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGC 118
           ++CL VAFGGFI GWDTGTI GF++ +D+++RFGS HSDG+ Y S  RTGL+V+IFN+GC
Sbjct: 58  LLCLCVAFGGFIFGWDTGTISGFVNQTDFLDRFGSKHSDGTPYFSNARTGLIVAIFNIGC 117

Query: 119 AIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAV 178
           AIG ++L + GD  GRR G+ I V IYI+GI+IQIASIDKWYQYFIGRII+GLG G IAV
Sbjct: 118 AIGGIILSKGGDLYGRRIGLFIVVTIYIIGIIIQIASIDKWYQYFIGRIISGLGVGGIAV 177

Query: 179 LSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWA 238
           L PMLISEI+PK +RG+LVSCYQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWA
Sbjct: 178 LCPMLISEIAPKQVRGSLVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWA 237

Query: 239 LVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAA 298
           L M+ A+ +VPESPRYLVE G++EEAKRS+AKSN+ TI+DP  I+E +L+   VEAE+AA
Sbjct: 238 LFMLFALTLVPESPRYLVEVGRLEEAKRSLAKSNRCTIEDPIVIEEYDLISAGVEAEKAA 297

Query: 299 GSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIF 358
           G ASW ELF T++K++QR  MG ++  LQQLTG NYFFYYGT IFK++GLEDSFQTS+I 
Sbjct: 298 GDASWKELFSTRSKIVQRLTMGCMIQCLQQLTGNNYFFYYGTSIFKSIGLEDSFQTSIII 357

Query: 359 GIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAG 418
           GIVNFASTFVALY V+K GRR CLLWGAA M+ CMV++ASVGVT L+PNG DQPSSKGAG
Sbjct: 358 GIVNFASTFVALYTVEKLGRRRCLLWGAASMMACMVIYASVGVTSLYPNGDDQPSSKGAG 417

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MIVF+CF+IFC+ATTWAP+ +VI +ESFPLRVK+K M++ + +N  W F I FFTPFI
Sbjct: 418 NCMIVFTCFYIFCYATTWAPVAWVITAESFPLRVKSKCMSIASAANWTWGFLIAFFTPFI 477

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           T AINFYYGYVF+GCLVF + YVF  VPETKGL LE++N +WEEGVLPWKSA WVP S+R
Sbjct: 478 TSAINFYYGYVFMGCLVFMFFYVFLIVPETKGLTLEEINELWEEGVLPWKSAQWVPASRR 537

Query: 539 GTDYNAEALATDDKPIYKRM 558
             DY+ E L  DDKP YK M
Sbjct: 538 AVDYDNELLTHDDKPWYKSM 557

>CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011w HXT2 high-affinity hexose transporter or
           uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10 or
           uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/559 (64%), Positives = 443/559 (79%), Gaps = 7/559 (1%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQE-----MKKDSQDFNEIDSQIIEIPKKPASAYLSVC 58
           S SP+ E   +S    V+ + SF++      +K + D + +  +  E P KP SAY +V 
Sbjct: 6   SLSPS-ESAENSPVREVNVANSFKDDDFILEQKQTADVSAMSPEA-EAPPKPISAYFTVI 63

Query: 59  IMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGC 118
            +CLM+AFGGF+ GWDTGTI GF++ +D+  RFG   +DGS YLS VRTGL+V+IFN+GC
Sbjct: 64  CLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQQAADGSYYLSDVRTGLIVAIFNIGC 123

Query: 119 AIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAV 178
           AIG + LGRLGD  GRR G++  + +Y+VGIVIQI+S   WYQYF+GRI++GLG G IAV
Sbjct: 124 AIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTTWYQYFVGRIVSGLGVGGIAV 183

Query: 179 LSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWA 238
           LSP LISE +PKHLRGT VS YQLMIT G+FLGYCTNYGTKT+ NSIQWRVPLGLCFAWA
Sbjct: 184 LSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKTHTNSIQWRVPLGLCFAWA 243

Query: 239 LVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAA 298
           L M+  M +VPESPR+LVEKG+ EEA+RS+A+SNKV++DDP    EIE +   VEAE++A
Sbjct: 244 LFMLVGMSMVPESPRFLVEKGRFEEARRSLARSNKVSMDDPIVTAEIENISAGVEAEKSA 303

Query: 299 GSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIF 358
           G+ASW ELF TK K+LQR +MG+++ +LQQLTGCNYFFYYGT IFKAVGLEDSFQTS+I 
Sbjct: 304 GNASWGELFSTKGKILQRVVMGIMIQSLQQLTGCNYFFYYGTTIFKAVGLEDSFQTSIIL 363

Query: 359 GIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAG 418
           GIVNFASTFVALYVVD++GRR CLLWG++ M  CMV+FASVGV  L+PNG+DQPSS  AG
Sbjct: 364 GIVNFASTFVALYVVDRFGRRKCLLWGSSTMAVCMVIFASVGVKSLYPNGKDQPSSTTAG 423

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MIVF+C +IFCFATTWAP  +VI++E++PLRVK + MA+    N +W F IGFFTPFI
Sbjct: 424 NVMIVFTCLYIFCFATTWAPTAYVIVAETYPLRVKNRAMAIAVGFNWIWGFLIGFFTPFI 483

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           T AINFYYGYVF+GCLVFS+ YVF FV ETKGL LE+VN M+EEGVLPWKSA W+P ++R
Sbjct: 484 TTAINFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYEEGVLPWKSAQWLPTTKR 543

Query: 539 GTDYNAEALATDDKPIYKR 557
            + Y+ +A   DDKP YKR
Sbjct: 544 TSGYDVDAALHDDKPWYKR 562

>CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P23585 Saccharomyces
           cerevisiae YMR011w HXT2 high-affinity hexose transporter
           or uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10
           or uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/559 (64%), Positives = 443/559 (79%), Gaps = 7/559 (1%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQE-----MKKDSQDFNEIDSQIIEIPKKPASAYLSVC 58
           S SP+ E   +S    V+ + SF++      +K + D + +  +  E P KP SAY +V 
Sbjct: 6   SLSPS-ESAENSPVREVNVANSFKDDDFILEQKQTADVSAMSPEA-EAPPKPISAYFTVI 63

Query: 59  IMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGC 118
            +CLM+AFGGF+ GWDTGTI GF++ +D+  RFG   +DGS YLS VRTGL+V+IFN+GC
Sbjct: 64  CLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQQAADGSYYLSDVRTGLIVAIFNIGC 123

Query: 119 AIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAV 178
           AIG + LGRLGD  GRR G++  + +Y+VGIVIQI+S   WYQYF+GRI++GLG G IAV
Sbjct: 124 AIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTTWYQYFVGRIVSGLGVGGIAV 183

Query: 179 LSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWA 238
           LSP LISE +PKHLRGT VS YQLMIT G+FLGYCTNYGTKT+ NSIQWRVPLGLCFAWA
Sbjct: 184 LSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKTHTNSIQWRVPLGLCFAWA 243

Query: 239 LVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAA 298
           L M+  M +VPESPR+LVEKG+ EEA+RS+A+SNKV++DDP    EIE +   VEAE++A
Sbjct: 244 LFMLVGMSMVPESPRFLVEKGRFEEARRSLARSNKVSMDDPIVTAEIENISAGVEAEKSA 303

Query: 299 GSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIF 358
           G+ASW ELF TK K+LQR +MG+++ +LQQLTGCNYFFYYGT IFKAVGLEDSFQTS+I 
Sbjct: 304 GNASWGELFSTKGKILQRVVMGIMIQSLQQLTGCNYFFYYGTTIFKAVGLEDSFQTSIIL 363

Query: 359 GIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAG 418
           GIVNFASTFVALYVVD++GRR CLLWG++ M  CMV+FASVGV  L+PNG+DQPSS  AG
Sbjct: 364 GIVNFASTFVALYVVDRFGRRKCLLWGSSTMAVCMVIFASVGVKSLYPNGKDQPSSTTAG 423

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MIVF+C +IFCFATTWAP  +VI++E++PLRVK + MA+    N +W F IGFFTPFI
Sbjct: 424 NVMIVFTCLYIFCFATTWAPTAYVIVAETYPLRVKNRAMAIAVGFNWIWGFLIGFFTPFI 483

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           T AINFYYGYVF+GCLVFS+ YVF FV ETKGL LE+VN M+EEGVLPWKSA W+P ++R
Sbjct: 484 TTAINFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYEEGVLPWKSAQWLPTTKR 543

Query: 539 GTDYNAEALATDDKPIYKR 557
            + Y+ +A   DDKP YKR
Sbjct: 544 TSGYDVDAALHDDKPWYKR 562

>ZYRO0A06688g Chr1 (546489..548204) [1716 bp, 571 aa] {ON} highly
           similar to uniprot|P39003 Saccharomyces cerevisiae
           YDR343C HXT6 High-affinity glucose transporter of the
           major facilitator superfamily nearly identical to Hxt7p
           expressed at high basal levels relative to other HXTs
           repression of expression by high glucose requires SNF3
          Length = 571

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/554 (66%), Positives = 445/554 (80%)

Query: 6   SPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVA 65
           SP      S +      ++   E  KD     E +  II++PKKPASAY+SV IMC+M+A
Sbjct: 17  SPELSPTESPSPSGGLPAKLEDEALKDYVLHPEDEEPIIDLPKKPASAYISVAIMCVMIA 76

Query: 66  FGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVL 125
           FGGF+ GWDTGTI GF++ SD+I RFG+  SDG+ YLSKVR GL+VSIFNVGCAIG + L
Sbjct: 77  FGGFVFGWDTGTISGFVNQSDWIRRFGTQRSDGTYYLSKVRMGLVVSIFNVGCAIGGLTL 136

Query: 126 GRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLIS 185
            ++GD  GR+ G++  V +Y+VGIVIQIAS+DKWYQYFIGRII+GLG G  AVLSPMLIS
Sbjct: 137 SKIGDIYGRKIGLISVVVVYVVGIVIQIASVDKWYQYFIGRIISGLGVGGTAVLSPMLIS 196

Query: 186 EISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAM 245
           E+SPKH+RG+LVSCYQLMIT  +FLGYCTNYGTK Y NS+QWRVPLGLCFAWAL MIG M
Sbjct: 197 EVSPKHIRGSLVSCYQLMITAVIFLGYCTNYGTKNYTNSVQWRVPLGLCFAWALFMIGGM 256

Query: 246 FIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSE 305
             VPESPR+L+  G+IEEAKRS++KSNK++ +DP  + E+E +Q +VE E+ AGSASWSE
Sbjct: 257 TFVPESPRFLISVGKIEEAKRSLSKSNKISTEDPGLLAELENIQASVEEEKLAGSASWSE 316

Query: 306 LFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAS 365
           +F  KTKVLQR +MG+ + +LQQLTG NYFFYYGT IFK+VGLEDSFQTS+I G+VNF  
Sbjct: 317 MFSPKTKVLQRMIMGIALQSLQQLTGDNYFFYYGTTIFKSVGLEDSFQTSIIIGVVNFFC 376

Query: 366 TFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFS 425
           TF++L+ VD++GRR CLLWGA GMVCC  VFASVGVT+LWPNGQ   SSKGAGN MI F+
Sbjct: 377 TFLSLFTVDRFGRRKCLLWGAIGMVCCFAVFASVGVTRLWPNGQGNGSSKGAGNCMICFT 436

Query: 426 CFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFY 485
            F+IFCFATTWAP+ +VI+SES+PLRVK+KGMAL T +N +W F I FFTPFIT AINFY
Sbjct: 437 MFYIFCFATTWAPLCYVIVSESYPLRVKSKGMALATAANWLWGFLISFFTPFITDAINFY 496

Query: 486 YGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAE 545
           YGYVF+GCLVF+Y YVF FVPETKGL LE+VN MW + VLPWKS  WVP S+R  DY+A 
Sbjct: 497 YGYVFMGCLVFAYFYVFFFVPETKGLTLEEVNEMWMDNVLPWKSPDWVPSSRRNVDYDAN 556

Query: 546 ALATDDKPIYKRMF 559
           A++ DDKP YK++ 
Sbjct: 557 AMSHDDKPFYKKLL 570

>NCAS0F03110 Chr6 complement(622619..624325) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/533 (67%), Positives = 439/533 (82%), Gaps = 1/533 (0%)

Query: 29  MKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYI 88
           M+K+  D  E  ++++  P     AY++V I C+MVAFGGF+ GWDTGTI GF++ +D++
Sbjct: 36  MEKNGSDDYEQVTELVN-PNNGKGAYVTVSICCVMVAFGGFVFGWDTGTISGFVAQTDFL 94

Query: 89  NRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVG 148
            RFG  H +G+ YLSKVR GL+VSIFN+GCAIG +VL RLGDT GR+ G++I V IYIVG
Sbjct: 95  RRFGQKHHNGTPYLSKVRMGLIVSIFNIGCAIGGIVLARLGDTHGRKMGLIIVVCIYIVG 154

Query: 149 IVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGM 208
           I+IQIAS+  WYQYFIGRII+GLG G IAVLSPMLISE++PK +RGTLVSCYQLMIT G+
Sbjct: 155 IIIQIASVKAWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKEMRGTLVSCYQLMITLGI 214

Query: 209 FLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSV 268
           FLGYCTNYGTK Y NS+QWRVPLGLCFAWAL MIG M  VPESPRYLVE G+I+EA+ S+
Sbjct: 215 FLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEAGKIDEARASL 274

Query: 269 AKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQ 328
           +K NK   D P   QE+EL++ +VE  +AAGSASW ELF  K  +LQRT++G+++ +LQQ
Sbjct: 275 SKVNKTPGDHPFIQQELELIEASVEEARAAGSASWGELFTGKPAMLQRTMLGIMIQSLQQ 334

Query: 329 LTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAG 388
           LTG NYFFYYGT +F AVG++DSF+TS++FGIVN AST  +LY VDK+GRR CLLWGA G
Sbjct: 335 LTGDNYFFYYGTTVFTAVGMQDSFETSIVFGIVNLASTCCSLYTVDKFGRRNCLLWGAVG 394

Query: 389 MVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESF 448
           MVCC VV+ASVGVT+LWPNG+   SSKGAGN MI F+CF+IFCFATTWAPI +V+ISE+F
Sbjct: 395 MVCCYVVYASVGVTRLWPNGEGNGSSKGAGNCMICFACFYIFCFATTWAPIAYVVISETF 454

Query: 449 PLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPET 508
           PLRVK+K M++ T +N +W F IGFFTPFITGAINFYYGYVF+GC+VF+Y YVF FVPET
Sbjct: 455 PLRVKSKAMSVATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPET 514

Query: 509 KGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMFSK 561
           KGL LE+VN M+ EGV+PWKSASWVPPS+RG DYN + LA DD PIYKRMF +
Sbjct: 515 KGLTLEEVNDMYSEGVVPWKSASWVPPSRRGADYNIDELAHDDTPIYKRMFGR 567

>YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein of
           unknown function with similarity to hexose transporter
           family members, expression is induced by low levels of
           glucose and repressed by high levels of glucose
          Length = 569

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/551 (64%), Positives = 446/551 (80%), Gaps = 1/551 (0%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
           +D   S   S H S    E  KD  ++N  +++ + +P+KPASAY +V IMCL +AFGGF
Sbjct: 19  DDGCPSIENSSHLSVPTVEENKDFSEYNGEEAEEVVVPEKPASAYATVSIMCLCMAFGGF 78

Query: 70  ISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRL 128
           +SGWDTGTI GF++ +D++ RFG+ SHS  + YLS VRTGL+VSIFNVG AIG + L +L
Sbjct: 79  MSGWDTGTISGFVNQTDFLRRFGNYSHSKNTYYLSNVRTGLIVSIFNVGSAIGCLFLSKL 138

Query: 129 GDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEIS 188
           GD  GR  G++I + +Y+VGIVIQIASIDKWYQYFIGRIIAG+G+G+I+VL+PMLISE +
Sbjct: 139 GDIYGRCMGLIIVIVVYMVGIVIQIASIDKWYQYFIGRIIAGIGAGSISVLAPMLISETA 198

Query: 189 PKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIV 248
           PKH+RGTL++C+QLM+TF +FLGYCTNYGTKTY NS+QWRVPLGLCFAWA++MIG M  V
Sbjct: 199 PKHIRGTLLACWQLMVTFAIFLGYCTNYGTKTYSNSVQWRVPLGLCFAWAIIMIGGMTFV 258

Query: 249 PESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQ 308
           PESPR+LV+ G+IE+AK S AKSNK+++DDPA + EI+L+   VEAE+A G+ASW ELF 
Sbjct: 259 PESPRFLVQVGKIEQAKASFAKSNKLSVDDPAVVAEIDLLVAGVEAEEAMGTASWKELFS 318

Query: 309 TKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFV 368
            KTKV QR  M V++ +LQQLTG NYFFYYGT IFK+VG+ DSF+TS++ GIVNFAS F 
Sbjct: 319 RKTKVFQRLTMTVMINSLQQLTGDNYFFYYGTTIFKSVGMNDSFETSIVLGIVNFASCFF 378

Query: 369 ALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFF 428
           +LY VDK GRR CLL GAA M  CMV++ASVGVT+L+PNG+ +PSSKGAGN  IVF+CF+
Sbjct: 379 SLYSVDKLGRRRCLLLGAATMTACMVIYASVGVTRLYPNGKSEPSSKGAGNCTIVFTCFY 438

Query: 429 IFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGY 488
           IFCF+ TW P+ +VIISE+FPLRV++K M++ T +N +W F IGFFTPFIT AINFYYGY
Sbjct: 439 IFCFSCTWGPVCYVIISETFPLRVRSKCMSVATAANLLWGFLIGFFTPFITSAINFYYGY 498

Query: 489 VFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALA 548
           VF+GCL FSY YVF FVPETKGL LE+V+ MW +GVLPWKS SWVP S+R  DY+ E L 
Sbjct: 499 VFMGCLAFSYFYVFFFVPETKGLTLEEVDEMWMDGVLPWKSESWVPASRRDGDYDNEKLQ 558

Query: 549 TDDKPIYKRMF 559
            D+KP YKRMF
Sbjct: 559 HDEKPFYKRMF 569

>Ecym_1319 Chr1 complement(649182..650789) [1608 bp, 535 aa] {ON}
           similar to Ashbya gossypii AFL207CAFL205C
          Length = 535

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/512 (67%), Positives = 422/512 (82%), Gaps = 4/512 (0%)

Query: 27  QEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSD 86
           Q++K +       D   +++P KPASAYL+VC++CL VAFGGF+ GWDTGTI GF++ SD
Sbjct: 25  QKVKNEESK----DLAFVDVPAKPASAYLTVCVLCLFVAFGGFVFGWDTGTISGFVNQSD 80

Query: 87  YINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYI 146
           ++ RFG   SDG+  +S  RTGL+VSIFN+GCAIG +VL +LGD  GRR G++    +Y+
Sbjct: 81  FLRRFGQLRSDGTYGMSNARTGLVVSIFNIGCAIGGIVLSKLGDMYGRRIGLMCVTLVYV 140

Query: 147 VGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITF 206
           VGIVIQI+S DKWYQYFIGRI++GLG G IAVLSPMLISE SPKHLRGTLVSCYQLMIT 
Sbjct: 141 VGIVIQISSTDKWYQYFIGRIVSGLGVGGIAVLSPMLISETSPKHLRGTLVSCYQLMITA 200

Query: 207 GMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKR 266
           G+FLGYCTNYGTK + +++QWRVPLGLCF WA  M+  M +VPESPRYLVE  +IEEAKR
Sbjct: 201 GIFLGYCTNYGTKKHSDAVQWRVPLGLCFVWAAFMVAGMAMVPESPRYLVEVNKIEEAKR 260

Query: 267 SVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLAL 326
           S+A+SNKV+++DP+   EI+ +Q  VE E+ AG+ASW ELF TKTKV QR +MG++V +L
Sbjct: 261 SLARSNKVSMEDPSIQAEIDRIQAGVEIERMAGTASWGELFSTKTKVFQRLIMGIMVQSL 320

Query: 327 QQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGA 386
           QQLTG NYFFYYGT IFK+VG+EDS+QTS++ G+VNFASTFVA+YVVDK+GRR CLLWGA
Sbjct: 321 QQLTGINYFFYYGTTIFKSVGMEDSYQTSIVLGVVNFASTFVAIYVVDKFGRRKCLLWGA 380

Query: 387 AGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISE 446
           A M  CMV+FAS+GVTKLWPNG DQP+SK AGN MIVF+CF+IF FATTWAPI +VI++E
Sbjct: 381 AAMAVCMVIFASIGVTKLWPNGDDQPASKSAGNIMIVFTCFYIFSFATTWAPIAYVIVAE 440

Query: 447 SFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVP 506
           +FPLR+K+K MA+ T +N +W F IGFFTPFIT AI FYYGYVF+G L+FS+ Y+F FVP
Sbjct: 441 TFPLRIKSKAMAIATAANWIWGFLIGFFTPFITTAIKFYYGYVFMGSLIFSFFYIFFFVP 500

Query: 507 ETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           ETKGL LE+V  MW+EGVLPWKS  WVP S+R
Sbjct: 501 ETKGLTLEEVEEMWQEGVLPWKSTEWVPASRR 532

>TDEL0E02280 Chr5 (438756..440519) [1764 bp, 587 aa] {ON} Anc_5.396
           YHR096C
          Length = 587

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/552 (64%), Positives = 440/552 (79%), Gaps = 6/552 (1%)

Query: 14  SSTAGSVHSSQSFQEMKKD--SQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFIS 71
           ++    +   +S  E +KD  +Q   + D Q   + KK    ++S+C  C+MVAFGGF+ 
Sbjct: 39  AADGADLEQFRSHDEGEKDEMTQLVRDADQQAATM-KKSDLMFVSLC--CVMVAFGGFVF 95

Query: 72  GWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGD 130
           GWDTGTI GF++ +D+I RFGS + + G  YLS VRTGLLVSIFN+GCAIG +VL + GD
Sbjct: 96  GWDTGTISGFVNQTDWIRRFGSYNQNTGQYYLSDVRTGLLVSIFNIGCAIGGIVLSKAGD 155

Query: 131 TVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPK 190
             GRR G+V  V IY VGI+IQI S DKWYQYFIGRII+GLG G I V+SPMLISE++PK
Sbjct: 156 LYGRRLGLVFVVVIYTVGILIQICSFDKWYQYFIGRIISGLGVGGITVMSPMLISEVAPK 215

Query: 191 HLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPE 250
             RGTL+SCYQLMIT G+FLGYCTN+GTK YD+S QWRVPLGLCFAWA+ MIG M  VPE
Sbjct: 216 QTRGTLISCYQLMITGGIFLGYCTNFGTKQYDDSTQWRVPLGLCFAWAMFMIGGMLFVPE 275

Query: 251 SPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTK 310
           SPRYLVE G++EEA+RS+A++N+   + P    E+E  Q +VEAE+ AGSASWSEL   K
Sbjct: 276 SPRYLVEVGKMEEARRSLARANRCPTESPLVTLELENFQASVEAEKVAGSASWSELITGK 335

Query: 311 TKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVAL 370
             + +RTLMGV++ +LQQLTG NYFFYYGT IF+AVGLEDSF+TS++ G+VNFASTF+AL
Sbjct: 336 PAIFKRTLMGVMIQSLQQLTGDNYFFYYGTTIFRAVGLEDSFETSIVLGVVNFASTFLAL 395

Query: 371 YVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIF 430
           Y VD +GRR CLLWG  GMVCC VV++SVGVT+L+PNGQDQPSSKGAGN MIVF+CF+IF
Sbjct: 396 YTVDHFGRRKCLLWGCVGMVCCYVVYSSVGVTRLYPNGQDQPSSKGAGNCMIVFACFYIF 455

Query: 431 CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVF 490
           CFATTWAP+ +VII+ES+PLR+K+K MA+ + SN +W F IGFFTPFIT AINFYYGYVF
Sbjct: 456 CFATTWAPMAYVIIAESYPLRIKSKAMAIASASNWLWGFLIGFFTPFITSAINFYYGYVF 515

Query: 491 LGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATD 550
           +GC+VF++ YVF FVPETKGL LE+VN+M+EE VLPWKSASW+PP +RG D++A+A   D
Sbjct: 516 MGCMVFAFFYVFFFVPETKGLTLEEVNIMYEERVLPWKSASWLPPHRRGADFDADAYTRD 575

Query: 551 DKPIYKRMFSKN 562
           D P YKRM  +N
Sbjct: 576 DLPFYKRMLRRN 587

>YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putative
           hexose transporter that is nearly identical to Hxt11p,
           has similarity to major facilitator superfamily (MFS)
           transporters, expression of HXT9 is regulated by
           transcription factors Pdr1p and Pdr3p
          Length = 567

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/550 (64%), Positives = 438/550 (79%), Gaps = 4/550 (0%)

Query: 15  STAGSVHSSQSFQEMKKDSQDFNEIDSQ--IIEIPKKPASAYLSVCIMCLMVAFGGFISG 72
           S + SV ++ S +    DS++   +D+    I++P+KP SAY +V I+CLM+AFGGFI G
Sbjct: 17  SNSNSVANAPSVKTEHNDSKNSLNLDATEPPIDLPQKPLSAYTTVAILCLMIAFGGFIFG 76

Query: 73  WDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV 132
           WDTGTI GF++ SD+I RFG  +  G+ YLSKVR GL+VSIFN+GCAIG +VL ++GD  
Sbjct: 77  WDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFNIGCAIGGIVLSKVGDIY 136

Query: 133 GRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHL 192
           GRR G++    IY+VGI+IQI SI+KWYQYFIGRII+GLG G IAVLSPMLISE++PK +
Sbjct: 137 GRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKQI 196

Query: 193 RGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           RGTLV  YQLM T G+FLGYCTNYGTK Y N+ QWRV LGLCFAW   M+  M  VPESP
Sbjct: 197 RGTLVQLYQLMCTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFAWTTFMVSGMMFVPESP 256

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           RYL+E G+ EEAKRS++KSNKV++DDPA + E + ++  +E E+ AG+ASWSEL  TKTK
Sbjct: 257 RYLIEVGKDEEAKRSLSKSNKVSVDDPALLAEYDTIKAGIELEKLAGNASWSELLSTKTK 316

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           V QR LMGV++ +LQQLTG NYFFYYGT IFK+VGL+DSFQTS+I G+VNF S+F+A+Y 
Sbjct: 317 VFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSIIIGVVNFFSSFIAVYT 376

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSKGAGNTMIVFSCFFIF 430
           ++++GRRTCLLWGAA M+CC  VFASVGVTKLWP G      +S+GAGN MIVF+ FFIF
Sbjct: 377 IERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITSQGAGNCMIVFTMFFIF 436

Query: 431 CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVF 490
            FATTWA   +VI+SE+FPLRVK++GMA+ T +N MW F I FFTPFITGAINFYYGYVF
Sbjct: 437 SFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLISFFTPFITGAINFYYGYVF 496

Query: 491 LGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATD 550
           LGCLVF+Y YVF FVPETKGL LE+VN MW EGV  WKSASWVPP +R  DY+A+A+  D
Sbjct: 497 LGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWVPPERRTADYDADAIDHD 556

Query: 551 DKPIYKRMFS 560
           D+PIYKR FS
Sbjct: 557 DRPIYKRFFS 566

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/560 (63%), Positives = 445/560 (79%), Gaps = 1/560 (0%)

Query: 3   YSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCL 62
           +    TG  + +S   +  SS    E  K+ ++  + +S  +  P  P      VC++CL
Sbjct: 14  HENKATGNGISASADSASMSSNIESENFKNYENEEDFESTPMTPPPAPTGTNWGVCVLCL 73

Query: 63  MVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGS 122
           MVAFGG+ISGWD+GTIGGF SH+D++ RFGS+   G +YLSKVRTGLL S+FNVG AIG 
Sbjct: 74  MVAFGGYISGWDSGTIGGFESHTDFLARFGSTSGSGKRYLSKVRTGLLTSMFNVGQAIGC 133

Query: 123 VVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPM 182
             LGRLGD  GRR G+++A  I+I+G VIQIAS+  WYQY IGRI+AG+G G IA+LSPM
Sbjct: 134 FFLGRLGDIYGRRIGLIVASVIFIIGSVIQIASVKAWYQYMIGRIVAGIGCGLIAILSPM 193

Query: 183 LISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMI 242
           LISE+SPK++RG +VSCYQLM+T G+FLGYCTNYGTK Y NS QWR+  GL FAW L MI
Sbjct: 194 LISEVSPKNMRGAMVSCYQLMVTLGIFLGYCTNYGTKRYHNSAQWRIGEGLQFAWCLCMI 253

Query: 243 GAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS 302
           GAM  VPESPR+LVEKG+IEEAKRS+ +SN V+ DDP T+ E++ +Q+ V+  +A G A 
Sbjct: 254 GAMMFVPESPRFLVEKGRIEEAKRSIGRSNGVSPDDPLTLWELDEIQVVVDKSRAEGEAG 313

Query: 303 WSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVN 362
           WS+LF T+ K+LQR +MG++++ALQQLTG NYFFYYGT +F+AVG++D ++ +++FG+VN
Sbjct: 314 WSDLFDTQHKILQRVIMGIMIMALQQLTGANYFFYYGTTVFQAVGMQDGYEAAIVFGVVN 373

Query: 363 FASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQD-QPSSKGAGNTM 421
           F ST  +L  VD  GRRTCLLWGAAGM CCMVVFASVGVT+LWP G++   +S+GAGN M
Sbjct: 374 FFSTCCSLLFVDSLGRRTCLLWGAAGMTCCMVVFASVGVTRLWPKGKNGGETSQGAGNCM 433

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           I FSCFF+FCFAT+WAP+ FVIISESFPL+VKAKGMAL  VSNQMWNFCIGFFTPFI+GA
Sbjct: 434 ICFSCFFLFCFATSWAPVAFVIISESFPLKVKAKGMALAIVSNQMWNFCIGFFTPFISGA 493

Query: 482 INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTD 541
           INF YGYVF+GCLVF++ YVF FVPETKGLQLEDV+LMW EG LPWKSASWVPPS+RG D
Sbjct: 494 INFAYGYVFMGCLVFAWFYVFFFVPETKGLQLEDVDLMWREGTLPWKSASWVPPSERGAD 553

Query: 542 YNAEALATDDKPIYKRMFSK 561
           Y+ +A+A DD P +K+MF K
Sbjct: 554 YDVDAMANDDTPAWKKMFGK 573

>YOL156W Chr15 (25273..26976) [1704 bp, 567 aa] {ON}  HXT11Putative
           hexose transporter that is nearly identical to Hxt9p,
           has similarity to major facilitator superfamily (MFS)
           transporters and is involved in pleiotropic drug
           resistance
          Length = 567

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/550 (64%), Positives = 438/550 (79%), Gaps = 4/550 (0%)

Query: 15  STAGSVHSSQSFQEMKKDSQDFNEIDSQ--IIEIPKKPASAYLSVCIMCLMVAFGGFISG 72
           S + S   + S +    DS++   +D+    I++P+KP SAY +V I+CLM+AFGGFI G
Sbjct: 17  SNSNSAVGAPSVKTEHGDSKNSLNLDANEPPIDLPQKPLSAYTTVAILCLMIAFGGFIFG 76

Query: 73  WDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV 132
           WDTGTI GF++ SD+I RFG  +  G+ YLSKVR GL+VSIFN+GCAIG +VL ++GD  
Sbjct: 77  WDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFNIGCAIGGIVLSKVGDIY 136

Query: 133 GRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHL 192
           GRR G++    IY+VGI+IQI SI+KWYQYFIGRII+GLG G IAVLSPMLISE++PKH+
Sbjct: 137 GRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKHI 196

Query: 193 RGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           RGTLV  YQLM T G+FLGYCTNYGTK Y N+ QWRV LGLCFAWA  M+  M  VPESP
Sbjct: 197 RGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFAWATFMVSGMMFVPESP 256

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           RYL+E G+ EEAKRS++KSNKV++DDPA + E + ++  +E E+ AG+ASWSEL  TKTK
Sbjct: 257 RYLIEVGKDEEAKRSLSKSNKVSVDDPALLVEYDTIKAGIELEKLAGNASWSELLSTKTK 316

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           V QR LMGV++ +LQQLTG NYFFYYGT IFK+VGL+DSFQTS+I G+VNF S+F+A+Y 
Sbjct: 317 VFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSIIIGVVNFFSSFIAVYT 376

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSKGAGNTMIVFSCFFIF 430
           ++++GRRTCLLWGAA M+CC  VFASVGVTKLWP G      +S+GAGN MIVF+ FFIF
Sbjct: 377 IERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITSQGAGNCMIVFTMFFIF 436

Query: 431 CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVF 490
            FATTWA   +VI+SE+FPLRVK++GMA+ T +N MW F I FFTPFITGAINFYYGYVF
Sbjct: 437 SFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLISFFTPFITGAINFYYGYVF 496

Query: 491 LGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATD 550
           LGCLVF+Y YVF FVPETKGL LE+VN MW EGV  WKSASWVPP +R  DY+A+A+  D
Sbjct: 497 LGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWVPPERRTADYDADAIDHD 556

Query: 551 DKPIYKRMFS 560
           ++PIYKR FS
Sbjct: 557 NRPIYKRFFS 566

>SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P53387 Kluyveromyces lactis
           KHT2 Hexose transporter 2
          Length = 571

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/557 (63%), Positives = 442/557 (79%), Gaps = 5/557 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           S S    D H ST  +  S     E+K  +++  EI   + EIPKKPASAY++V IMCL 
Sbjct: 19  SYSLASADSHLSTPSNKASRADLDELKFQAEE-TEI---VAEIPKKPASAYITVSIMCLC 74

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGS 122
           VAFGGF+ GWDTGTI GF++ +D+  RFG  SHS    YLS VR GL+VSIFNVGCA+G 
Sbjct: 75  VAFGGFVVGWDTGTISGFVNQTDFKRRFGEYSHSKDEYYLSNVRVGLIVSIFNVGCAVGG 134

Query: 123 VVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPM 182
           +VL +LGD  GR  G++    +Y+VGIVIQI+S+DKWYQYFIGRI++GLG G + VL+PM
Sbjct: 135 LVLSKLGDIYGRCIGLMAVTIVYVVGIVIQISSVDKWYQYFIGRIVSGLGVGGVCVLAPM 194

Query: 183 LISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMI 242
           LISE +PKHLRGTL++C+QLM+TF +FLGYC NYGTK+YDNS+QWRVPLGLCFAWA++M+
Sbjct: 195 LISETAPKHLRGTLLACWQLMVTFAIFLGYCANYGTKSYDNSVQWRVPLGLCFAWAIIMV 254

Query: 243 GAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS 302
             M  VPESPR+LV+ G++E+AKRSVAKSNK++++DPA   E++L+   VE E+ AGS+S
Sbjct: 255 VGMCFVPESPRFLVKVGRVEDAKRSVAKSNKISVEDPAVQAEVDLIAAGVEVEKLAGSSS 314

Query: 303 WSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVN 362
           W ELF  KTKV QR +M V++ +LQQL+G NYFFYYGT IFK+VG+EDSF+TS++ GI+N
Sbjct: 315 WGELFSKKTKVFQRLVMSVMINSLQQLSGDNYFFYYGTTIFKSVGMEDSFETSIVIGIIN 374

Query: 363 FASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMI 422
           FASTF++LY +DK GRR  LLWGAA M  CM+++ASVGVT+L+P+G+DQPSSK AGN MI
Sbjct: 375 FASTFLSLYTLDKLGRRRSLLWGAAIMTVCMLIYASVGVTRLYPDGKDQPSSKPAGNCMI 434

Query: 423 VFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI 482
           VF+C +IF FA TW P  +VIISESFPLRVK+K M++ T +N +W F IGFFTPFIT AI
Sbjct: 435 VFTCLYIFFFANTWGPTCYVIISESFPLRVKSKCMSVATGANYLWGFLIGFFTPFITSAI 494

Query: 483 NFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDY 542
           NFYYGYVF+GCLVFSY YVF FVPETKGL LE+V  MW EGVLPWKS SWVP S+R  +Y
Sbjct: 495 NFYYGYVFMGCLVFSYFYVFFFVPETKGLTLEEVEEMWHEGVLPWKSESWVPSSRRDVNY 554

Query: 543 NAEALATDDKPIYKRMF 559
           +AE L  D+KP YKRM 
Sbjct: 555 DAEKLQHDEKPWYKRML 571

>NCAS0F04060 Chr6 (809459..811291) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/572 (63%), Positives = 448/572 (78%), Gaps = 16/572 (2%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSF----------QEMKKDSQDFNEIDSQIIEIPKKPASA 53
           + S   E++ S        SQS           +  K++S+D NE+   ++EIPKKPASA
Sbjct: 42  TMSEVAENIASPEVPQTSGSQSVLSDNSVKAENESFKENSEDANEV---VVEIPKKPASA 98

Query: 54  YLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSI 113
           Y+++ I C M+ FGGFISGWDTGTIGGFL+H DY+ RFG  H +G+ Y S VRTGL+VSI
Sbjct: 99  YVTISIFCCMIGFGGFISGWDTGTIGGFLAHPDYLRRFGQHHKNGTHYFSNVRTGLVVSI 158

Query: 114 FNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGS 173
           FN+G   G ++LG L + +GR+  +V  V I++VGI+IQIASIDKWYQYFIGRII+GLG 
Sbjct: 159 FNIGGLFGCLILGDLANRIGRKMALVAVVVIFMVGIIIQIASIDKWYQYFIGRIISGLGV 218

Query: 174 GTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGL 233
           G I++ SPML+SE++PKHLRGTL S YQLM+T G+FLG CTNYGTK YDNS+QWRVPLGL
Sbjct: 219 GAISIFSPMLLSEVAPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGL 278

Query: 234 CFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVE 293
            FAW L MI AMF VPESPRYLVE G+IEEAKRS+A SNKV++DDPA   E++L+   VE
Sbjct: 279 SFAWCLFMIAAMFFVPESPRYLVEVGKIEEAKRSIATSNKVSMDDPAVQAEVDLISSGVE 338

Query: 294 AEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQ 353
           AE+ AG+ASW ELF TK K +QR  M  ++  LQQLTGCNYFFYYGT+IF+AVG++DS+Q
Sbjct: 339 AERLAGNASWGELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQ 398

Query: 354 TSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNG---QD 410
           T+++FGIVNFASTFVALYVVD++GRR CL+WGAA MVCC VV+ASVGVT+L+P+G   +D
Sbjct: 399 TAIVFGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKD 458

Query: 411 QPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFC 470
             SSKGAGN MI FSCFFIF FA TWAPI +V++SESFPLR+K KGMAL    N  WNF 
Sbjct: 459 TNSSKGAGNCMICFSCFFIFSFACTWAPICWVVVSESFPLRIKPKGMALANGCNWFWNFL 518

Query: 471 IGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSA 530
           I FFTPFITGAINFYYGYVF+GC+VF+Y YVF FVPE KGL LE+VN +WE+GVLPWKS 
Sbjct: 519 ISFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSP 578

Query: 531 SWVPPSQRGTDYNAEALATDDKPIYKRMFSKN 562
            WVP S+RG D + +A   DDKP++K+MF + 
Sbjct: 579 DWVPSSRRGADVDMDAFQKDDKPLFKKMFGRK 610

>KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/537 (65%), Positives = 429/537 (79%), Gaps = 9/537 (1%)

Query: 14  SSTAGSVHSSQSFQEMKKDSQDFNEIDSQ----IIEIPKKPASAYLSVCIMCLMVAFGGF 69
            S AGS  S++S    KKD+    E+DS      +EIPKKPASAY++V I+CLMVAFGGF
Sbjct: 14  ESRAGSFLSNES---NKKDNVII-ELDSSNQELPVEIPKKPASAYITVVIICLMVAFGGF 69

Query: 70  ISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
           + GWDTGTI GFL+ +D++ RFG   +DG+   S +RTGL+VSIF +GCAIG ++  +LG
Sbjct: 70  VFGWDTGTISGFLAQTDFLRRFGELQADGTYAFSNIRTGLVVSIFCLGCAIGGILFSKLG 129

Query: 130 DTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISP 189
           DT GRR  +VI   +Y+VGIVI I++  KWYQY IGR+ AGLG G IAV SP+LISE SP
Sbjct: 130 DTYGRRIALVIVTLVYMVGIVICISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASP 189

Query: 190 KHLRGTLVSCYQLMITFGMFLGYCTNYGTK-TYDNSIQWRVPLGLCFAWALVMIGAMFIV 248
           KHLRGTLVSCYQLMIT G+F+GY  NY TK T  NS+QWR+PLGL F WA++MI AMF V
Sbjct: 190 KHLRGTLVSCYQLMITAGIFVGYILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFV 249

Query: 249 PESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQ 308
           PESPRYL+E G+IEEA+RSVA+SNK+ ++DPA   E+E +  AVEAE+AAGSASW ELF 
Sbjct: 250 PESPRYLIEVGKIEEARRSVARSNKIDVEDPAVTVEVEFLSAAVEAERAAGSASWGELFS 309

Query: 309 TKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFV 368
           T  KVLQR +MG+ V +LQQLTG NYFFYYGT IFK++GLEDSFQTS+I G+VNFASTFV
Sbjct: 310 TNGKVLQRLIMGICVQSLQQLTGANYFFYYGTTIFKSIGLEDSFQTSIIIGVVNFASTFV 369

Query: 369 ALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFF 428
            +Y V+++GRR CLLWGAA M  C  ++ ++GV  L+PNG+ QPSSK AGN MIVF+CF+
Sbjct: 370 GIYFVERFGRRRCLLWGAAVMTVCFAIYGAIGVKALYPNGESQPSSKSAGNVMIVFTCFY 429

Query: 429 IFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGY 488
           IF FATTWAPI FVI++E+FPLRVKAKGMA+   +N  WNF IGFFTPFITGAINFYYG+
Sbjct: 430 IFSFATTWAPIAFVIVAETFPLRVKAKGMAVSVGANWTWNFLIGFFTPFITGAINFYYGF 489

Query: 489 VFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAE 545
           VF+GCL+ ++ YVF FVPETKGL LE+VN MWEEGVLPWKSA+WVPP++R  +YN E
Sbjct: 490 VFMGCLIVAWVYVFFFVPETKGLSLEEVNTMWEEGVLPWKSANWVPPARRDAEYNPE 546

>Kpol_365.10 s365 complement(21800..23701) [1902 bp, 633 aa] {ON}
           complement(21800..23701) [1902 nt, 634 aa]
          Length = 633

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/560 (62%), Positives = 433/560 (77%), Gaps = 1/560 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPK-KPASAYLSVCIMCL 62
            Q+ T +  H+ T  +   +       +   +  E++ ++  I K KP    + V + CL
Sbjct: 74  DQTVTEQSEHNQTLTNNSGTTGILSTDEGKDELTEMEKEVENIEKNKPTGDVIFVAVCCL 133

Query: 63  MVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGS 122
           MVAFGGFI GWDTGTI GF+  +D+I RFG   SDG+ YLS  RTGL+VSIFN+GCAIG 
Sbjct: 134 MVAFGGFIFGWDTGTISGFVRQTDFIRRFGQKRSDGTHYLSNARTGLIVSIFNIGCAIGG 193

Query: 123 VVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPM 182
           V+L + G+  GR+ G+ I V IYI GIVIQIASI+KWYQYFIGRII+GLG G IAVLSP+
Sbjct: 194 VILSKTGEMYGRKIGLTIVVVIYIAGIVIQIASINKWYQYFIGRIISGLGVGGIAVLSPL 253

Query: 183 LISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMI 242
           LISE+SPK LRGTLVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGL FAWAL MI
Sbjct: 254 LISEVSPKQLRGTLVSCYQLMITAGIFLGYCTNFGTKNYHNSVQWRVPLGLSFAWALFMI 313

Query: 243 GAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS 302
             +  VPESPR+LVE G+ EEAKRS+AK+NK TID P  + E+E  +  VE E+  G A 
Sbjct: 314 FGLTFVPESPRFLVEVGKTEEAKRSLAKTNKTTIDSPLVLLELEKYEAGVELEKLEGKAE 373

Query: 303 WSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVN 362
           W EL   K ++ +RTLMG++V +LQQLTG NYFFYYGT IF+AVGL+DSF+T+++ G+VN
Sbjct: 374 WIELITGKPQMFRRTLMGMVVQSLQQLTGANYFFYYGTTIFQAVGLKDSFETAIVLGVVN 433

Query: 363 FASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMI 422
           FASTF ALY VD +GRR CL WGA GMVCC VV+ASVGVT+L+P+G DQP+S GAGN MI
Sbjct: 434 FASTFFALYTVDHFGRRRCLEWGAVGMVCCYVVYASVGVTRLYPHGMDQPTSHGAGNCMI 493

Query: 423 VFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI 482
           VF+ FFIFCFAT+WAPI +VI+SES+PLRV+ K +++    N +WNF I FFTPFIT AI
Sbjct: 494 VFASFFIFCFATSWAPIAYVIVSESYPLRVRGKAISIANACNWIWNFLISFFTPFITSAI 553

Query: 483 NFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDY 542
           NFYYGYVF+GC+VF++ +VF FVPETKGL LE+VN+M+EEGVLPWKSASW+PPS+R   Y
Sbjct: 554 NFYYGYVFMGCMVFAFFFVFFFVPETKGLTLEEVNIMYEEGVLPWKSASWIPPSKRDVGY 613

Query: 543 NAEALATDDKPIYKRMFSKN 562
           + E L  D+KP YKR+FSK+
Sbjct: 614 DVEELKHDNKPFYKRIFSKD 633

>KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/533 (64%), Positives = 424/533 (79%), Gaps = 2/533 (0%)

Query: 15  STAGSVHSSQSFQEMKKDSQDFNEIDSQI-IEIPKKPASAYLSVCIMCLMVAFGGFISGW 73
           S   SVHS  S  + +    +    +  + +EIPKKPASAY++V I+CLMVAFGGF+ GW
Sbjct: 11  SAPDSVHSVPSNGKDENMVLEVGASEQNVPVEIPKKPASAYITVVIICLMVAFGGFVFGW 70

Query: 74  DTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVG 133
           DTGTI GFL+ +D++ RFG   +DG+   S +RTGL+VSIF +GCAIG ++  +LGDT G
Sbjct: 71  DTGTISGFLAQTDFLRRFGELQADGTYAFSNIRTGLVVSIFCLGCAIGGILFSKLGDTYG 130

Query: 134 RRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLR 193
           RR  +VI   +Y+VGIVI I++  KWYQY IGR+ AGLG G IAV SP+LISE SPKHLR
Sbjct: 131 RRIALVIVTLVYMVGIVICISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLR 190

Query: 194 GTLVSCYQLMITFGMFLGYCTNYGTK-TYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           GTLVSCYQLMIT G+F+GY  NY TK T  NS+QWR+PLGL F WA++MI AMF VPESP
Sbjct: 191 GTLVSCYQLMITAGIFVGYILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESP 250

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           RYL+E G+IEEA+RSVA+SNK+ ++DPA   E+E +  AVEAE+AAGSASW ELF T  K
Sbjct: 251 RYLIEVGKIEEARRSVARSNKIDVEDPAVTVEVEFLSAAVEAERAAGSASWGELFSTNGK 310

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           VLQR +MG+ V +LQQLTG NYFFYYGT IFK++GLEDSFQTS+I G+VNFASTFV +Y 
Sbjct: 311 VLQRLIMGICVQSLQQLTGANYFFYYGTTIFKSIGLEDSFQTSIIIGVVNFASTFVGIYF 370

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCF 432
           V+++GRR CLLWGAA M  C  ++ ++GV  L+PNG+ QPSSK AGN MIVF+CF+IF F
Sbjct: 371 VERFGRRRCLLWGAAVMTVCFAIYGAIGVKALYPNGESQPSSKSAGNVMIVFTCFYIFSF 430

Query: 433 ATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLG 492
           ATTWAPI FVI++E+FPLRVKAKGMA+   +N  WNF IGFFTPFITGAINFYYG+VF+G
Sbjct: 431 ATTWAPIAFVIVAETFPLRVKAKGMAVSVGANWTWNFLIGFFTPFITGAINFYYGFVFMG 490

Query: 493 CLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAE 545
           CL+ ++ YVF FVPETKGL LE+VN MWEEGVLPWKSA+WVPP++R  DYN +
Sbjct: 491 CLIVAWVYVFFFVPETKGLSLEEVNTMWEEGVLPWKSANWVPPARRDADYNVQ 543

>YDR345C Chr4 complement(1162957..1164660) [1704 bp, 567 aa] {ON}
           HXT3Low affinity glucose transporter of the major
           facilitator superfamily, expression is induced in low or
           high glucose conditions
          Length = 567

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/559 (65%), Positives = 448/559 (80%), Gaps = 2/559 (0%)

Query: 6   SPTGEDVHSSTAGSVHSSQ--SFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           SP     +S+     +SSQ  +  E K    DF     Q++  P     AY++V I C+M
Sbjct: 9   SPQKSSENSNADLPSNSSQVMNMPEEKGVQDDFQAEADQVLTNPNTGKGAYVTVSICCVM 68

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGGF+ GWDTGTI GF++ +D++ RFG  H DGS YLSKVRTGL+VSIFN+GCAIG +
Sbjct: 69  VAFGGFVFGWDTGTISGFVAQTDFLRRFGMKHKDGSYYLSKVRTGLIVSIFNIGCAIGGI 128

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
           +L +LGD  GR+ G+++ V IYI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPML
Sbjct: 129 ILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPML 188

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE++PK +RGTLVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWAL MIG
Sbjct: 189 ISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG 248

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            M  VPESPRYLVE GQI+EA+ S++K NKV  D P   QE+E+++ +VE  +AAGSASW
Sbjct: 249 GMTFVPESPRYLVEAGQIDEARASLSKVNKVAPDHPFIQQELEVIEASVEEARAAGSASW 308

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            ELF  K  + +RT+MG+++ +LQQLTG NYFFYYGT +F AVG+ DSF+TS++FG+VNF
Sbjct: 309 GELFTGKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVFNAVGMSDSFETSIVFGVVNF 368

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
            ST  +LY VD++GRR CLL+GA GMVCC VV+ASVGVT+LWPNG+   SSKGAGN MIV
Sbjct: 369 FSTCCSLYTVDRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPNGEGNGSSKGAGNCMIV 428

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           F+CF+IFCFATTWAPI +V+ISE+FPLRVK+K M++ T +N +W F IGFFTPFITGAIN
Sbjct: 429 FACFYIFCFATTWAPIAYVVISETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAIN 488

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYN 543
           FYYGYVF+GC+VF+Y YVF FVPETKGL LE+VN M+ EGVLPWKSASWVP SQRG +Y+
Sbjct: 489 FYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYAEGVLPWKSASWVPTSQRGANYD 548

Query: 544 AEALATDDKPIYKRMFSKN 562
           A+AL  DD+P YK+MF K 
Sbjct: 549 ADALMHDDQPFYKKMFGKK 567

>Smik_4.609 Chr4 complement(1089106..1090809) [1704 bp, 567 aa] {ON}
           YDR342C (REAL)
          Length = 567

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/559 (64%), Positives = 448/559 (80%), Gaps = 2/559 (0%)

Query: 6   SPTGEDVHSSTAGSVHSSQ--SFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           SP     +S+T    +SSQ  +  E K    DF +  +Q+   P     AY++V I C+M
Sbjct: 9   SPQKSSENSNTELPSNSSQVMNMPEEKGVQDDFQDEANQVFTNPNTGKGAYVTVSICCVM 68

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGGF+ GWDTGTI GF++ +D++ RFG  H DG+ YLSKVRTGL+VSIFN+GCAIG +
Sbjct: 69  VAFGGFVFGWDTGTISGFVAQTDFVRRFGMKHHDGTFYLSKVRTGLIVSIFNIGCAIGGI 128

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
           +L +LGD  GR+ G+++ V IYI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPML
Sbjct: 129 ILSKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPML 188

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE++PK +RGTLVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWAL MIG
Sbjct: 189 ISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG 248

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            M  VPESPRYLVE GQI++A+ S++K NKV  D P   QE+E+++ +VE  +AAGSASW
Sbjct: 249 GMTFVPESPRYLVEAGQIDQARASLSKVNKVAPDHPFIQQELEVIEASVEEAKAAGSASW 308

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            ELF  K  + +RT+MG+++ +LQQLTG NYFFYYGT +F AVG+ DSF+TS++FGIVN 
Sbjct: 309 GELFTGKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVFNAVGMSDSFETSIVFGIVNL 368

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
            ST  +LY VD++GRR CLLWGA GMVCC VV+ASVGVT+LWPNGQ   SSKGAGN MI 
Sbjct: 369 FSTCCSLYTVDRFGRRNCLLWGAIGMVCCYVVYASVGVTRLWPNGQGNGSSKGAGNCMIC 428

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           F+CF+IFCFATTWAPI +V+ISE+FPLR+K+K M++ T +N +W F IGFFTPFITGAIN
Sbjct: 429 FACFYIFCFATTWAPIAYVVISETFPLRIKSKAMSIATAANWIWGFLIGFFTPFITGAIN 488

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYN 543
           FYYGYVF+GC+VF+Y YVF FVPETKGL LE+VN M+ EGVLPWKSASWVP S+RG DY+
Sbjct: 489 FYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYAEGVLPWKSASWVPTSRRGVDYD 548

Query: 544 AEALATDDKPIYKRMFSKN 562
           A+AL  DD+P YK+MF K 
Sbjct: 549 ADALMHDDQPFYKKMFGKK 567

>NCAS0I03210 Chr9 (600725..602431) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/566 (64%), Positives = 448/566 (79%), Gaps = 10/566 (1%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSF----QEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCI 59
             + T E   +S   S+ S  S     +  K++S + NE+   ++EIPKKPASAY+++ I
Sbjct: 6   ENTATPEVPQTSGTQSILSENSIKAENESFKENSDEGNEV---VVEIPKKPASAYVTISI 62

Query: 60  MCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCA 119
            C M+ FGGFISGWDTGTIGGFL+H DY+ RFG  H +G+ Y S VRTGL+VSIFN+G  
Sbjct: 63  FCCMIGFGGFISGWDTGTIGGFLAHPDYLRRFGQHHKNGTHYFSNVRTGLVVSIFNIGGL 122

Query: 120 IGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVL 179
            G ++LG L + +GR+  +V  V I++VGI+IQIASIDKWYQYFIGRII+GLG G I++ 
Sbjct: 123 FGCLILGDLANRIGRKMALVAVVVIFMVGIIIQIASIDKWYQYFIGRIISGLGVGAISIF 182

Query: 180 SPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWAL 239
           SPML+SE++PKHLRGTL S YQLM+T G+FLG CTNYGTK YDNS+QWRVPLGL FAW L
Sbjct: 183 SPMLLSEVAPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGLSFAWCL 242

Query: 240 VMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAG 299
            MI AMF VPESPRYLVE G+IEEAKRS+A SNKV++DDPA   E++L+   VEAE+ AG
Sbjct: 243 FMIAAMFFVPESPRYLVEVGKIEEAKRSIATSNKVSMDDPAVQAEVDLISSGVEAERLAG 302

Query: 300 SASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFG 359
           +ASW+ELF TK K +QR  M  ++  LQQLTGCNYFFYYGT+IF+AVG++DS+QT+++FG
Sbjct: 303 NASWAELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIVFG 362

Query: 360 IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNG---QDQPSSKG 416
           IVNFASTFVALYVVD++GRR CL+WGAA MVCC VV+ASVGVT+L+P+G   +D  SSKG
Sbjct: 363 IVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSSKG 422

Query: 417 AGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTP 476
           AGN MI FSCFFIF FA TWAPI +V++SESFPLR+K KGMAL    N  WNF I FFTP
Sbjct: 423 AGNCMICFSCFFIFSFACTWAPICWVVVSESFPLRIKPKGMALANGCNWFWNFLISFFTP 482

Query: 477 FITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPS 536
           FITGAINFYYGYVF+GC+VF+Y YVF FVPE KGL LE+VN +WE+GVLPWKS  WVP S
Sbjct: 483 FITGAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPDWVPSS 542

Query: 537 QRGTDYNAEALATDDKPIYKRMFSKN 562
           +RG D + +A   DDKP++K+MF + 
Sbjct: 543 RRGADVDMDAFQKDDKPLFKKMFGRK 568

>NCAS0F00120 Chr6 (11887..13596) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/543 (65%), Positives = 435/543 (80%), Gaps = 8/543 (1%)

Query: 22  SSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGF 81
            ++SF+E  +D+Q+       ++EIPKKPASAY+++ I C M+AFGGF+SGWDTGTIGGF
Sbjct: 33  ENESFKETSEDAQEV------VLEIPKKPASAYVTISIFCCMIAFGGFLSGWDTGTIGGF 86

Query: 82  LSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIA 141
           L+H DY+ RFG  H DG  Y S VRTGL+VSIFN+G  IG +VLG L + +GR+  +V  
Sbjct: 87  LAHPDYLRRFGQHHHDGKHYFSNVRTGLIVSIFNIGGLIGCLVLGDLANRIGRKMALVAV 146

Query: 142 VFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQ 201
             I+++G++IQIASIDKWYQYFIGRII G+G G I++ SPML+SE+SPKHLRGTL S YQ
Sbjct: 147 TIIFMIGLIIQIASIDKWYQYFIGRIIGGVGVGAISIFSPMLLSEVSPKHLRGTLGSMYQ 206

Query: 202 LMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQI 261
           LM+T G+FLG CTNYGTK YDNS+QWRVPLGL FAW L MI AMF VPESPRYLVE G+I
Sbjct: 207 LMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGLSFAWCLFMIAAMFFVPESPRYLVEVGKI 266

Query: 262 EEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGV 321
           EEAKRS+A SNKV++DDPA   E++L+   VEAE+ AG+ASW+ELF TK K +QR  M  
Sbjct: 267 EEAKRSIATSNKVSMDDPAVQAEVDLISSGVEAERLAGNASWAELFSTKGKNIQRLFMCC 326

Query: 322 IVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTC 381
           ++  LQQLTGCNYFFYYGTI+F+AVG+ DS+QT+++FGIVNFASTFVALYVVD++GRR C
Sbjct: 327 MLQCLQQLTGCNYFFYYGTIVFQAVGMSDSYQTAIVFGIVNFASTFVALYVVDRFGRRKC 386

Query: 382 LLWGAAGMVCCMVVFASVGVTKLWPNG--QDQPSSKGAGNTMIVFSCFFIFCFATTWAPI 439
           L+WGAA MVCC VV+ASVGV++L+P G      +SKGAGN MIVFSCFFIF FA TWAPI
Sbjct: 387 LMWGAAAMVCCYVVYASVGVSRLYPEGLKHKDITSKGAGNCMIVFSCFFIFSFACTWAPI 446

Query: 440 PFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYC 499
            +V++SESFPLRVK KGMAL    N  WNF I FFTPFITGAINF YGYVF+GC+VF+Y 
Sbjct: 447 CWVVVSESFPLRVKPKGMALANGCNWFWNFLISFFTPFITGAINFCYGYVFMGCMVFAYF 506

Query: 500 YVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMF 559
           YVF FVPE KGL LE+VN +WEEGVLPWKS  WVP S+RG D   +A   DDKP++K+MF
Sbjct: 507 YVFFFVPEMKGLTLEEVNELWEEGVLPWKSPEWVPSSRRGADVEMDAFQKDDKPLFKKMF 566

Query: 560 SKN 562
            + 
Sbjct: 567 GRK 569

>NCAS0A03030 Chr1 complement(593557..595281) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/568 (64%), Positives = 454/568 (79%), Gaps = 10/568 (1%)

Query: 2   DYSQSPTGEDVHSSTAGSVHSSQSF----QEMKKDSQDFNEIDSQIIEIPKKPASAYLSV 57
           + +++ + E   +S + SV S  S     +  K++S+D N++   ++EIPKKPASAY+++
Sbjct: 10  ETAENSSPEVPQTSGSQSVLSDNSIKAENESFKENSEDANDV---VVEIPKKPASAYVTI 66

Query: 58  CIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVG 117
            I C M+AFGGF+SGWDTGTIGGFL+H DY+ RFG  H DG+ Y S VRTGL+VSIFN+G
Sbjct: 67  SIFCCMIAFGGFLSGWDTGTIGGFLAHPDYLRRFGQHHKDGTHYFSNVRTGLVVSIFNIG 126

Query: 118 CAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIA 177
             IG +VLG L + +GR+  +V  V I++VG++IQIASI+KWYQYFIGRII+GLG G I+
Sbjct: 127 GLIGCLVLGDLANRIGRKMALVAVVIIFMVGLIIQIASINKWYQYFIGRIISGLGVGAIS 186

Query: 178 VLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAW 237
           + SPML+SE++PKHLRGTL S YQLM+T G+FLG CTNYGTK Y NS+QWRVPLGL FAW
Sbjct: 187 IFSPMLLSEVAPKHLRGTLGSMYQLMVTMGIFLGDCTNYGTKKYSNSVQWRVPLGLSFAW 246

Query: 238 ALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQA 297
            L MI AMF VPESPRYLVE G++EEAKRS+A SN+V+IDDPA   E++L+   VEAE+ 
Sbjct: 247 CLFMIAAMFFVPESPRYLVEVGKVEEAKRSIATSNQVSIDDPAVQAEVDLISSGVEAERL 306

Query: 298 AGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLI 357
           AG+ASW ELF TK K +QR  M  ++  LQQLTGCNYFFYYGT+IF+AVG++DS+QT+++
Sbjct: 307 AGNASWVELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIV 366

Query: 358 FGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNG---QDQPSS 414
           FGIVNFASTFVALYVVD++GRR CL+WGAA MVCC VV+ASVGVT+L+P+G   +D  SS
Sbjct: 367 FGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSS 426

Query: 415 KGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFF 474
           KGAGN MI FSCFFIFCFA TWAPI +V++SESFPLR+K KGMAL    N  WNF I FF
Sbjct: 427 KGAGNCMICFSCFFIFCFACTWAPICWVVVSESFPLRIKPKGMALANGCNWFWNFLISFF 486

Query: 475 TPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVP 534
           TPFITGAINFYYGYVF+GC+VF+Y YVF FVPE KGL LE+VN +WE+GVLPWKS  WVP
Sbjct: 487 TPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPDWVP 546

Query: 535 PSQRGTDYNAEALATDDKPIYKRMFSKN 562
            S+RG D + +A   DDKP++K+MF + 
Sbjct: 547 SSRRGADVDMDAFQKDDKPLFKKMFGRK 574

>KAFR0D00760 Chr4 complement(153417..155096) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/544 (64%), Positives = 436/544 (80%), Gaps = 6/544 (1%)

Query: 13  HSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISG 72
           H ST  +  S ++ +E + + ++       I E+PKKP S Y++VC++CL VAFGGFI G
Sbjct: 19  HMSTEDNKASEENLKEYQSNEEN------HINELPKKPLSEYVTVCLLCLSVAFGGFIFG 72

Query: 73  WDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV 132
           WDTGTI GF++ +D++ RFG  H DGS Y S VR GL+V IFN+GCA G ++L ++GD  
Sbjct: 73  WDTGTISGFVAQTDFLRRFGMEHRDGSYYFSNVREGLIVGIFNIGCAFGCILLSKVGDMY 132

Query: 133 GRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHL 192
           GR+ GIV  V +YIVGIVI IAS+DKWYQYFIGRII+G+G G I+VL PMLISE SPKHL
Sbjct: 133 GRKMGIVTVVVVYIVGIVISIASVDKWYQYFIGRIISGMGVGGISVLCPMLISETSPKHL 192

Query: 193 RGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           RGTLVS YQLMIT G+F+GYCTNYGTK+Y NS+QWRVPLGL FAWAL MIG   +VPESP
Sbjct: 193 RGTLVSSYQLMITAGIFVGYCTNYGTKSYSNSVQWRVPLGLGFAWALFMIGGTLLVPESP 252

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           RYL E  +IEEAKRS+A+SNKV+ +DPA   E++L+   +EAE+AAG+ASW ELF TK+K
Sbjct: 253 RYLCEFNKIEEAKRSLARSNKVSTEDPAIQFELDLILGGIEAERAAGTASWGELFSTKSK 312

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           V QR LMG++V ALQQLTG NYFFYYGT IFK+VG+ DSF+TS++ G+VNFASTF ALY 
Sbjct: 313 VFQRVLMGILVQALQQLTGNNYFFYYGTTIFKSVGMSDSFETSIVIGVVNFASTFFALYT 372

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCF 432
           V+ YGRRT LL+GAA M+CCMV++ASVGVT+L+P+GQD+ SSKGAG+ MIVF+CF+IFC+
Sbjct: 373 VEHYGRRTMLLYGAASMMCCMVIYASVGVTRLYPHGQDEASSKGAGDCMIVFTCFYIFCY 432

Query: 433 ATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLG 492
           A +WAP+ +VIISESFPLRV++K M+L + SN +W F I FFTPFITGAINFYYGYVF G
Sbjct: 433 AISWAPVAWVIISESFPLRVRSKCMSLASASNWLWGFLISFFTPFITGAINFYYGYVFTG 492

Query: 493 CLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDK 552
           CL  S+ YV+ F+PETKGL LE++  MW  GVLPWKSA W+PP++RG D++    + DDK
Sbjct: 493 CLFASWFYVYFFIPETKGLTLEEIEEMWTTGVLPWKSAEWLPPARRGADFDQSKFSQDDK 552

Query: 553 PIYK 556
           P YK
Sbjct: 553 PWYK 556

>Suva_2.516 Chr2 complement(919934..921637) [1704 bp, 567 aa] {ON}
           YDR345C (REAL)
          Length = 567

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/559 (65%), Positives = 444/559 (79%), Gaps = 2/559 (0%)

Query: 6   SPTGEDVHSSTAGSVHSSQ--SFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           SP     +S+     +SSQ  +  E K    DF     QI+  P     AY++V I C+M
Sbjct: 9   SPQKSSENSNAELPSNSSQVMNMPEEKGTQDDFQAEADQILSNPNTGKGAYVTVSICCVM 68

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGGF+ GWDTGTI GF++ +D++ RFG  H DGS YLSKVRTGL+V+IFN+GCAIG +
Sbjct: 69  VAFGGFVFGWDTGTISGFVAQTDFLRRFGMKHKDGSYYLSKVRTGLIVAIFNIGCAIGGI 128

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
           VL +LGD  GR+ G+++ V IYI+GI+IQIASIDKWYQYFIGRII+GLG G IAVLSPML
Sbjct: 129 VLAKLGDMYGRKMGLIVVVVIYIIGIIIQIASIDKWYQYFIGRIISGLGVGGIAVLSPML 188

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE++PK +RGTLVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWAL MIG
Sbjct: 189 ISEVAPKDMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG 248

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            M  VPESPRYLVE G+I+EA+ S+++ NKV  D P   QE+E ++ +VE  +AAGSASW
Sbjct: 249 GMTFVPESPRYLVEAGKIDEARSSLSRVNKVAPDHPFIQQELETIEASVEEARAAGSASW 308

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            ELF  K  + +RT+MG+++ +LQQLTG NYFFYYGT +F AVG+ DSF+TS++FG+VNF
Sbjct: 309 GELFTGKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVFNAVGMSDSFETSIVFGVVNF 368

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
            ST  +LY VD++GRR CLL+GA GMVCC VV+ASVGVTKLWPNG+   SSKGAGN MI 
Sbjct: 369 FSTCCSLYTVDRFGRRNCLLYGAVGMVCCYVVYASVGVTKLWPNGEGNGSSKGAGNCMIC 428

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           F+CF+IFCFATTWAPI +V+ISE+FPLRVK+K M++ T +N  W F IGFFTPFITGAIN
Sbjct: 429 FACFYIFCFATTWAPIAYVVISETFPLRVKSKAMSIATAANWFWGFLIGFFTPFITGAIN 488

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYN 543
           FYYGYVF+GC+VF+Y YVF FVPETKGL LE+VN M+ EGVLPWKSASWVP S+RG DYN
Sbjct: 489 FYYGYVFMGCMVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPTSRRGADYN 548

Query: 544 AEALATDDKPIYKRMFSKN 562
           A+AL  DD+P YK MF + 
Sbjct: 549 ADALMHDDQPFYKSMFGRK 567

>CAGL0A02321g Chr1 complement(252192..253862) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P32466 Saccharomyces
           cerevisiae YDR345c HXT3 or uniprot|P42833 Saccharomyces
           cerevisiae YNL318c HXT14
          Length = 556

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/542 (64%), Positives = 433/542 (79%), Gaps = 2/542 (0%)

Query: 22  SSQSFQEMKKDSQDFNEIDSQI-IEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGG 80
           S  S    K+D  D + ++ +  IE P    SAY++V I C +VAFGGFI GWDTGTI G
Sbjct: 16  SQNSDNSYKRDDLDPDTLEKEAKIENPNGK-SAYIAVSISCALVAFGGFIFGWDTGTISG 74

Query: 81  FLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVI 140
           F++ +D+I R GS H+DG+ YLSKVRTGL+V IFN+GCAIG VVL ++GDT GR+ G+V 
Sbjct: 75  FVNQTDFIRRIGSKHADGTSYLSKVRTGLVVGIFNIGCAIGGVVLSKIGDTKGRKAGLVT 134

Query: 141 AVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCY 200
            V IYIVGIVIQIA+IDKWYQYFIGRII+GLG G I+VLSP LISE++PK LRG+LVS Y
Sbjct: 135 VVLIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGISVLSPTLISEVAPKELRGSLVSLY 194

Query: 201 QLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQ 260
           Q+MIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWAL+MIG M  VPESPRYL+E G 
Sbjct: 195 QIMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALLMIGGMTFVPESPRYLIEAGD 254

Query: 261 IEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMG 320
            + A++S+  +NK+  + P   QE  +++  VE   AAG+ASWSEL   K  +L+RT+MG
Sbjct: 255 DDAARKSLCAANKLPAEHPFIEQEFTILKAKVEEANAAGTASWSELITGKPAMLRRTIMG 314

Query: 321 VIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRT 380
           +++ +LQQLTG NYFFYYGT +FKAVGLEDSFQTS++FG+VNF STF++L+ VD++GRR 
Sbjct: 315 IMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFQTSIVFGVVNFFSTFLSLFTVDRFGRRN 374

Query: 381 CLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIP 440
           CLL+GAAGMVCC VV+ASVGVT+LWPNGQ   SSKGAGN MIVFSCF+IFCFATTWAPI 
Sbjct: 375 CLLYGAAGMVCCYVVYASVGVTRLWPNGQGNGSSKGAGNCMIVFSCFYIFCFATTWAPIA 434

Query: 441 FVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCY 500
           +VIISESFPLR+K K M++ + SN +W F I FFTPFIT AINFYYGYVF+GC+VF+Y Y
Sbjct: 435 YVIISESFPLRIKTKAMSIASASNWIWGFLIAFFTPFITNAINFYYGYVFMGCMVFAYFY 494

Query: 501 VFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMFS 560
           VF FV ET+GL LE+V+ M+ EGVLPWKS+ WVP S+R   Y+A+AL  DD P YKR+  
Sbjct: 495 VFFFVNETRGLTLEEVDEMYAEGVLPWKSSKWVPESERDDSYDADALLHDDTPWYKRVIG 554

Query: 561 KN 562
           +N
Sbjct: 555 RN 556

>KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {ON} 
          Length = 549

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/525 (65%), Positives = 424/525 (80%), Gaps = 4/525 (0%)

Query: 25  SFQEMKKDSQ--DFNEIDSQI-IEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGF 81
           S +  KKD+   + +  + ++ +EIPKKPASAY++V I+CLMVAFGGF+ GWDTGTI GF
Sbjct: 20  SHESNKKDNVIIELDPSNPELPVEIPKKPASAYITVVIICLMVAFGGFVFGWDTGTISGF 79

Query: 82  LSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIA 141
           L+ +D++ RFG   +DG+   S +RTGL+VSIF +GCAIG ++  +LGDT GRR  +VI 
Sbjct: 80  LAQTDFLRRFGELQADGTYAFSNIRTGLVVSIFCLGCAIGGILFSKLGDTYGRRIALVIV 139

Query: 142 VFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQ 201
             +Y+VGIVI I++  KWYQY IGR+ AGLG G IAV SP+LISE SPKHLRGTLVSCYQ
Sbjct: 140 TLVYMVGIVICISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQ 199

Query: 202 LMITFGMFLGYCTNYGTK-TYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQ 260
           LMIT G+F+GY  NY TK T  NS+QWR+PLGL F WA++MI AMF VPESPRYL+E G+
Sbjct: 200 LMITAGIFVGYILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGK 259

Query: 261 IEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMG 320
           IEEA+RSVA+SNK+ ++DPA   E+E +  AVEAE+AAGSASW ELF T  KVLQR +MG
Sbjct: 260 IEEARRSVARSNKIDVEDPAVTVEVEFLSAAVEAERAAGSASWGELFSTNGKVLQRLIMG 319

Query: 321 VIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRT 380
           + V +LQQLTG NYFFYYGT IFK++GLEDSFQTS+I G+VNFASTFV +Y V+++GRR 
Sbjct: 320 ICVQSLQQLTGANYFFYYGTTIFKSIGLEDSFQTSIIIGVVNFASTFVGIYFVERFGRRR 379

Query: 381 CLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIP 440
           CLLWGAA M  C  ++ ++GV  L+PNG+ QPSSK AGN MIVF+CF+IF FATTWAPI 
Sbjct: 380 CLLWGAAVMTVCFAIYGAIGVKALYPNGESQPSSKSAGNVMIVFTCFYIFSFATTWAPIA 439

Query: 441 FVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCY 500
           FVI++E+FPLRVKAKGMA+   +N  WNF IGFFTPFITGAINFYYG+VF+GCL+ ++ Y
Sbjct: 440 FVIVAETFPLRVKAKGMAVSVGANWTWNFLIGFFTPFITGAINFYYGFVFMGCLIVAWVY 499

Query: 501 VFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAE 545
           VF FVPETKGL LE+VN MWEEGVLPWKSA+WVPP++R  +YN E
Sbjct: 500 VFFFVPETKGLSLEEVNTMWEEGVLPWKSANWVPPARRDAEYNPE 544

>Suva_10.164 Chr10 (291810..293531) [1722 bp, 573 aa] {ON} YLR081W
           (REAL)
          Length = 573

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/560 (63%), Positives = 439/560 (78%), Gaps = 5/560 (0%)

Query: 5   QSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQI-----IEIPKKPASAYLSVCI 59
           Q    +++ SS +   H S   Q+   D     E++ +I     +E+P KP S Y++V +
Sbjct: 14  QPQAADELVSSLSNDSHLSAPSQKYSNDELKAGEVEPEISHTAPMELPLKPMSEYVTVSL 73

Query: 60  MCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCA 119
           +CL VAFGGF+ GWDTGTI GF++ +D++ RFG  H DG+ YLS VR GL+V+IFN+GCA
Sbjct: 74  LCLCVAFGGFMFGWDTGTISGFVAQTDFLRRFGMKHKDGTYYLSNVRIGLIVAIFNIGCA 133

Query: 120 IGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVL 179
            G ++L + GD  GR+KG++I + +YI+GI+IQIASIDKWYQYFIGRII+GLG G IAVL
Sbjct: 134 FGGIILSKGGDLYGRKKGLLIVIIVYIIGIIIQIASIDKWYQYFIGRIISGLGVGGIAVL 193

Query: 180 SPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWAL 239
            PMLISEI+PKHLRGTLVSCYQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAW+L
Sbjct: 194 CPMLISEIAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWSL 253

Query: 240 VMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAG 299
            MI A+ +VPESPR+L E  ++EEAKRS+AKSNKV+ +DPA   E++L+   VEAE+ AG
Sbjct: 254 FMIFALTLVPESPRFLCEVNKVEEAKRSIAKSNKVSAEDPAVQAELDLIMAGVEAEKLAG 313

Query: 300 SASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFG 359
           +ASW ELF T+TKV QR LMGV+V   QQLTG NYFFYYGTIIFK+VGL DSFQT+++ G
Sbjct: 314 NASWGELFSTRTKVFQRLLMGVLVQMFQQLTGNNYFFYYGTIIFKSVGLSDSFQTAIVIG 373

Query: 360 IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGN 419
           IVNFASTF +L+ V+K GRR CLL GAA M+ CMV++ASVGVT+L+PNG+ QPSSKGAGN
Sbjct: 374 IVNFASTFFSLWTVEKLGRRKCLLLGAASMMACMVIYASVGVTRLYPNGKSQPSSKGAGN 433

Query: 420 TMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFIT 479
            MI F+ F++FC+ATTWAP+ +VI +ESFPLRVK+K MAL + SN +W F I FFTPFIT
Sbjct: 434 CMICFTSFYLFCYATTWAPVAWVITAESFPLRVKSKCMALASASNWVWGFLIAFFTPFIT 493

Query: 480 GAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRG 539
            AINFYYGYVF+GCL   + YVF FVPETKGL LE++  +WEEGVLPWKS  WVP S+RG
Sbjct: 494 SAINFYYGYVFVGCLCAMFFYVFFFVPETKGLSLEEIQELWEEGVLPWKSEGWVPSSRRG 553

Query: 540 TDYNAEALATDDKPIYKRMF 559
            DY+   L  DDKP YK M 
Sbjct: 554 ADYDLNDLQHDDKPWYKAML 573

>NDAI0C04570 Chr3 complement(1042623..1044329) [1707 bp, 568 aa]
           {ON} 
          Length = 568

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/536 (66%), Positives = 440/536 (82%), Gaps = 1/536 (0%)

Query: 27  QEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSD 86
           + M K+  +  EI +++   P    SAY+ V I C MVAFGGF+ GWDTGTI GF++ +D
Sbjct: 34  EGMGKEGSEDLEIVTELSN-PNTGKSAYIGVSISCAMVAFGGFVFGWDTGTISGFVAQTD 92

Query: 87  YINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYI 146
           ++ RFG  H DG+ YLSKVR GL+VSIFN+GCAIG +VL +LGDT GR++G++I V IYI
Sbjct: 93  FLRRFGQKHHDGTHYLSKVRMGLIVSIFNIGCAIGGIVLSKLGDTRGRKQGLIIVVVIYI 152

Query: 147 VGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITF 206
           VGI+IQIAS+  WYQYFIGRII+GLG G IAVLSPMLISE++PK +RGTLVSCYQLMIT 
Sbjct: 153 VGIIIQIASVKAWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKDMRGTLVSCYQLMITL 212

Query: 207 GMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKR 266
           G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWAL MIG M  VPESPRYLVE G+I+EA+ 
Sbjct: 213 GIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEVGKIDEARA 272

Query: 267 SVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLAL 326
           S++  NKV  D P   QE++L++ +VE  +AAGSA+W ELF  K  +LQRT++G+++ +L
Sbjct: 273 SLSTVNKVAGDHPFIQQELDLIEASVEEARAAGSATWGELFTGKPAMLQRTMLGIMIQSL 332

Query: 327 QQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGA 386
           QQLTG NYFFYYGTI+F AVG+ DSF+TS++FG+VN  ST  +LY VD++GRR CLL+GA
Sbjct: 333 QQLTGDNYFFYYGTIVFNAVGMTDSFETSIVFGVVNLFSTGCSLYTVDRFGRRNCLLYGA 392

Query: 387 AGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISE 446
            GM+CC VV+ASVGVT+LWPNGQ   SSKGAGN MI F+CF+IFCFATTWAPI +V+ISE
Sbjct: 393 IGMICCYVVYASVGVTRLWPNGQGNGSSKGAGNCMICFACFYIFCFATTWAPIAYVVISE 452

Query: 447 SFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVP 506
           +FPLRVK+K M++ T +N +W F IGFFTPFITGAINFYYGYVF+GC+VF+Y YVF FVP
Sbjct: 453 TFPLRVKSKAMSVATAANWIWGFLIGFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVP 512

Query: 507 ETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMFSKN 562
           ETKGL LE+VN M+ EGVLPWKSASWVPPS+RG DY+A A A DD P+YKR+FS+N
Sbjct: 513 ETKGLTLEEVNEMYSEGVLPWKSASWVPPSKRGADYDANAFAHDDTPLYKRIFSRN 568

>CAGL0I00286g Chr9 complement(20521..22188) [1668 bp, 555 aa] {ON}
           highly similar to uniprot|P23585 Saccharomyces
           cerevisiae YMR011w HXT2 or uniprot|P39003 Saccharomyces
           cerevisiae YDR343c HXT6 or uniprot|P39004 Saccharomyces
           cerevisiae YDR342c HXT7
          Length = 555

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/548 (66%), Positives = 439/548 (80%), Gaps = 5/548 (0%)

Query: 14  SSTAGSVHSSQSFQEMKKDSQDF----NEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
           SST+ +    Q+  E K + +DF    +E   Q  EIP+KP  AY +V  +CLM+AFGGF
Sbjct: 7   SSTSATDPERQT-PETKLEGEDFQLKADEASIQGAEIPRKPLGAYWTVMCLCLMIAFGGF 65

Query: 70  ISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
           + GWDTGTI GF++ +D+  RFG  HSDG+ YLS VRTGL+V+IFN+GCA G + LGR G
Sbjct: 66  VFGWDTGTISGFVAQTDFKRRFGQRHSDGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRTG 125

Query: 130 DTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISP 189
           D  GR+KG+VI V +Y+VGI+IQIAS+DKWYQYFIGRII+GLG G IAVLSP LISE +P
Sbjct: 126 DLYGRKKGLVIVVSVYVVGIIIQIASVDKWYQYFIGRIISGLGVGGIAVLSPTLISETAP 185

Query: 190 KHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVP 249
           KHLRGT VS YQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAWAL MIG M +VP
Sbjct: 186 KHLRGTCVSFYQLMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMSMVP 245

Query: 250 ESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQT 309
           ESPR+LVEKG++EEA+RS+A SNK+++DDP    E++ +   VEAE+ AGSASW ELF  
Sbjct: 246 ESPRFLVEKGRLEEARRSIAISNKLSMDDPGVTFELDTISAGVEAERLAGSASWGELFSN 305

Query: 310 KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVA 369
           K K+L R +MGV++ +LQQLTG NYFFYYGT IFKAVGLEDSFQTS++ GIVNFASTFV 
Sbjct: 306 KGKILPRVIMGVMIQSLQQLTGNNYFFYYGTTIFKAVGLEDSFQTSIVLGIVNFASTFVG 365

Query: 370 LYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFI 429
           L+ V+++GRR CLLWG+A M  C V+FASVGV  L+P+G+D  SSKGAGN MIVF+CFFI
Sbjct: 366 LWTVERFGRRRCLLWGSATMAACFVIFASVGVKSLYPHGRDHASSKGAGNCMIVFTCFFI 425

Query: 430 FCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYV 489
           FCFATTWAPI +VI+SE++PLRVK + MA+   SN +W F IGFFTPFIT AINF YGYV
Sbjct: 426 FCFATTWAPIAYVIVSETYPLRVKNRAMAIAVGSNWIWGFLIGFFTPFITSAINFSYGYV 485

Query: 490 FLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALAT 549
           F+GCLVFSY YVF FV ETKGL LE+VN M+EEGVLPWKS +WVPPS+R   Y+ +A+  
Sbjct: 486 FMGCLVFSYFYVFFFVCETKGLTLEEVNDMYEEGVLPWKSPNWVPPSRRDASYDIDAMMH 545

Query: 550 DDKPIYKR 557
           DDKP YKR
Sbjct: 546 DDKPWYKR 553

>KAFR0D00800 Chr4 complement(170100..171776) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/551 (62%), Positives = 426/551 (77%), Gaps = 2/551 (0%)

Query: 9   GEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGG 68
           G  V + +  S  S++   +  KD Q  +++  ++  +P+KP   Y+ VCI CL VAFGG
Sbjct: 10  GHSVSNDSRMSTPSNKVSVDELKDGQVQDQV--ELAGLPQKPMGDYIGVCISCLCVAFGG 67

Query: 69  FISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRL 128
           FI GWDTGTI GF++ +D++ RFG  H+ GS YLS VR GL+V IFN+GCA G ++L +L
Sbjct: 68  FIFGWDTGTISGFVAQTDFLERFGQKHASGSYYLSNVREGLIVGIFNIGCAFGGIILSKL 127

Query: 129 GDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEIS 188
           GD  GR+ G+     IYIVG VI IAS+DKWYQYFIGRI+AGLG G IAVLSPMLISE S
Sbjct: 128 GDMYGRKIGLTCVTIIYIVGQVICIASVDKWYQYFIGRIVAGLGVGGIAVLSPMLISETS 187

Query: 189 PKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIV 248
           PKHLRGTLVSCYQLM T G+FLGYCTNYGT  Y NS+QWRV LG+ FAWAL MIG +  V
Sbjct: 188 PKHLRGTLVSCYQLMCTAGIFLGYCTNYGTSKYSNSVQWRVALGISFAWALFMIGGLTFV 247

Query: 249 PESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQ 308
           PESPRYL EK +IE+AK+++A SNKV++DDPA   EI+ +   V AE+ AG+AS  ELF 
Sbjct: 248 PESPRYLCEKDRIEDAKKAIAMSNKVSVDDPAVQVEIDSIMAGVIAEREAGTASIGELFS 307

Query: 309 TKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFV 368
           TKTKV QR +MG+++ + QQLTG NYFFYYGT IF+AVG+ +SF+T+++ GIVNFASTFV
Sbjct: 308 TKTKVFQRLVMGIMIQSFQQLTGDNYFFYYGTTIFQAVGMTNSFETAIVLGIVNFASTFV 367

Query: 369 ALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFF 428
           +L VVD+YGRR CLLWGAA M  CMV++ASVGV  L+P+G+  PSSK AG+ MIVF+CF+
Sbjct: 368 SLVVVDRYGRRACLLWGAASMAVCMVIYASVGVKSLYPHGRSNPSSKSAGDVMIVFTCFY 427

Query: 429 IFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGY 488
           IFCFATTW PI +V++SESFPLRVK++ MAL T +N +W F I FFTPFI  +I+F YGY
Sbjct: 428 IFCFATTWGPIAWVVVSESFPLRVKSQCMALATAANWLWGFLISFFTPFINSSIHFAYGY 487

Query: 489 VFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALA 548
           VFLGCLV  + YVF FVPETKGL LE++  MWEEGVLPWKSA WVPPS+RG ++++E L 
Sbjct: 488 VFLGCLVAMWFYVFFFVPETKGLSLEEIQEMWEEGVLPWKSAGWVPPSRRGGEFDSEDLT 547

Query: 549 TDDKPIYKRMF 559
            DDKP YK M 
Sbjct: 548 KDDKPWYKAML 558

>KAFR0D00780 Chr4 (163688..165370) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/557 (63%), Positives = 436/557 (78%), Gaps = 7/557 (1%)

Query: 8   TGEDVHSSTAGSVHSSQSFQEMKKDSQD-----FNEIDSQIIEIPKKPASAYLSVCIMCL 62
           + E++++S   S HS QS    K    D     F   + Q++ +PKKP SAY    ++ L
Sbjct: 6   SNEELNTSV--SNHSEQSTVSNKASEHDLKDENFQGEEEQVVGLPKKPFSAYTKSVVILL 63

Query: 63  MVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGS 122
            VAFGGF+ GWDTGTIGGF++H DY+ RFG  HSDGS Y S VR GLLV IFN+GCAIG 
Sbjct: 64  CVAFGGFVFGWDTGTIGGFMAHPDYLQRFGMQHSDGSYYFSNVREGLLVGIFNIGCAIGG 123

Query: 123 VVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPM 182
           ++L +LGD  GR+ G+   + IYIVG VI IAS++ WYQY IGRII+GLG G IAVLSPM
Sbjct: 124 IILSKLGDMYGRKFGLTCVIIIYIVGQVICIASVEAWYQYLIGRIISGLGIGGIAVLSPM 183

Query: 183 LISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMI 242
           L+SE SPKH+RGTLVSCYQLM T G+F+GYC NYGTK+YDNS+QWRVPLGL FAWAL MI
Sbjct: 184 LLSESSPKHIRGTLVSCYQLMCTAGIFIGYCVNYGTKSYDNSVQWRVPLGLSFAWALFMI 243

Query: 243 GAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS 302
           G +  V ESPRYL E  +IEEAK ++ K+N V I+DPA   E++ +  ++E E+AAG+AS
Sbjct: 244 GGLTFVSESPRYLCEANKIEEAKVAIGKTNLVDIEDPAVQAEVDAIMASLEVERAAGNAS 303

Query: 303 WSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVN 362
           W+ELF TK KVLQR +MG+++ ALQQLTG NYFFYYGTIIF+AVG++DS++TS++ GIVN
Sbjct: 304 WAELFSTKGKVLQRLIMGIMLQALQQLTGDNYFFYYGTIIFEAVGMDDSYETSIVLGIVN 363

Query: 363 FASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMI 422
           FASTFV+LY+VD YGRRTCLLWGAAGM+CCMV++ASVGV  L+P+G+  PSSKGAGN MI
Sbjct: 364 FASTFVSLYIVDHYGRRTCLLWGAAGMICCMVIYASVGVKSLYPHGRSNPSSKGAGNCMI 423

Query: 423 VFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI 482
           VF+CF+IFCFATTW P  +V+ISE++PLR+++KGMAL T SN +W F I FFTPFI  AI
Sbjct: 424 VFTCFYIFCFATTWGPCIWVLISETYPLRIRSKGMALATASNWIWGFLISFFTPFINSAI 483

Query: 483 NFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDY 542
           +F YGYVFLGCLVFS+ YVF  VPETKGL LE++  MW  GVLPWKS+ WVP ++RG ++
Sbjct: 484 HFAYGYVFLGCLVFSWFYVFFIVPETKGLTLEEIEEMWVTGVLPWKSSGWVPAARRGAEF 543

Query: 543 NAEALATDDKPIYKRMF 559
           +AE    DDKP YK MF
Sbjct: 544 DAENFTHDDKPWYKAMF 560

>KLTH0B00330g Chr2 (29891..31591) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P54862 Saccharomyces cerevisiae
           YOL156W HXT11 Putative hexose transporter that is nearly
           identical to Hxt9p, has similarity to major facilitator
           superfamily (MFS) transporters and is involved in
           pleiotropic drug resistance
          Length = 566

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/552 (63%), Positives = 436/552 (78%), Gaps = 7/552 (1%)

Query: 14  SSTAGSVHSSQSFQ-EMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISG 72
           S+  GS+ S +    E +KD  +F   ++ I E+PK+P S Y S+ I+CLM+AFGGFI G
Sbjct: 19  STKPGSISSHEKLDIEREKDLHNFPPHENDI-ELPKQPLSHYFSISILCLMIAFGGFIFG 77

Query: 73  WDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV 132
           WDTGTI GF++ SD++ RFGS +S G  YLSKVR GL++SIFN+GCAIG +VL ++GD  
Sbjct: 78  WDTGTISGFVNLSDFVRRFGSRNSKGVYYLSKVRMGLIISIFNIGCAIGGIVLSKIGDVY 137

Query: 133 GRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHL 192
           GRR G++    +Y++GI+IQI+S DKWYQYFIGRII+GLG G IAVLSPML+SE+SPKH+
Sbjct: 138 GRRIGLISVTIVYVIGIIIQISSTDKWYQYFIGRIISGLGVGGIAVLSPMLLSEVSPKHI 197

Query: 193 RGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           RG LV+ YQL+ T G+FLGYCTNYGTK Y +S QWRV LGLCFAWA++MI  M  VPESP
Sbjct: 198 RGMLVNLYQLLGTMGIFLGYCTNYGTKKYTDSTQWRVGLGLCFAWAMLMISGMLFVPESP 257

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           RYLVE G++EEAKRS+++SNKV IDDPA   E++ +   VE+E+ AG A+W EL  TKTK
Sbjct: 258 RYLVEAGKLEEAKRSLSRSNKVLIDDPAIAAELDAISAGVESERLAGDATWGELLSTKTK 317

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           V+QR +MG+++ +LQQLTG NYFFYYGT IFK++GLEDSF+TS+I G VNF S+F+A+Y 
Sbjct: 318 VIQRVIMGIMIQSLQQLTGDNYFFYYGTTIFKSIGLEDSFETSIIIGAVNFFSSFIAIYT 377

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSKGAGNTMIVFSCFFIF 430
           ++++GRRTCLLWGAA M CC +VFASVGVTKLWP G D P  SSKGAGN MIVF+ FFIF
Sbjct: 378 IERFGRRTCLLWGAASMFCCFIVFASVGVTKLWPEGPDHPGISSKGAGNCMIVFTMFFIF 437

Query: 431 CFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVF 490
            FATTWA   +VI+SE+FPLRVK+KGMAL T +N MW F I FFTPFITGAINFYYGYVF
Sbjct: 438 SFATTWAGCCYVIVSETFPLRVKSKGMALSTAANWMWGFLISFFTPFITGAINFYYGYVF 497

Query: 491 LGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATD 550
           +GCL+F+Y YVF FVPETKGL LE+V++MW E V  W S+SWVPP++R  DY    + T 
Sbjct: 498 MGCLIFAYFYVFFFVPETKGLTLEEVDIMWLESVPAWNSSSWVPPTRRSADY---VVDTS 554

Query: 551 DKPIYKRMFSKN 562
            K  + + FSKN
Sbjct: 555 SKNFFSKFFSKN 566

>KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/547 (62%), Positives = 423/547 (77%), Gaps = 2/547 (0%)

Query: 13  HSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISG 72
           + S   +V +  S  E+K +S D  E   Q I +PKKP SAY    I+ L VAFGGFI G
Sbjct: 17  NRSQQSTVSNKVSDNEIKDESYD--EQAGQEITLPKKPISAYSKFIILSLCVAFGGFIFG 74

Query: 73  WDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV 132
           WDTGTI GF++ +D++ RFG  +S G  YLS VR GL+V IFN+GCA G ++L +LGD  
Sbjct: 75  WDTGTISGFVAQTDFLQRFGELNSSGEYYLSNVREGLIVGIFNIGCAFGGIILSKLGDMY 134

Query: 133 GRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHL 192
           GR+ G+     IYIVG VI IAS+DKWYQYFIGRI+AGLG G IAVLSPMLISE SPKHL
Sbjct: 135 GRKIGLTCVTIIYIVGQVICIASVDKWYQYFIGRIVAGLGVGGIAVLSPMLISETSPKHL 194

Query: 193 RGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           RGTLVSCYQLM T G+FLGYCTNYGT  Y NS+QWRV LG+ FAWAL MIG +  VPESP
Sbjct: 195 RGTLVSCYQLMCTAGIFLGYCTNYGTSKYSNSVQWRVALGISFAWALFMIGGLTFVPESP 254

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           RYL EK +IE+AK+++A SNKV++DDPA   E++ +  ++EAE+AAG+ASW ELF  K K
Sbjct: 255 RYLCEKDRIEDAKKAIAMSNKVSVDDPAVQAEVDAIMASLEAERAAGNASWGELFSPKGK 314

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           +LQR +MGV++ ALQQLTG NYFFYYGT IF+AVG+ +SF+T+++ GIVNFASTFV+LYV
Sbjct: 315 ILQRLIMGVMLQALQQLTGDNYFFYYGTTIFQAVGMTNSFETAIVLGIVNFASTFVSLYV 374

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCF 432
           +D+YGRRTCLLWGAA M  CMV++ASVGV  L+P+G+  PSSK AG+ MIVF+C +IFCF
Sbjct: 375 IDRYGRRTCLLWGAASMAVCMVIYASVGVKSLYPHGRSNPSSKSAGDVMIVFTCLYIFCF 434

Query: 433 ATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLG 492
           ATTW P  +V+ISE++PLR+++KGMAL T SN +W F I FFTPFI  AI+F YGYVFLG
Sbjct: 435 ATTWGPCIWVLISETYPLRIRSKGMALATASNWIWGFLISFFTPFINSAIHFAYGYVFLG 494

Query: 493 CLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDK 552
           CLVFS+ YVF  VPETKGL LE++  MW  GVLPWKS  WVP ++RG +++AE    DDK
Sbjct: 495 CLVFSWFYVFFIVPETKGLTLEEIEEMWITGVLPWKSNGWVPAARRGAEFDAEDFTHDDK 554

Query: 553 PIYKRMF 559
           P YK M 
Sbjct: 555 PWYKAML 561

>NCAS0C02990 Chr3 (563467..565173) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/560 (64%), Positives = 442/560 (78%), Gaps = 4/560 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKD-SQDFNEIDSQIIEIPKKPASAYLSVCIMCL 62
            Q+P       S + SV S  S +    +  ++ +E+  Q+++IPKKPASAYL++ I C 
Sbjct: 6   EQNPEVPIEQHSGSQSVLSDSSVKADNDNLKENSDELAEQVVDIPKKPASAYLTISIFCT 65

Query: 63  MVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGS 122
           M+ FGGFI GWDTGTIGGFL+H DY+ RFG  H DG+ Y S VRTGL+VSIFN+G   G 
Sbjct: 66  MIGFGGFICGWDTGTIGGFLAHPDYLKRFGQHHHDGTHYFSNVRTGLVVSIFNIGGLFGC 125

Query: 123 VVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPM 182
           ++LG L D +GR+  +V    I+++GI+IQIASIDKWYQYFIGRII+G+G G I++ SPM
Sbjct: 126 LILGGLADRIGRKMALVAVTVIFMIGIIIQIASIDKWYQYFIGRIISGMGVGAISIFSPM 185

Query: 183 LISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMI 242
           L+ E++PKHLRGTL S YQLM+TFG+FLG CTNYGTK Y+NS+QWRVPLGL FAW L MI
Sbjct: 186 LLGEVAPKHLRGTLGSMYQLMVTFGIFLGDCTNYGTKNYNNSVQWRVPLGLSFAWCLFMI 245

Query: 243 GAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS 302
            AMF VPESPRYLVE G++EEAKRS+A SNKV++DDPA   E +L+   +EAE+ AG+AS
Sbjct: 246 AAMFFVPESPRYLVEVGKVEEAKRSIATSNKVSVDDPAVQAECDLITSGIEAERLAGNAS 305

Query: 303 WSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVN 362
           W ELF TK KV+QR LM  ++  LQQLTGCNYFFYYGT+IF+AVGL+DS+QT+++FGIVN
Sbjct: 306 WGELFSTKGKVVQRLLMCCMLQCLQQLTGCNYFFYYGTVIFQAVGLKDSYQTAIVFGIVN 365

Query: 363 FASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNG---QDQPSSKGAGN 419
           FASTFVA YVVD YGRR CL+WGAA MVCC VV+ASVGVT+L+P+G   +D  SSKGAGN
Sbjct: 366 FASTFVAFYVVDHYGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSSKGAGN 425

Query: 420 TMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFIT 479
            MIVFSCFFIF FA TWAPI +V++SESFPL++K KGMAL    N  WNF + FFTPFIT
Sbjct: 426 CMIVFSCFFIFSFACTWAPICWVVVSESFPLKIKPKGMALANGCNWFWNFLVSFFTPFIT 485

Query: 480 GAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRG 539
           GAINFYYGYVF+GC+VF+Y YVF FVPE KGL LE+V+ +W+EGVLPWKS  WVP S+RG
Sbjct: 486 GAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVDELWQEGVLPWKSPDWVPASRRG 545

Query: 540 TDYNAEALATDDKPIYKRMF 559
            D + +A   DDKP +K+MF
Sbjct: 546 ADVDLDAFQKDDKPFFKKMF 565

>YHR094C Chr8 complement(290913..292625) [1713 bp, 570 aa] {ON}
           HXT1Low-affinity glucose transporter of the major
           facilitator superfamily, expression is induced by Hxk2p
           in the presence of glucose and repressed by Rgt1p when
           glucose is limiting
          Length = 570

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/559 (63%), Positives = 444/559 (79%), Gaps = 1/559 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           S S    ++ S  + ++++ +   E   D+   +++   +   P      Y++V I C+M
Sbjct: 13  SNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQPAVAP-PNTGKGVYVTVSICCVM 71

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGGFI GWDTGTI GF++ +D++ RFG  H DGS YLSKVRTGL+VSIFN+GCAIG +
Sbjct: 72  VAFGGFIFGWDTGTISGFVAQTDFLRRFGMKHHDGSHYLSKVRTGLIVSIFNIGCAIGGI 131

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
           VL +LGD  GRR G+++ V IY +GI+IQIASI+KWYQYFIGRII+GLG G I VLSPML
Sbjct: 132 VLAKLGDMYGRRIGLIVVVVIYTIGIIIQIASINKWYQYFIGRIISGLGVGGITVLSPML 191

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE++P  +RGTLVSCYQ+MIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWAL MIG
Sbjct: 192 ISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG 251

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            M  VPESPRYLVE G+I+EA+ S+AK NK   D P    E+E ++ +VE  +AAG+ASW
Sbjct: 252 GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVEEMRAAGTASW 311

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            ELF  K  + QRT+MG+++ +LQQLTG NYFFYYGTI+F+AVGL DSF+TS++FG+VNF
Sbjct: 312 GELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFQAVGLSDSFETSIVFGVVNF 371

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
            ST  +LY VD++GRR CL+WGA GMVCC VV+ASVGVT+LWPNGQDQPSSKGAGN MIV
Sbjct: 372 FSTCCSLYTVDRFGRRNCLMWGAVGMVCCYVVYASVGVTRLWPNGQDQPSSKGAGNCMIV 431

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           F+CF+IFCFATTWAPI +V+ISE FPLRVK+K M++ + +N +W F I FFTPFITGAIN
Sbjct: 432 FACFYIFCFATTWAPIAYVVISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAIN 491

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYN 543
           FYYGYVF+GC+VF+Y YVF FVPETKGL LE+VN M+ EGVLPWKSASWVP S+RG DYN
Sbjct: 492 FYYGYVFMGCMVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN 551

Query: 544 AEALATDDKPIYKRMFSKN 562
           A+ L  DD+P YK +FS+ 
Sbjct: 552 ADDLMHDDQPFYKSLFSRK 570

>TBLA0A03510 Chr1 complement(865967..867679) [1713 bp, 570 aa] {ON}
           Anc_5.396 YHR096C
          Length = 570

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/499 (67%), Positives = 411/499 (82%), Gaps = 1/499 (0%)

Query: 65  AFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVV 124
           AFGGFI GWDTGTI GF++ +D++ RFGS H+DG+ YLSKVR GL+VSIFN+GCAIG +V
Sbjct: 72  AFGGFIFGWDTGTISGFVAQTDFVRRFGSKHADGTPYLSKVRMGLIVSIFNIGCAIGGIV 131

Query: 125 LGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLI 184
           L ++GD  GR+ G+   V IYIVGIVIQIASIDKWYQYFIGRII+GLG G IAV SPMLI
Sbjct: 132 LSKVGDVYGRKMGLTTVVLIYIVGIVIQIASIDKWYQYFIGRIISGLGVGGIAVFSPMLI 191

Query: 185 SEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGA 244
           SE+SPK +RG +VSCYQLMIT G+FLGYCTNYGTK YD+S QWRVPLGLCFAWAL M+G 
Sbjct: 192 SEVSPKAMRGAMVSCYQLMITLGIFLGYCTNYGTKNYDDSTQWRVPLGLCFAWALFMLGG 251

Query: 245 MFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS 304
           M +VPESPRYLVE G+ EEA+ S+AK NK   D P   QE++L+  +VE E+ AG ASWS
Sbjct: 252 MTLVPESPRYLVEVGKTEEARASLAKVNKCAGDHPFIQQELDLIVSSVELEKTAGVASWS 311

Query: 305 ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFA 364
           EL + K ++ QRT++G++V +LQQLTG NYFFYYGT +F AVG+ DSF+TS++FG+VN  
Sbjct: 312 ELIKGKPQMFQRTMIGILVQSLQQLTGDNYFFYYGTTVFTAVGMNDSFETSIVFGVVNLF 371

Query: 365 STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSKGAGNTMIV 423
           STF +L+ VD++GRR CLLWGA GMVCC VVFASVGVT+LWP G+D   +SKGAGN MIV
Sbjct: 372 STFCSLFTVDRFGRRNCLLWGAVGMVCCYVVFASVGVTRLWPEGKDAGVTSKGAGNCMIV 431

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           FSCF+IFCFAT+WAPI +VI+SE+FPLRVK+K M++ T +N +W F IGFFTPFITGAIN
Sbjct: 432 FSCFYIFCFATSWAPIAYVIVSETFPLRVKSKAMSISTAANWIWGFLIGFFTPFITGAIN 491

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYN 543
           FYYGYVF+GC+VF++ YVF  VPETKGL LE+V+ M+ EGVLPWKS++WVP S+R   +N
Sbjct: 492 FYYGYVFMGCMVFAWFYVFFCVPETKGLTLEEVDEMYTEGVLPWKSSNWVPISRRDDSHN 551

Query: 544 AEALATDDKPIYKRMFSKN 562
              +  D KP+YK+MF KN
Sbjct: 552 ISDIKDDGKPLYKKMFGKN 570

>Suva_10.165 Chr10 (295189..296898) [1710 bp, 569 aa] {ON} YEL069C
           (REAL)
          Length = 569

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/536 (65%), Positives = 432/536 (80%), Gaps = 6/536 (1%)

Query: 25  SFQEMKKDS--QDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFL 82
           S +E+K +   QD+    S  +E+P KP S Y++V ++CL VAFGGF+ GWDTGTI GF+
Sbjct: 37  SNEELKNEELGQDY----SAPMELPLKPMSEYVTVSLLCLCVAFGGFMFGWDTGTISGFV 92

Query: 83  SHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAV 142
           + +D++ RFG  H DG+ YLS VR GL+V+IFN+GCA G ++L + GD  GR+KG++I +
Sbjct: 93  AQTDFLRRFGMKHKDGTYYLSNVRIGLIVAIFNIGCAFGGIILSKGGDLYGRKKGLLIVI 152

Query: 143 FIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQL 202
            +YI+GI+IQIAS++KWYQYFIGRII+GLG G IAVL PMLISEI+PKHLRGTLVSCYQL
Sbjct: 153 IVYIIGIIIQIASVNKWYQYFIGRIISGLGVGGIAVLCPMLISEIAPKHLRGTLVSCYQL 212

Query: 203 MITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIE 262
           MIT G+FLGYCTNYGTK Y NS+QWRVPLGLCFAW+L MI A+ +VPESPR+L E  ++E
Sbjct: 213 MITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWSLFMIFALTLVPESPRFLCEVNKVE 272

Query: 263 EAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVI 322
           EAKRS+AKSNKV+ +DPA   E++L+   VEAE+ AG+ASW ELF T+TKV QR LMGV+
Sbjct: 273 EAKRSIAKSNKVSAEDPAVQAELDLIMAGVEAEKLAGNASWGELFSTRTKVFQRLLMGVL 332

Query: 323 VLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCL 382
           V   QQLTG NYFFYYGTIIFK+VGL DSFQT+++ GIVNFASTF +L+ V+K GRR CL
Sbjct: 333 VQMFQQLTGNNYFFYYGTIIFKSVGLSDSFQTAIVIGIVNFASTFFSLWTVEKLGRRKCL 392

Query: 383 LWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFV 442
           L GAA M+ CMV++ASVGVT+L+PNG+  PSSKGAGN MI F+ F++FC+ATTWAP+ +V
Sbjct: 393 LLGAASMMACMVIYASVGVTRLYPNGKSHPSSKGAGNCMICFTSFYLFCYATTWAPVAWV 452

Query: 443 IISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVF 502
           I +ESFPLRVK+K MAL + SN +W F I FFTPFIT AINFYYGYVF+GCL   + YVF
Sbjct: 453 ITAESFPLRVKSKCMALASASNWVWGFLIAFFTPFITSAINFYYGYVFVGCLCAMFFYVF 512

Query: 503 AFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRM 558
            FVPETKGL LE++  +WEEGVLPWKS  WVP S+RG DY+ E L  DDKP YK +
Sbjct: 513 FFVPETKGLSLEEIQELWEEGVLPWKSEGWVPSSRRGADYDLEGLQHDDKPWYKAL 568

>KNAG0B04370 Chr2 (835663..837336) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/550 (64%), Positives = 438/550 (79%), Gaps = 6/550 (1%)

Query: 13  HSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISG 72
           +SS      S+ S    +KD    +E +   IE P    SA ++V + C MVAFGGFI G
Sbjct: 14  NSSIDDGFESNNSKIINQKDDIQQSECE---IESPNNNKSALMAVALSCGMVAFGGFIFG 70

Query: 73  WDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV 132
           WDTGTI GF++ +D++ RFG  ++DG+ YLSKVRTGL+VSIFN+GCAIG +VL +LGDT 
Sbjct: 71  WDTGTISGFVAQTDFLRRFGQKNADGTHYLSKVRTGLVVSIFNIGCAIGGLVLAKLGDTH 130

Query: 133 GRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHL 192
           GR+  + I V IYIVGIVIQIASI+KWYQYFIGRII+GLG G I+VLSPMLISE+SPK L
Sbjct: 131 GRKLALAIVVSIYIVGIVIQIASINKWYQYFIGRIISGLGVGGISVLSPMLISEVSPKQL 190

Query: 193 RGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           RGTLVS YQLMIT G+FLGYCTN+GTK YDNS+QWRVPLGL FAWAL+MIG +  VPESP
Sbjct: 191 RGTLVSSYQLMITLGIFLGYCTNFGTKNYDNSVQWRVPLGLSFAWALLMIGGLSFVPESP 250

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           RYL+EKG+++EA+ S+A++NK   D P    E++ +  +VE  +AAG A+W ELF  K  
Sbjct: 251 RYLIEKGRMDEARDSLAQANKCAPDHPFVQHELDTISASVEETRAAGDATWMELF--KPF 308

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           + +RT MGV++ +LQQLTG NYFFYYGTI+FKAVGLEDSF+TS++FG+VNF ST  +LY 
Sbjct: 309 MFKRTSMGVMIQSLQQLTGDNYFFYYGTIVFKAVGLEDSFETSIVFGVVNFFSTCCSLYT 368

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCF 432
           VD++GRR CLLWGA GM+CC VV+ASVGVT+LW +GQD P SKGAGN MI F+CF+IFCF
Sbjct: 369 VDRFGRRNCLLWGAVGMICCYVVYASVGVTRLWADGQDNP-SKGAGNCMICFACFYIFCF 427

Query: 433 ATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLG 492
           ATTWAPI +VIISE+FPLR+K+K M+L T SN +W F I FFTPFIT AINF YGYVF+G
Sbjct: 428 ATTWAPIAYVIISETFPLRIKSKAMSLATASNWIWGFLISFFTPFITQAINFSYGYVFMG 487

Query: 493 CLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDK 552
           C+VF+Y YVF FV ETKGL LE+V +M+ EGVLPWKS++WVPPS+R  DY+ +AL  DD 
Sbjct: 488 CMVFAYFYVFFFVSETKGLTLEEVEVMYSEGVLPWKSSAWVPPSRRAADYDVDALMHDDV 547

Query: 553 PIYKRMFSKN 562
           P YKR+F++N
Sbjct: 548 PFYKRVFARN 557

>KNAG0C05180 Chr3 (1007743..1009410) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/555 (65%), Positives = 444/555 (80%), Gaps = 3/555 (0%)

Query: 8   TGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFG 67
           T + +    + S +S+        + QD  +  +  +  P     AY+S+CI C MVAFG
Sbjct: 4   TPDAITPQKSESSNSNVEVNSKIMNQQDDFQYQNAEVASPNTGRGAYMSICISCCMVAFG 63

Query: 68  GFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGR 127
           GFI GWDTGTI GF++ +D++ RFG  H DGS YLSKVRTGL+VSIFN+GCAIG +VL +
Sbjct: 64  GFIFGWDTGTISGFVAQTDFLRRFGQKHKDGSHYLSKVRTGLIVSIFNIGCAIGGLVLSK 123

Query: 128 LGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEI 187
           LGDT GR+  ++I V IYI+GI+IQIASI+KWYQYFIGRII+GLG G I+VLSPMLISE+
Sbjct: 124 LGDTKGRKMALIIVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGISVLSPMLISEV 183

Query: 188 SPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFI 247
           SPKHLRGTLVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWAL MIG M  
Sbjct: 184 SPKHLRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMTF 243

Query: 248 VPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELF 307
           VPESPRYL+E G +EEA+ S+AK+NK   D P   QE++ ++ +V+  +AAG+ASW ELF
Sbjct: 244 VPESPRYLIEAGLMEEARASLAKANKCAPDHPFIQQELDTIEASVDEAKAAGTASWGELF 303

Query: 308 QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTF 367
             K  + +RT MGV++ +LQQLTG NYFFYYGTI+FKAVGLEDSF+TS++FG+VN  ST 
Sbjct: 304 --KPFMFKRTSMGVMIQSLQQLTGDNYFFYYGTIVFKAVGLEDSFETSIVFGVVNLFSTC 361

Query: 368 VALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCF 427
            +LY VDK+GRR CLLWGA GMVCC VV+ASVGVT+LW NG+D P SKGAGN MI F+CF
Sbjct: 362 CSLYTVDKFGRRNCLLWGAIGMVCCYVVYASVGVTRLWANGEDNP-SKGAGNCMICFACF 420

Query: 428 FIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYG 487
           +IFCFATTWAPI +VIISE+FPLR+K+K M+L T +N +W F IGFFTPFITGAINF YG
Sbjct: 421 YIFCFATTWAPIAYVIISETFPLRIKSKAMSLATAANWLWGFLIGFFTPFITGAINFSYG 480

Query: 488 YVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEAL 547
           YVF+GC+VF+Y YVF FV ETKGL LE+V  M+ EGVLPWKS++WVPPS+RG DY+A+AL
Sbjct: 481 YVFMGCMVFAYFYVFFFVSETKGLTLEEVETMYAEGVLPWKSSAWVPPSRRGADYDADAL 540

Query: 548 ATDDKPIYKRMFSKN 562
            TDDKP YKR+F +N
Sbjct: 541 MTDDKPFYKRVFGRN 555

>YHR096C Chr8 complement(294669..296447) [1779 bp, 592 aa] {ON}
           HXT5Hexose transporter with moderate affinity for
           glucose, induced in the presence of non-fermentable
           carbon sources, induced by a decrease in growth rate,
           contains an extended N-terminal domain relative to other
           HXTs
          Length = 592

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/556 (64%), Positives = 441/556 (79%), Gaps = 5/556 (0%)

Query: 9   GEDVHSSTAGSVHSSQSFQEMKKDSQDF--NEIDSQIIEIPKKPASAYLSVCIMCLMVAF 66
           G + + + A  V S  S +   KD  +    E+D Q+    KK  S  L V + CLMVAF
Sbjct: 39  GYNDNLAQAKPVSSYISHEGPPKDELEELQKEVDKQL---EKKSKSDLLFVSVCCLMVAF 95

Query: 67  GGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLG 126
           GGF+ GWDTGTI GF+  +D+I RFGS+ ++G+ YLS VRTGL+VSIFN+GCAIG +VL 
Sbjct: 96  GGFVFGWDTGTISGFVRQTDFIRRFGSTRANGTTYLSDVRTGLMVSIFNIGCAIGGIVLS 155

Query: 127 RLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISE 186
           +LGD  GR+ G++  V IY +GI+IQIASIDKWYQYFIGRII+GLG G I VL+PMLISE
Sbjct: 156 KLGDMYGRKIGLMTVVVIYSIGIIIQIASIDKWYQYFIGRIISGLGVGGITVLAPMLISE 215

Query: 187 ISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMF 246
           +SPK LRGTLVSCYQLMITFG+FLGYCTN+GTK Y NS+QWRVPLGLCFAW++ MI  M 
Sbjct: 216 VSPKQLRGTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWSIFMIVGMT 275

Query: 247 IVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSEL 306
            VPESPRYLVE G+IEEAKRS+A++NK T D P    E+E  Q ++EAE+ AGSASW EL
Sbjct: 276 FVPESPRYLVEVGKIEEAKRSLARANKTTEDSPLVTLEMENYQSSIEAERLAGSASWGEL 335

Query: 307 FQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAST 366
              K ++ +RTLMG+++ +LQQLTG NYFFYYGT IF+AVGLEDSF+T+++ G+VNF ST
Sbjct: 336 VTGKPQMFRRTLMGMMIQSLQQLTGDNYFFYYGTTIFQAVGLEDSFETAIVLGVVNFVST 395

Query: 367 FVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSC 426
           F +LY VD++GRR CLLWG  GM+CC VV+ASVGVT+LWPNGQDQPSSKGAGN MIVF+C
Sbjct: 396 FFSLYTVDRFGRRNCLLWGCVGMICCYVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFAC 455

Query: 427 FFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYY 486
           F+IFCFATTWAP+ +V+ISES+PLRV+ K M++ +  N +W F I FFTPFIT AINFYY
Sbjct: 456 FYIFCFATTWAPVAYVLISESYPLRVRGKAMSIASACNWIWGFLISFFTPFITSAINFYY 515

Query: 487 GYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEA 546
           GYVF+GC+VF+Y YVF FVPETKGL LE+VN M+EE VLPWKS  W+PPS+R TDY+ +A
Sbjct: 516 GYVFMGCMVFAYFYVFFFVPETKGLTLEEVNEMYEENVLPWKSTKWIPPSRRTTDYDLDA 575

Query: 547 LATDDKPIYKRMFSKN 562
              D +P YKRMF+K 
Sbjct: 576 TRNDPRPFYKRMFTKE 591

>CAGL0A01804g Chr1 complement(180180..181871) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P32466 Saccharomyces
           cerevisiae YDR345c HXT3 or uniprot|P32465 Saccharomyces
           cerevisiae YHR094c HXT1
          Length = 563

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/548 (65%), Positives = 440/548 (80%)

Query: 14  SSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGW 73
           SS     H S+   ++ K+      + +++I  P     A++ V I C MVAFGGF+ GW
Sbjct: 15  SSNEVDSHESKYLNQVGKNDMADEFVQNEMIANPNTGKGAFVGVIISCFMVAFGGFVFGW 74

Query: 74  DTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVG 133
           DTGTI GF++  D+I+RFG  H DG++YLSKVRTGL+VSIFN+GCAIG ++L +LGDT G
Sbjct: 75  DTGTISGFVAQKDFIHRFGMKHPDGTEYLSKVRTGLIVSIFNIGCAIGGIILSKLGDTKG 134

Query: 134 RRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLR 193
           R+ G+V+ V IYIVGI+IQIASI+KWYQYFIGRII+GLG G I+VLSPMLISE++P  LR
Sbjct: 135 RKMGLVVVVVIYIVGIIIQIASINKWYQYFIGRIISGLGVGGISVLSPMLISEVAPSDLR 194

Query: 194 GTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPR 253
           G+LVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWAL MIG M  VPESPR
Sbjct: 195 GSLVSCYQLMITLGIFLGYCTNFGTKNYTNSVQWRVPLGLCFAWALFMIGGMTFVPESPR 254

Query: 254 YLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKV 313
           YLVE GQIEEA+ S+A+ NK + D P   QE++L+Q +V+  ++AGSASW ELF  K  +
Sbjct: 255 YLVEAGQIEEARSSLARINKCSPDHPYIQQELDLIQASVDEARSAGSASWGELFTGKPAM 314

Query: 314 LQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVV 373
            +RTLMG+++ +LQQLTG NYFFYYGTI+FKAVGLEDSF+TS++FG+VNF ST  +L  V
Sbjct: 315 FRRTLMGIMIQSLQQLTGDNYFFYYGTIVFKAVGLEDSFETSIVFGVVNFFSTCCSLLTV 374

Query: 374 DKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFA 433
           D++GRR CLL+GA GMVCC VV+ASVGVT+LWP+GQ   SSKGAGN MIVFSCF+IFCFA
Sbjct: 375 DRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPHGQGNGSSKGAGNCMIVFSCFYIFCFA 434

Query: 434 TTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGC 493
           TTWAPI +VIISE+FPLR+KAK M++ T +N MW F I FFTPFIT AINFYYGYVF+GC
Sbjct: 435 TTWAPIAYVIISETFPLRIKAKAMSIATAANWMWGFLIAFFTPFITNAINFYYGYVFMGC 494

Query: 494 LVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKP 553
           +VF+Y YVF FV ETKGL LE+VN M+ EGVLPWKS+ WVP S+RG DY+A+AL  DD P
Sbjct: 495 MVFAYFYVFFFVSETKGLTLEEVNEMYAEGVLPWKSSKWVPASRRGADYDADALMHDDTP 554

Query: 554 IYKRMFSK 561
            YKR+  +
Sbjct: 555 WYKRVVGR 562

>SAKL0G07656g Chr7 (641127..642866) [1740 bp, 579 aa] {ON} highly
           similar to Saccharomyces cerevisiae uniprot|P32466
           YDR345C HXT3 Low affinity glucose transporter of the
           major facilitator superfamily, expression is induced in
           low or high glucose conditions
          Length = 579

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/551 (65%), Positives = 446/551 (80%), Gaps = 2/551 (0%)

Query: 11  DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIE-IPKKPASAYLSVCIMCLMVAFGGF 69
           D +S  +  +++ ++      D  +F+E+     E + KK  S YL V I C+MVAFGGF
Sbjct: 29  DQNSHNSRIMNAPEAKGGQMGDEDEFDELQKAAEEQLAKKGTSEYLFVSICCVMVAFGGF 88

Query: 70  ISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRL 128
           + GWDTGTI GF++ SD+  RFG   HS G+ YLS VR GL+V+IFN+GCAIG VVL ++
Sbjct: 89  VFGWDTGTISGFVNMSDFKRRFGQYKHSTGTYYLSDVRVGLIVAIFNIGCAIGGVVLSKI 148

Query: 129 GDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEIS 188
           G+  GRR G++  V IYI+GI+IQIASIDKWYQYFIGRII+GLG G I VLSPMLISE +
Sbjct: 149 GEVYGRRIGLMAVVVIYIIGIIIQIASIDKWYQYFIGRIISGLGVGGITVLSPMLISENA 208

Query: 189 PKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIV 248
           PKHLRGTLVSCYQLMIT G+FLGYCTNYGTKTY+NS+QWRVPLGLCFAWA++MI  M  V
Sbjct: 209 PKHLRGTLVSCYQLMITAGIFLGYCTNYGTKTYENSVQWRVPLGLCFAWAILMIIGMSFV 268

Query: 249 PESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQ 308
           PESPRYLVE G++EEA+RS+A+ NKV++DD     E+E ++ +VEAE+ AGSASWSEL  
Sbjct: 269 PESPRYLVEVGRVEEARRSLARVNKVSVDDALVAVELEHIEASVEAEKLAGSASWSELVT 328

Query: 309 TKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFV 368
            K  + +RTLMG+++ +LQQLTG NYFFYYGT IF+AVG++DSF+TS++ GIVNFAST +
Sbjct: 329 GKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQAVGMDDSFETSIVLGIVNFASTSL 388

Query: 369 ALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFF 428
           +LY VDK+GRR CLL+G  GMV C VV+ASVGVT+LWP+GQDQPSSKGAGN MIVF+CF+
Sbjct: 389 SLYTVDKFGRRNCLLYGCCGMVACYVVYASVGVTRLWPDGQDQPSSKGAGNCMIVFACFY 448

Query: 429 IFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGY 488
           IFCFATTWAPI +V+ISES+PLR+K K MA+ + +N +W F I FFTPFIT AINFYYGY
Sbjct: 449 IFCFATTWAPIAYVVISESYPLRIKGKAMAIASAANWIWGFLIAFFTPFITSAINFYYGY 508

Query: 489 VFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALA 548
           VF+GC++F+Y YVF FVPETKGL LE+VN M+++GVLPWKS+SW+P S+RG DYNA+ L 
Sbjct: 509 VFMGCMIFAYFYVFFFVPETKGLTLEEVNEMYQDGVLPWKSSSWIPSSRRGADYNADDLM 568

Query: 549 TDDKPIYKRMF 559
            DDKP YKR F
Sbjct: 569 HDDKPFYKRFF 579

>Smik_8.173 Chr8 complement(271033..272811) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/556 (64%), Positives = 441/556 (79%), Gaps = 5/556 (0%)

Query: 9   GEDVHSSTAGSVHSSQSFQEMKKDSQDF--NEIDSQIIEIPKKPASAYLSVCIMCLMVAF 66
           G +   + A  V S  S +   KD  +    E+D+Q+ E   K    ++SVC  CLMVAF
Sbjct: 39  GYNDDLAQAKPVSSYVSHEGPPKDELEELQKEVDNQL-ETKSKSDLVFVSVC--CLMVAF 95

Query: 67  GGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLG 126
           GGF+ GWDTGTI GF+  +D+I RFGS+ ++G+ YLS VRTGL+VSIFN+GCAIG +VL 
Sbjct: 96  GGFVFGWDTGTISGFVRQTDFIRRFGSTRANGTNYLSDVRTGLMVSIFNIGCAIGGIVLS 155

Query: 127 RLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISE 186
           +LGD  GR+ G++  V IY +GI+IQIASIDKWYQYFIGRII+GLG G I VL+PMLISE
Sbjct: 156 KLGDMYGRKIGLMTVVVIYSIGIIIQIASIDKWYQYFIGRIISGLGVGGITVLAPMLISE 215

Query: 187 ISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMF 246
           +SPK LRGTLVSCYQLMITFG+FLGYCTN+GTK Y NS+QWRVPLGLCFAW++ MI  M 
Sbjct: 216 VSPKQLRGTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWSIFMIVGMS 275

Query: 247 IVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSEL 306
            VPESPRYLVE G+IEEAKRS+A++NK T D P    E+E  Q ++EAE+ AGSASW EL
Sbjct: 276 FVPESPRYLVEVGKIEEAKRSLARANKTTEDSPLVTLEMENYQASIEAERLAGSASWGEL 335

Query: 307 FQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAST 366
              K ++ +RTLMG+++ +LQQLTG NYFFYYGT IF+AVGLEDSF+T+++ G+VNF ST
Sbjct: 336 VTGKPQMFRRTLMGMMIQSLQQLTGDNYFFYYGTTIFQAVGLEDSFETAIVLGVVNFVST 395

Query: 367 FVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSC 426
           F +LY VD++GRR CLLWG  GM+CC VV+ASVGVT+LWPNGQDQPSSKGAGN MIVF+C
Sbjct: 396 FFSLYTVDRFGRRNCLLWGCIGMICCYVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFAC 455

Query: 427 FFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYY 486
           F+IFCFATTWAP+ +V+ISES+PLRV+ K M++ +  N +W F I FFTPFIT AINFYY
Sbjct: 456 FYIFCFATTWAPVAYVLISESYPLRVRGKAMSIASACNWIWGFLISFFTPFITSAINFYY 515

Query: 487 GYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEA 546
           GYVF+GC+VF+Y YVF FVPETKGL LE+VN M+EE VLPWKS  W+PPS+R  DY+ +A
Sbjct: 516 GYVFMGCMVFAYFYVFFFVPETKGLTLEEVNEMYEENVLPWKSTRWIPPSRRTADYDLDA 575

Query: 547 LATDDKPIYKRMFSKN 562
              D +P YKRMF+K 
Sbjct: 576 TKNDPRPFYKRMFTKE 591

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/513 (66%), Positives = 426/513 (83%), Gaps = 3/513 (0%)

Query: 36  FNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSH 95
           ++E   + +  P+K    Y +VCIMCLMVAFGGF++GWD GTIGGF++ +D+I RFG+  
Sbjct: 44  YSEESPEALVEPEKNKWKYTTVCIMCLMVAFGGFMTGWDIGTIGGFMAQTDFIRRFGTLG 103

Query: 96  SDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIAS 155
            +   YLSK+R GLLVSIFN+GCA+GSV LG+LGD  GRR G+++A  I+++G++I+I S
Sbjct: 104 PNNVYYLSKIRMGLLVSIFNIGCAVGSVTLGKLGDIYGRRWGLILATIIFVIGVLIEITS 163

Query: 156 IDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTN 215
           +DKWYQYFIGRIIAG+G G IAVLSPMLISE++PK LRG +VSCYQLMITFG+FLG C N
Sbjct: 164 VDKWYQYFIGRIIAGIGMGLIAVLSPMLISEVAPKELRGAMVSCYQLMITFGIFLGNCCN 223

Query: 216 YGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVT 275
           YGTK+Y NS QWR+ +GL F W+++M+ AM  VPESPRYL++KG+ E+AK S+A+SNKV 
Sbjct: 224 YGTKSYSNSAQWRIGVGLQFLWSIIMVCAMMFVPESPRYLIQKGKTEQAKISIARSNKVD 283

Query: 276 IDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYF 335
           ID   T +E E+V  AVEAE+ AG A W E+F+TK K  QR LMG++VL LQQL+G NYF
Sbjct: 284 IDSVITQREFEIVYSAVEAEREAGVAGWKEIFETKNKTFQRVLMGMVVLGLQQLSGANYF 343

Query: 336 FYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVV 395
           FYYG+ IF AVGL+D+FQT++IFG+VNFASTFVALYVVDK+GRR CLL GAA + CCM+V
Sbjct: 344 FYYGSTIFNAVGLDDAFQTAIIFGVVNFASTFVALYVVDKFGRRLCLLVGAAALSCCMLV 403

Query: 396 FASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAK 455
           FA++GVT L+PNG D P+SK AG+ MIVFSC FIF FAT+WAPIPFVI+SE+FPLR+++K
Sbjct: 404 FATIGVTSLYPNGWDSPTSKWAGDVMIVFSCLFIFFFATSWAPIPFVILSETFPLRIRSK 463

Query: 456 GMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLED 515
           GMALGTVSNQ+WNF +GFFTP+ITGAI+FYYGYVFLGC VF++ YVF FVPETKGL LED
Sbjct: 464 GMALGTVSNQLWNFMVGFFTPWITGAIHFYYGYVFLGCCVFAFFYVFFFVPETKGLVLED 523

Query: 516 VNLMWEEGVLPWKSASWVPPSQRG---TDYNAE 545
           +NL+WEEGV PWKS +WVPPSQR    +D N++
Sbjct: 524 INLLWEEGVPPWKSVAWVPPSQREEYLSDINSD 556

>SAKL0C02134g Chr3 (188874..190589) [1716 bp, 571 aa] {ON} highly
           similar to uniprot|P40886 Saccharomyces cerevisiae
           YJL214W HXT8
          Length = 571

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/561 (61%), Positives = 436/561 (77%), Gaps = 5/561 (0%)

Query: 4   SQSPTGEDVHS-STAGSVHSSQSFQEMKKDSQDF---NEIDSQIIEIPKKPASAYLSVCI 59
           S   T  D HS +TA S  S+ S +  + D  D    NE       +P+KPASAY++VCI
Sbjct: 11  SAQDTPVDSHSLATATSHLSTPSNKAARDDLDDLKFQNEATELTTVMPQKPASAYITVCI 70

Query: 60  MCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGC 118
           +C+ VAFGGF+SGWD GTI GF++ +D+  RFG  SHS    YLS VR GL+VSIF++G 
Sbjct: 71  LCMCVAFGGFVSGWDVGTISGFVNQTDFKRRFGEYSHSKDEYYLSNVRVGLIVSIFSIGN 130

Query: 119 AIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAV 178
           A+G++VL +LGD  GR  G++  + +Y+VGIVIQI+S DKWYQYFIGRI+AGLG G + V
Sbjct: 131 AVGALVLSKLGDVYGRCMGLMAVILVYVVGIVIQISSDDKWYQYFIGRIVAGLGGGGVGV 190

Query: 179 LSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWA 238
           L+ MLISE +PKHLRGTL++ +Q+M+   + LGYCTNYGTK Y NSIQWRVPLGLCFAWA
Sbjct: 191 LAQMLISETAPKHLRGTLLASWQVMVNCAILLGYCTNYGTKNYSNSIQWRVPLGLCFAWA 250

Query: 239 LVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAA 298
           ++MI  M  VPESPRYL++ G+IEEAKRS+A+SNK+T++DPA   E++L+   +E E+ A
Sbjct: 251 IIMIAGMCFVPESPRYLIQVGKIEEAKRSLARSNKLTVEDPAVQCEVDLIAAGIELEKLA 310

Query: 299 GSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIF 358
           GS+SW +L   KTKV QR +M + + +LQQLTGC YFFYYGT IFK+VG+EDSF+TS++ 
Sbjct: 311 GSSSWGDLLSKKTKVFQRLVMSITINSLQQLTGCGYFFYYGTTIFKSVGMEDSFETSIVI 370

Query: 359 GIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAG 418
           G+VNF STFV+LY++D+ GRR CLL GAA M  CMV++A+VGVT L+P+G+DQPSSK AG
Sbjct: 371 GVVNFVSTFVSLYILDRLGRRKCLLMGAAVMTVCMVIYATVGVTSLYPDGEDQPSSKAAG 430

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MIVF+CF+IF FA TW P  FV+ISESFPLRVK+K M++ T +N +W F +GFFTPFI
Sbjct: 431 NCMIVFTCFYIFFFANTWGPGCFVVISESFPLRVKSKCMSVATAANGLWGFLVGFFTPFI 490

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           T AINFYYGYVF+GCLV SY YVF FVPETKGL LE+V  MW EGVLPWKS SWVP S+R
Sbjct: 491 TSAINFYYGYVFMGCLVVSYFYVFFFVPETKGLTLEEVEEMWHEGVLPWKSGSWVPSSRR 550

Query: 539 GTDYNAEALATDDKPIYKRMF 559
           GT+Y+AE L  D+KP YKRM 
Sbjct: 551 GTNYDAEKLQHDEKPWYKRML 571

>KLLA0D13310g Chr4 complement(1143027..1144730) [1704 bp, 567 aa]
           {ON} uniprot|P18631 Kluyveromyces lactis RAG1 Low-
           affinity glucose transporter
          Length = 567

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/561 (62%), Positives = 443/561 (78%), Gaps = 12/561 (2%)

Query: 11  DVHSSTAGSVHSSQSFQEMKKDS---------QDFNEIDSQIIE-IPKKPASAYLSVCIM 60
           D  S+ +G+ HS  +   +K  S         +D N+++    E + +KPA  Y+ V + 
Sbjct: 7   DSTSAGSGTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLC 66

Query: 61  CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAI 120
           C+MVAFGGF+ GWDTGTI GF++ +D++ RFG   +DGS YLS VRTGL+VSIFN+GCA+
Sbjct: 67  CVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAV 126

Query: 121 GSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLS 180
           G +VL  +GD  GRR G++  + IY++GI+IQIAS+DKWYQYFIGRII+GLG G I VLS
Sbjct: 127 GGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLS 186

Query: 181 PMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALV 240
           PMLISE +PKHLRGTLVSCYQLMITFG+FLGYCTNYGTK Y NS+QWRVPLGLCFAWA+ 
Sbjct: 187 PMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIF 246

Query: 241 MIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGS 300
           M+  M  VPES R+LVE  QIEEA++S+AK+NKV+IDDP    E+  +Q ++E E+AAG+
Sbjct: 247 MVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAGN 306

Query: 301 ASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGI 360
           ASW EL   K  + +RTLMG+++ +LQQLTG NYFFYYGT IF++VG++DSF+TS++ GI
Sbjct: 307 ASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGI 366

Query: 361 VNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSKGAG 418
           VNFASTF ALY VD +GRR CLL+G  GMV C VV+ASVGVT+LWP+G D P  SSKGAG
Sbjct: 367 VNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAG 426

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MIVF+CF+IFCFATTWAPI +V+ISES+PLRVK K MA+ + SN +W F IGFFTPFI
Sbjct: 427 NCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFI 486

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           T AI+FYYGYVF+GC+VF++ YV+ FVPETKGL LE+VN M+ EGVLPWKS+SWVP S+R
Sbjct: 487 TSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWKSSSWVPSSRR 546

Query: 539 GTDYNAEALATDDKPIYKRMF 559
           G +Y+ +AL  DDKP YK M 
Sbjct: 547 GAEYDVDALQHDDKPWYKAML 567

>Smik_8.172 Chr8 complement(267609..269321) [1713 bp, 570 aa] {ON}
           YHR096C (REAL)
          Length = 570

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/559 (62%), Positives = 441/559 (78%), Gaps = 1/559 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           S S    ++ SS + ++++ +   E   D+   +++   +   P     AY+ V I C+M
Sbjct: 13  SNSSNSYELESSGSKTMNTPEGKNENFHDNLSESQVQPAVPS-PNTGKGAYVMVSICCVM 71

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGGFI GWDTGTI GF++  D++ RFG  H DG+ YLSKVRTGL+VSIFN+GCAIG +
Sbjct: 72  VAFGGFIFGWDTGTISGFVAQIDFLRRFGMKHHDGTHYLSKVRTGLIVSIFNIGCAIGGI 131

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
           +L +LGD  GRR G+++ V IY +GI+IQIASI+KWYQYFIGRII+GLG G I VLSPML
Sbjct: 132 ILAKLGDMYGRRIGLIVVVVIYTIGIIIQIASINKWYQYFIGRIISGLGVGGITVLSPML 191

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE++P  +RGTLVSCYQ+MIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWA+ M+ 
Sbjct: 192 ISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWAIFMVA 251

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            M  VPESPRYLVE G+I+EA+ S+AK NK   D P    E+E ++ +VE  ++AG+ASW
Sbjct: 252 GMMFVPESPRYLVEVGKIDEARASLAKVNKCPPDHPFIQHELETIEASVEEMRSAGTASW 311

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            ELF  K  + QRT+MG+++ +LQQLTG NYFFYYGTI+F+AVGLEDSF+TS++FG+VNF
Sbjct: 312 GELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFQAVGLEDSFETSIVFGVVNF 371

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
            ST  +LY VD++GRR CL+WGA GM+CC VV+ASVGVT+LWPNGQ+  SSKGAGN MI 
Sbjct: 372 FSTCCSLYTVDRFGRRNCLMWGAVGMICCYVVYASVGVTRLWPNGQENGSSKGAGNCMIC 431

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           F+CF+IFCFATTWAPI +V+ISE FPLRVK+K M++ + +N +W F I FFTPFITGAIN
Sbjct: 432 FACFYIFCFATTWAPIAYVVISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAIN 491

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYN 543
           FYYGYVF+GC+VF+Y YVF FVPETKGL LE+VN M+ EGVLPWKSASWVP S+RG DYN
Sbjct: 492 FYYGYVFMGCMVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN 551

Query: 544 AEALATDDKPIYKRMFSKN 562
           AE L  DD+P YK MFS+ 
Sbjct: 552 AEDLMHDDQPFYKSMFSRK 570

>AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR094C
           (HXT1)
          Length = 546

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/534 (63%), Positives = 422/534 (79%), Gaps = 3/534 (0%)

Query: 19  SVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTI 78
           SV S+ S     K S++ N+ +S ++EIP KPASAY++V ++C++VAFGGFI GWDTGTI
Sbjct: 12  SVMSTHSSTASNKPSKEENK-ESGLVEIPVKPASAYITVSLLCILVAFGGFIFGWDTGTI 70

Query: 79  GGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGI 138
            GF++ SDY NRFG  +  G  YLS  RTGL+V+IFN+GCA+G + L +  D  GRR G+
Sbjct: 71  SGFVNQSDYKNRFGELNESGDYYLSDNRTGLIVAIFNIGCAVGGIFLSKFADMYGRRIGL 130

Query: 139 VIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVS 198
           +I   +Y++GIV+QI+S DKWYQY IGR+I+GLG G IAVLSPMLISE SPKHLRG LVS
Sbjct: 131 MIVTLVYVIGIVVQISSTDKWYQYCIGRVISGLGVGGIAVLSPMLISETSPKHLRGMLVS 190

Query: 199 CYQLMITFGMFLGYCTNYGTKT-YDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVE 257
           CYQLMIT G+F+GYC NYGTK  Y++S QWR+PLGL FAWA++MIG M +VPESPRYLVE
Sbjct: 191 CYQLMITAGIFVGYCANYGTKAKYEDSKQWRIPLGLSFAWAILMIGGMVLVPESPRYLVE 250

Query: 258 KGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRT 317
             + E+AKRS+A+SNKV +DDP+   E + +   +E E+ AGSASW ELF TK+K+LQR 
Sbjct: 251 VNKYEDAKRSLARSNKVPVDDPSIQAEFDNIHAGIELERMAGSASWGELFSTKSKILQRV 310

Query: 318 LMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYG 377
           +MGV++ +LQQLTG NYFFYYGT IFK+VGLEDSFQTS+I G VNF STFVA++ V K+G
Sbjct: 311 IMGVMIQSLQQLTGNNYFFYYGTTIFKSVGLEDSFQTSIILGAVNFGSTFVAVWAVGKFG 370

Query: 378 RRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWA 437
           RR  +L GAA M  CMV+FAS+GVTKLWPNG+DQPSSK AGN MIVF+C +IFCFATTWA
Sbjct: 371 RRRLMLAGAAAMTVCMVIFASIGVTKLWPNGEDQPSSKPAGNVMIVFTCIYIFCFATTWA 430

Query: 438 PIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFS 497
           PIPFVI+SE+FPLRVKAKGMA+ T +N +W F I FFTP IT AI F YGYVF+GCL+F+
Sbjct: 431 PIPFVIVSETFPLRVKAKGMAIATAANWIWGFLIAFFTPKITNAIKFNYGYVFMGCLIFA 490

Query: 498 YCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDD 551
           + Y+F FVPETKGL LE+V  MW+EGV+PWKS SW P  +R   Y  E +  + 
Sbjct: 491 FFYMFFFVPETKGLTLEEVEEMWQEGVVPWKSESWTPSYKRNA-YETEEVKPEK 543

>Suva_15.290 Chr15 complement(493441..495144) [1704 bp, 567 aa] {ON}
           YHR094C (REAL)
          Length = 567

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/558 (63%), Positives = 436/558 (78%), Gaps = 6/558 (1%)

Query: 4   SQSPTGEDVHSSTAGSVH-SSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCL 62
           S S    D+ S    +    ++SF +   +SQ    + S     P     AY++V I C+
Sbjct: 13  SNSSNSYDLESKAMNAPEGKNESFHDNLSESQAQPAVPS-----PNTGKGAYVTVSICCI 67

Query: 63  MVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGS 122
           MVAFGGF+ GWDTGTI GF++ +D++ RFG  H DGS YLSKVR GL+VSIFN+GCAIG 
Sbjct: 68  MVAFGGFVFGWDTGTISGFVAQTDFLKRFGMKHKDGSHYLSKVRIGLMVSIFNIGCAIGG 127

Query: 123 VVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPM 182
           ++L RLGD  GRR G+++ V IY +GI+IQIASIDKWYQYFIGRII+GLG G I VLSPM
Sbjct: 128 ILLARLGDMYGRRIGLIVVVVIYTIGIIIQIASIDKWYQYFIGRIISGLGVGGITVLSPM 187

Query: 183 LISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMI 242
           LISE++P  +RGTLVSCYQ+MIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWA+ M+
Sbjct: 188 LISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWAIFMV 247

Query: 243 GAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS 302
             M  VPESPRYLVE G+I+EA+ S+AK NK   D P    E+E ++ +VE  ++AG+AS
Sbjct: 248 AGMLFVPESPRYLVEVGRIDEARASLAKVNKCPPDHPFIQHELESIEASVEEMKSAGTAS 307

Query: 303 WSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVN 362
           W ELF  K  + QRT+MG+++ +LQQLTG NYFFYYGTI+FKAVG+ DSF+TS++FG+VN
Sbjct: 308 WGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFKAVGMSDSFETSIVFGVVN 367

Query: 363 FASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMI 422
           F ST  +LY VD++GRR CL+WGA GMV C VV+ASVGVTKLWP+G D PSSKGAGN MI
Sbjct: 368 FFSTCCSLYTVDRFGRRNCLMWGAVGMVFCYVVYASVGVTKLWPHGPDGPSSKGAGNCMI 427

Query: 423 VFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI 482
            F+CF+IFCFATTWAPI +V+ISE FPLRVK+K M++ + +N  W F IGFFTPFITGAI
Sbjct: 428 CFACFYIFCFATTWAPIAYVVISECFPLRVKSKCMSIASAANWFWGFLIGFFTPFITGAI 487

Query: 483 NFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDY 542
           NFYYGYVF+GC++F+Y YVF FVPETKGL LE+VN M+ EGVLPWKSASWVP S+RG DY
Sbjct: 488 NFYYGYVFMGCMIFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPASKRGADY 547

Query: 543 NAEALATDDKPIYKRMFS 560
           NA+ L  DD+P YK +FS
Sbjct: 548 NADDLMHDDQPFYKSLFS 565

>CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {ON}
           highly similar to uniprot|P38695 Saccharomyces
           cerevisiae YHR096c HXT5 or uniprot|P32466 Saccharomyces
           cerevisiae YDR345c HXT3
          Length = 588

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/515 (67%), Positives = 425/515 (82%), Gaps = 2/515 (0%)

Query: 48  KKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRT 107
           KK    ++S+C  C+MVAFGGF+ GWDTGTI GF++ +D++ RFG   SDG+ YLS VRT
Sbjct: 76  KKSDLIFVSLC--CIMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQQRSDGTYYLSNVRT 133

Query: 108 GLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRI 167
           GL+V+IFN+GCAIG + L +LGD  GRR G+V  V +Y +GIVIQIASIDKWYQYFIGRI
Sbjct: 134 GLIVAIFNIGCAIGGITLSKLGDIWGRRLGLVTVVVVYTIGIVIQIASIDKWYQYFIGRI 193

Query: 168 IAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQW 227
           I+GLG G IAVLSPMLISE+SPK LRGTLVSCYQLMIT G+FLGYCTNYGTK Y NS+QW
Sbjct: 194 ISGLGVGGIAVLSPMLISEVSPKQLRGTLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQW 253

Query: 228 RVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIEL 287
           RVPLGLCFAWAL MI  +  VPESPRYLVE G++EEAKRS+A++NK T+D P  + E++ 
Sbjct: 254 RVPLGLCFAWALFMIFGVMCVPESPRYLVEVGKLEEAKRSLARANKTTVDSPIVLLELDK 313

Query: 288 VQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVG 347
            Q +VEAE+ AGSASW EL   K ++L+RT+MG+++ +LQQLTG NYFFYYGT IF+AVG
Sbjct: 314 YQASVEAERLAGSASWGELVTGKPQMLRRTIMGMMIQSLQQLTGANYFFYYGTTIFRAVG 373

Query: 348 LEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPN 407
           L+DSFQT+++ G+VNF STF ALY VD YGRR CL+WG  GMVCC VV+ASVGVT+LWPN
Sbjct: 374 LDDSFQTAIVLGVVNFVSTFYALYTVDHYGRRNCLMWGCVGMVCCYVVYASVGVTRLWPN 433

Query: 408 GQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMW 467
           G+   SSKGAGN MIVF+CFFIFCFATTWAPI +VI+SES+PLR++ K M++   +N +W
Sbjct: 434 GEGNGSSKGAGNCMIVFACFFIFCFATTWAPIAYVIVSESYPLRIRGKAMSIAIAANWIW 493

Query: 468 NFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPW 527
            F I FFTPFIT AINFYYGYVF+GC+VF+Y YVF FVPETKGL LE+VN M+EEGVLPW
Sbjct: 494 GFLIAFFTPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNQMYEEGVLPW 553

Query: 528 KSASWVPPSQRGTDYNAEALATDDKPIYKRMFSKN 562
           KS+SWVPP +R  +YN +  + DDKP YKR+FS+N
Sbjct: 554 KSSSWVPPDRRTAEYNLDDYSHDDKPWYKRVFSRN 588

>TDEL0A04250 Chr1 (756579..758300) [1722 bp, 573 aa] {ON}  YBR298C
          Length = 573

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/548 (63%), Positives = 423/548 (77%), Gaps = 5/548 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           S+    E +++S+  S    +      + S   N +      IP+KP   Y++V  MCLM
Sbjct: 17  SREKIMEPLYASSCASTPPDKVTSNEPEYSSALNPVGG----IPEKPLKEYITVMFMCLM 72

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGS 122
           +AFGGF+ GWDTGTI GF++H+D+I RFG    +  S YLS VR GL+VSIFN+GCA+G 
Sbjct: 73  IAFGGFVFGWDTGTISGFVNHTDFIVRFGQFDPARQSFYLSDVRIGLIVSIFNIGCALGG 132

Query: 123 VVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPM 182
           + L  LGD  GRR G+++ V +Y+VGI+IQI+S D WYQYFIGRI++GLG G IAVLSP 
Sbjct: 133 LTLSHLGDIYGRRIGLMVVVLVYVVGIIIQISSTDLWYQYFIGRIVSGLGVGAIAVLSPA 192

Query: 183 LISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMI 242
           LISEISPKHLRGT VS YQLMIT G+FLGYCTNYGTK Y NSIQWR+PLGLCFA A+ MI
Sbjct: 193 LISEISPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKRYTNSIQWRLPLGLCFACAIFMI 252

Query: 243 GAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS 302
             M +VPESPRYLVEK +++EA+ S+AKSNK+ +DDP    E+EL+   VEAE+ AG+A+
Sbjct: 253 VGMLLVPESPRYLVEKERLDEARISLAKSNKLPVDDPGVAFELELITAGVEAERLAGNAT 312

Query: 303 WSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVN 362
           WSELF  K K+LQR +MGV++ +LQQLTG NYFFYYGT IF AVGLEDSFQTS+I G+VN
Sbjct: 313 WSELFSRKGKILQRVVMGVMIQSLQQLTGNNYFFYYGTTIFNAVGLEDSFQTSIILGLVN 372

Query: 363 FASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMI 422
           F STFV+L+VVD++GRR CLLWG+A M  C VVFASVGVT LWPNG+DQPSSKGAGN MI
Sbjct: 373 FLSTFVSLWVVDRFGRRKCLLWGSASMAACFVVFASVGVTSLWPNGRDQPSSKGAGNAMI 432

Query: 423 VFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI 482
           VF+CFFIFCFATTWAPI +VI++ES+PLRVK + MA+   SN +W F I FFTPFIT AI
Sbjct: 433 VFTCFFIFCFATTWAPIAYVIVAESYPLRVKNRAMAIAVGSNWIWGFVIAFFTPFITSAI 492

Query: 483 NFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDY 542
           NFYYGYVF+GCLVFS+ YVF  V ETKGL LE+VN M+EEGVLPWKS +WVP   R  + 
Sbjct: 493 NFYYGYVFMGCLVFSFFYVFFCVCETKGLTLEEVNEMYEEGVLPWKSVNWVPRKMRVLED 552

Query: 543 NAEALATD 550
           N E +  D
Sbjct: 553 NVEVVHID 560

>AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON}
           Unclear if syntenic homolog of Saccharomyces cerevisiae
           YDR343C (HXT6), YDR342C (HXT7) and YHR092C (HXT4)
          Length = 539

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/509 (64%), Positives = 411/509 (80%), Gaps = 1/509 (0%)

Query: 41  SQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSK 100
            + ++IP KPA+AY++VC++C+ VAFGGFI GWDTGTI GF++ +D+  RF   + +G  
Sbjct: 28  EETVDIPTKPATAYITVCLLCVFVAFGGFIFGWDTGTISGFVNQTDFRRRFAQVNDEGGY 87

Query: 101 YLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWY 160
           Y S  R GL+V+IFN+GCA+G ++L RLGD  GRR G++I   IY+VGI+IQI+S  KWY
Sbjct: 88  YWSNARVGLIVAIFNIGCAVGGIILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKWY 147

Query: 161 QYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKT 220
           QY IGR+I+GLG G IAVLSPMLISE SPKHLRGTLVSCYQLMIT G+ LGYC NYGTK+
Sbjct: 148 QYCIGRVISGLGVGGIAVLSPMLISETSPKHLRGTLVSCYQLMITAGILLGYCANYGTKS 207

Query: 221 -YDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDP 279
            YD+S QWR+PLGLCF WA+ MI  M  VPESPRYL+EK +IEEAKRS+A SNKV +DDP
Sbjct: 208 RYDDSRQWRIPLGLCFLWAIFMITGMAFVPESPRYLIEKDKIEEAKRSLATSNKVPVDDP 267

Query: 280 ATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYG 339
           A + E+  +Q  VE E+ AGSASW ELF  +TK+LQR +MG ++ +LQQLTG NYFFYYG
Sbjct: 268 AILAEVNNIQAGVELERMAGSASWGELFTVRTKILQRVIMGAMIQSLQQLTGNNYFFYYG 327

Query: 340 TIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASV 399
           T IF +VGLED+F+TS+I G VNF STFVA+Y VD++GRR CLL+GAA M  CMV+FASV
Sbjct: 328 TTIFDSVGLEDAFKTSIILGAVNFGSTFVAMYTVDRFGRRKCLLYGAAAMAVCMVIFASV 387

Query: 400 GVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMAL 459
           GVT+LWPNG DQPSS+ AGN MIVF+C +IF FATTWAPI +VI+SE+FPLRVKAKGMA+
Sbjct: 388 GVTRLWPNGPDQPSSRPAGNAMIVFTCLYIFFFATTWAPIAYVIVSETFPLRVKAKGMAI 447

Query: 460 GTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLM 519
            T +N +W F I FFTP+IT AI FYYGYVF+GCL+F++ Y+F FVPETKGL LE+V  M
Sbjct: 448 ATAANWIWGFLIAFFTPYITNAIRFYYGYVFMGCLIFAFFYIFFFVPETKGLTLEEVEEM 507

Query: 520 WEEGVLPWKSASWVPPSQRGTDYNAEALA 548
           W+EGV+PW+S SWVP ++R   Y+++  A
Sbjct: 508 WQEGVVPWRSESWVPSARRHAPYSSDKQA 536

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/553 (61%), Positives = 432/553 (78%), Gaps = 2/553 (0%)

Query: 11  DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFI 70
           D+ S  +   + +++    + D +  +E  + I   P  P + +  +C++CLMVAFGG+I
Sbjct: 21  DITSVASTPSNKNETDITPEGDPKTESENATNIAAPPSPPGTNW-GICVLCLMVAFGGYI 79

Query: 71  SGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGD 130
           SGWD+GTIGG+ S +D++ RFGS  SDG+ YLSKVRTGLL S+FN+G AIG   LGRLGD
Sbjct: 80  SGWDSGTIGGYESQTDFLKRFGSKRSDGTYYLSKVRTGLLTSMFNIGNAIGCFFLGRLGD 139

Query: 131 TVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPK 190
             GRR G+++A  I+IVG +IQIASI  WYQY IGRI+AG+G+G IA+LSPMLISE++PK
Sbjct: 140 MYGRRIGLIVAAVIFIVGNIIQIASIRAWYQYMIGRIVAGVGAGLIAILSPMLISEVAPK 199

Query: 191 HLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPE 250
           + RG +VSCYQLMIT G+FLGYCTN+GTK Y NS QWRV +GL FAW L MI AM  VPE
Sbjct: 200 NSRGAMVSCYQLMITLGIFLGYCTNFGTKRYHNSTQWRVGVGLQFAWCLCMISAMMFVPE 259

Query: 251 SPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTK 310
           SPR+LVEKG+IEEAKRS+ +SN V+ DDP  I E++ +Q+ V+  +A G A W +LF T+
Sbjct: 260 SPRFLVEKGRIEEAKRSIGRSNGVSPDDPVAIWELDEIQVVVDKSRAEGEAGWLDLFNTE 319

Query: 311 TKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVAL 370
            K+ QR +MG+ ++A QQLTG NYFFYYGT IFKAVG++D F+ +++FG+VNF ST  AL
Sbjct: 320 HKIFQRVIMGIAIMAFQQLTGANYFFYYGTTIFKAVGMKDGFEAAIVFGVVNFFSTCCAL 379

Query: 371 YVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP-SSKGAGNTMIVFSCFFI 429
             VD+ GRR CLL+GAAGM+CCMVVFASVGV +LWP G+    SS+GAG+ MI FSCFF+
Sbjct: 380 LFVDRLGRRRCLLYGAAGMICCMVVFASVGVKRLWPKGKKAGISSQGAGDCMICFSCFFL 439

Query: 430 FCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYV 489
           FCFAT+WAPI FVIISE+FPL VKAKGMAL  VSNQ+WNFCIGFFTPFI+ +INF YGYV
Sbjct: 440 FCFATSWAPIAFVIISETFPLNVKAKGMALAIVSNQLWNFCIGFFTPFISNSINFAYGYV 499

Query: 490 FLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALAT 549
           FLGC+  ++ YVF FVPETKGL LEDV++MW EG LPWKSASW+PPS+RG +Y+ +ALA 
Sbjct: 500 FLGCICLAWIYVFFFVPETKGLVLEDVDIMWREGTLPWKSASWIPPSERGANYDVDALAN 559

Query: 550 DDKPIYKRMFSKN 562
           DD   +++MF + 
Sbjct: 560 DDSSPWRKMFGRK 572

>KAFR0C03750 Chr3 complement(765712..767454) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/570 (62%), Positives = 447/570 (78%), Gaps = 14/570 (2%)

Query: 2   DYSQSPTGEDVHSSTAGSVHSSQSFQ----EMKKDSQDFN-------EIDSQ--IIEIPK 48
           +YS +    D+   TA S H+S +      E++++   F+       ++D +  + EIPK
Sbjct: 11  NYSTNSLHGDIPYKTA-SPHASGTATPQPTEIREELSSFSGKGIATSQVDKEQTVQEIPK 69

Query: 49  KPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTG 108
           KP   Y++V  +C+M+AFGG++ GWDTGTI GF++ +D+I RFG   SDG+ YLS VR G
Sbjct: 70  KPFREYITVLSLCMMIAFGGYVFGWDTGTISGFVNQTDFIERFGQKKSDGTSYLSNVRMG 129

Query: 109 LLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRII 168
           LLV+IFN+G AIG + LGRLGD VGRR G++I V +YIVGIVIQIASIDKW+QYFIGRII
Sbjct: 130 LLVAIFNIGAAIGGLTLGRLGDFVGRRLGLMIVVIVYIVGIVIQIASIDKWFQYFIGRII 189

Query: 169 AGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWR 228
           +G+G G I+VLSP LISE +PKHLRGT VS YQL+IT G+FLGYCTN+GTK Y NS+QWR
Sbjct: 190 SGMGVGGISVLSPTLISETAPKHLRGTAVSFYQLLITAGIFLGYCTNFGTKNYSNSVQWR 249

Query: 229 VPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELV 288
           VPLGLCF WA+ MI  M  VPESPRYLVEKG+IEEA+ S+A+SNK+ ++DP    EI+ +
Sbjct: 250 VPLGLCFVWAIFMISGMIFVPESPRYLVEKGKIEEARVSIARSNKLEVEDPGITYEIDTI 309

Query: 289 QIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGL 348
             ++EAE+ AG+AS SELF TK K+L R +MGV++ +LQQLTG NYFFYYGT IFKAVGL
Sbjct: 310 SQSIEAERVAGTASVSELFSTKGKILPRVVMGVMIQSLQQLTGNNYFFYYGTTIFKAVGL 369

Query: 349 EDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNG 408
           +DSFQTS++ GIVNFASTFV+LY V+++GRR CLLWG+A M  CM VFASVGVT+L+PNG
Sbjct: 370 QDSFQTSIVLGIVNFASTFVSLYTVERFGRRRCLLWGSASMAACMCVFASVGVTRLYPNG 429

Query: 409 QDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWN 468
           + QPSSKGAGN MIVF+CF+IFCFATTWAPI +V++SE+FPLR++++ MA+   +N +W 
Sbjct: 430 KSQPSSKGAGNAMIVFTCFYIFCFATTWAPIAYVVVSETFPLRIRSRAMAISVGANWIWG 489

Query: 469 FCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWK 528
           F I FFTPFIT AI FYYGYVF+GCLVFSY YVF FV ETKGL LE+VN M+ EGVLPWK
Sbjct: 490 FLIAFFTPFITSAIGFYYGYVFMGCLVFSYFYVFFFVSETKGLTLEEVNEMYMEGVLPWK 549

Query: 529 SASWVPPSQRGTDYNAEALATDDKPIYKRM 558
           S  W+P  +RG DY+ +    D+KP YKRM
Sbjct: 550 SPKWLPKGRRGADYDEKGFTHDEKPWYKRM 579

>NCAS0H03600 Chr8 complement(683969..685651) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/552 (60%), Positives = 424/552 (76%), Gaps = 6/552 (1%)

Query: 13  HSSTAGSVHSSQSFQEMKKDSQDFNEIDSQ---IIEIPKKPASAYLSVCIMCLMVAFGGF 69
           H   + SV S+ S  + + D+ +F +   +    IE+PKK A AY ++ I+C M+ FGGF
Sbjct: 6   HEQGSQSVLSNAS-AKAENDNDNFKDDSVEHNGYIEMPKKSAGAYATISILCCMIGFGGF 64

Query: 70  ISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
           I+GWDTGTIGGF+ H D++ RFG    DG+ Y S  RTGL+VSIFN+G  IG + L  L 
Sbjct: 65  IAGWDTGTIGGFMGHPDFMRRFGQKRRDGTHYFSNSRTGLIVSIFNLGGCIGCLTLNNLA 124

Query: 130 DTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISP 189
             VGR+K +VI V IY+VGIVI++ASI+KWYQYFIGRII+G+G G I++ SPML+SE+SP
Sbjct: 125 GRVGRKKALVIVVIIYMVGIVIEMASINKWYQYFIGRIISGMGVGAISIFSPMLLSEVSP 184

Query: 190 KHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVP 249
           KHLRGTL S YQLM+TFG+FLG CTNYGT+   NS QWR PLGL FAWAL MI  M  VP
Sbjct: 185 KHLRGTLGSVYQLMVTFGIFLGDCTNYGTRHKHNSSQWRAPLGLSFAWALFMIAGMSFVP 244

Query: 250 ESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQT 309
           ESPRYL+E G++EEAKRSV  SNK++ DDPA   E++L+   +EAE+ AGSASW ELF T
Sbjct: 245 ESPRYLLEIGKVEEAKRSVGTSNKLSADDPAVQCEVDLILANIEAERLAGSASWPELFST 304

Query: 310 KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVA 369
           K K +QR LM  ++ +LQQLTG NYFFYYG+ +F+A  L+D ++T+++FGIVNFASTFVA
Sbjct: 305 KGKYVQRLLMCCVLQSLQQLTGINYFFYYGSTVFQAASLKDPYETAIVFGIVNFASTFVA 364

Query: 370 LYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSKGAGNTMIVFSCF 427
            YVVDK+GRR CL+WGAA MVCC VV+ASVGV +L+P G+     +SKGAG+ MIVFSCF
Sbjct: 365 FYVVDKFGRRKCLMWGAAAMVCCFVVYASVGVKRLYPEGRKHKEITSKGAGDCMIVFSCF 424

Query: 428 FIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYG 487
           FIF FA T API +V++SE+FPL +K KGMAL   SN +WNF I FFTPFITGAI+FYYG
Sbjct: 425 FIFSFACTLAPICWVVVSETFPLEIKPKGMALANGSNWLWNFLISFFTPFITGAIDFYYG 484

Query: 488 YVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEAL 547
           YVF+GC++F+Y +VF FVPE KGL LE+VN +WEEGVLPWKS  WVP ++R  + +  AL
Sbjct: 485 YVFMGCILFAYFFVFFFVPEMKGLTLEEVNELWEEGVLPWKSPDWVPSTRRDANMDMNAL 544

Query: 548 ATDDKPIYKRMF 559
             DD+P+YK++F
Sbjct: 545 QHDDQPMYKKVF 556

>NCAS0J00120 Chr10 complement(4561..6279) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/559 (64%), Positives = 446/559 (79%), Gaps = 10/559 (1%)

Query: 10  EDVHSSTAGSVHS----SQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVA 65
           E+  S +  S HS    + SF+E  ++ +D NE    ++EIPKKPASAY ++ I C M+ 
Sbjct: 16  ENSGSQSVLSDHSIKDENDSFKENGENGEDANE---AVVEIPKKPASAYATISIFCCMIG 72

Query: 66  FGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVL 125
           FGGFISGWDTGTIGGFL+H DY+ RFG  H DG+ Y S VRTGL+VSIFN+G   G ++L
Sbjct: 73  FGGFISGWDTGTIGGFLAHPDYLRRFGQHHHDGTHYFSNVRTGLVVSIFNIGGLFGCLIL 132

Query: 126 GRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLIS 185
           G L + +GR+  +V+ V I+++GI+IQIASI+KWYQYFIGRII+GLG G I++ SPML+S
Sbjct: 133 GDLANRIGRKMALVVVVIIFMIGIIIQIASINKWYQYFIGRIISGLGVGAISIFSPMLLS 192

Query: 186 EISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAM 245
           E+SPKHLRGTL S YQLM+T G+FLG CTNYGTK Y NS+QWRVPLGL FAW L MI AM
Sbjct: 193 EVSPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKKYSNSVQWRVPLGLSFAWCLFMIAAM 252

Query: 246 FIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSE 305
           F VPESPRYLVE G++EEAKRS+A SNKV+IDDPA   E++L+   VEAE+ AG+ASW E
Sbjct: 253 FFVPESPRYLVEVGKMEEAKRSIATSNKVSIDDPAVQGEVDLILAGVEAERLAGNASWGE 312

Query: 306 LFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAS 365
           LF TK K +QR  M  ++  LQQLTGCNYFFYYGT+IF+AVG++DS+QT+++FG+VNFAS
Sbjct: 313 LFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIVFGVVNFAS 372

Query: 366 TFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNG---QDQPSSKGAGNTMI 422
           TFVALYVVD++GRR CL+WGAA MVCC VV+ASVGVT+L+P+G   +D  SSKGAGN MI
Sbjct: 373 TFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSSKGAGNCMI 432

Query: 423 VFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI 482
            FSCFFIFCFA TWAPI ++++SE+FPLR+K KGMAL    N  WNF I FFTPFITGAI
Sbjct: 433 CFSCFFIFCFACTWAPICWIVVSEAFPLRIKPKGMALANGCNWFWNFLISFFTPFITGAI 492

Query: 483 NFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDY 542
           NFYYGYVF+GC+VF Y YVF FVPE KGL LE+VN +WE+GVLPWKS +WVP S+RG D 
Sbjct: 493 NFYYGYVFMGCMVFGYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPNWVPSSRRGADV 552

Query: 543 NAEALATDDKPIYKRMFSK 561
           N +    DDKP++K+MF +
Sbjct: 553 NMDEFQKDDKPLFKKMFGR 571

>NCAS0E03210 Chr5 complement(637282..638961) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/518 (63%), Positives = 419/518 (80%)

Query: 45  EIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSK 104
           E   KP SAY +V  +CLM+AFGGFI GWD GTIGGF+  +D+  RFG  + +G  YLS 
Sbjct: 42  EGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFVGQTDFKRRFGELNDEGEYYLSD 101

Query: 105 VRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFI 164
           VRTGL+V+ FN+GCA G ++LGRLGD  GR+ G+V  V +Y+VG+VIQI+S + W QYFI
Sbjct: 102 VRTGLIVATFNLGCAFGGIILGRLGDFYGRKIGLVCVVSVYVVGVVIQISSTNNWIQYFI 161

Query: 165 GRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNS 224
           GRI++GLG G IAVLSP LISEI+PKHLRG  +S YQLMIT G+F+GYCTNYG+K+Y NS
Sbjct: 162 GRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQLMITGGIFVGYCTNYGSKSYTNS 221

Query: 225 IQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQE 284
           IQWR+PLGL FAWAL+M+  M +VPESPRYL+EKG+ EEAKRS+AKSNK T+DDP  ++E
Sbjct: 222 IQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFEEAKRSLAKSNKTTVDDPIVLRE 281

Query: 285 IELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFK 344
            +++   VEAE+A G+ASW+ELF TK KVLQR +MG++V +LQQLTGCNYFFYYGT IF+
Sbjct: 282 FDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIMVQSLQQLTGCNYFFYYGTTIFQ 341

Query: 345 AVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKL 404
           AVG++DS+ TS++ G+VNF+STF++L+ V+++GRR CLLWG+A M CC VVFAS+GVTKL
Sbjct: 342 AVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCLLWGSASMACCFVVFASMGVTKL 401

Query: 405 WPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSN 464
           +PNG DQP+SK AGN MIVF+C FIFCFA +WAPI FV+++ES+P R+K + MA+   +N
Sbjct: 402 YPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFVVVAESYPQRIKQRAMAIAVAAN 461

Query: 465 QMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGV 524
            +WNF IGF TPFIT AINFYYG+VF GCL+FS+ Y+F FV ETKGL LE+ N M+EEG 
Sbjct: 462 WIWNFAIGFCTPFITSAINFYYGFVFFGCLIFSFFYIFFFVCETKGLSLEEFNEMYEEGT 521

Query: 525 LPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMFSKN 562
           LPWKS +W+P S+RG DY+  A   DD+  ++++FSK 
Sbjct: 522 LPWKSDTWIPSSRRGADYDVHATQNDDQTFFQKIFSKK 559

>Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON}
           YMR011W (HXT2) - high affinity hexose transporter-2
           [contig 245] FULL
          Length = 570

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/553 (62%), Positives = 419/553 (75%), Gaps = 8/553 (1%)

Query: 6   SPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVA 65
           SPT  D  S T  +  S   F        + NEI       P+KP S Y+ V  +CLMVA
Sbjct: 23  SPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEI-------PQKPLSEYILVMCLCLMVA 75

Query: 66  FGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKY-LSKVRTGLLVSIFNVGCAIGSVV 124
           FGGF+ GWDTGTI GF++ +D+  RFG+      KY LS VRTGL+VSIFN+GCAIG + 
Sbjct: 76  FGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLT 135

Query: 125 LGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLI 184
           LGRLGD  GRR G++  + +Y+VGI+IQIAS +KWYQYFIGRI++GLG G IAVLSP LI
Sbjct: 136 LGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLI 195

Query: 185 SEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGA 244
           SE +PKHLRGT VS YQLMIT G+F+GYCTNYGTKTY N++QW++PLGLCF WA+ MI  
Sbjct: 196 SETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAG 255

Query: 245 MFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS 304
           M  VPESPRYL+EKG  EEAKRS+AKSNK+T++D   + E+EL+   VEAE+ AG+ASW 
Sbjct: 256 MIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWG 315

Query: 305 ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFA 364
           ELF  K K+LQR +MG ++ +LQQLTG NYFFYYGT IF AVG++DSFQTS++ G+VNFA
Sbjct: 316 ELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFA 375

Query: 365 STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVF 424
           STFV LY V++YGRR CLLWG+A M  C VVFASVGVTKL+PNG+D PSSK AGN MI F
Sbjct: 376 STFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIFF 435

Query: 425 SCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINF 484
           +C FIF FATTWAPI +VI+SE++PLRVK + MA+   SN +W F IGF TPFIT AI F
Sbjct: 436 TCLFIFFFATTWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGF 495

Query: 485 YYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNA 544
           YYGYVF+GCLVFS+ YVF FV ETKGL LE+VN M++EGVLPWKS +WVP  +R   Y+ 
Sbjct: 496 YYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYQEGVLPWKSETWVPALRRNESYDV 555

Query: 545 EALATDDKPIYKR 557
                D KP YKR
Sbjct: 556 NETQEDSKPFYKR 568

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/553 (59%), Positives = 415/553 (75%), Gaps = 13/553 (2%)

Query: 2   DYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDF----NEIDSQIIEIP-------KKP 50
           D  Q     +V +   GS  S + ++   K  ++      EI S+  E+        +KP
Sbjct: 5   DIEQPILERNVATENDGSTDSYKRYRSATKIEENSFGTKEEICSETREVSTVGSISSEKP 64

Query: 51  AS--AYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTG 108
                Y +VC+MC+MVAFGGF+ GWD GTIGGF++ +D+I RFG+ + DG  YLS +R G
Sbjct: 65  TDIWKYTTVCLMCIMVAFGGFMMGWDIGTIGGFMAQTDFIQRFGTKNEDGVLYLSTIRMG 124

Query: 109 LLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRII 168
           LLVSIFN+GCAIGSV LG+LGD  GRR G++    I++VG++IQIAS+ KW+QYFIGRII
Sbjct: 125 LLVSIFNIGCAIGSVFLGKLGDLYGRRWGLIFGTSIFVVGVIIQIASVSKWFQYFIGRII 184

Query: 169 AGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWR 228
           AG+G G IAVLSPMLISE++PK LRG +VSCYQLMITFG+FLG C NYGTK+Y NS QWR
Sbjct: 185 AGIGMGVIAVLSPMLISEVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYQNSKQWR 244

Query: 229 VPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELV 288
           + +GL F W ++M+  M  VPESPRYLV++   EEAK S+A SNK++ +   T+QE E+V
Sbjct: 245 IAVGLQFLWCIIMVSGMTFVPESPRYLVQQNMFEEAKESIAISNKLSKESEETLQEFEIV 304

Query: 289 QIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGL 348
           +  ++AE  AG A W ELF  K K+LQR LMG+ VL LQQLTG NYFFYYG  +FK+VGL
Sbjct: 305 KAGIQAELDAGEAQWKELFHRKNKILQRVLMGIFVLGLQQLTGANYFFYYGATVFKSVGL 364

Query: 349 EDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNG 408
           +DSFQT++IFG+VNF STFV+LYVVD++GRR CLL G+A +  CM+VFA+VGVT L+   
Sbjct: 365 DDSFQTTIIFGVVNFLSTFVSLYVVDRFGRRFCLLVGSAALGLCMLVFATVGVTSLYSGD 424

Query: 409 QDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWN 468
            D PS K AGN MIV SC +IF FATTWAP+PFVI+SE+FP  +K+KGMALG VSNQ+WN
Sbjct: 425 SDVPSCKWAGNVMIVVSCIYIFFFATTWAPVPFVILSETFPTNIKSKGMALGIVSNQLWN 484

Query: 469 FCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWK 528
           F IGF TP+IT +I+FYYGY+FLGC VF++ YVF FVPETKGL L+D+N MWEE   PW+
Sbjct: 485 FVIGFCTPWITKSIHFYYGYIFLGCCVFAFLYVFFFVPETKGLGLDDINTMWEEETYPWR 544

Query: 529 SASWVPPSQRGTD 541
           S+SW+PPSQR  +
Sbjct: 545 SSSWIPPSQRAAN 557

>KNAG0M02690 Chr13 (502232..503911) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/556 (57%), Positives = 430/556 (77%), Gaps = 3/556 (0%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQII---EIPKKPASAYLSVCIMCLMVAF 66
           E+ ++ST  + +S+    + K +        S  I   E+P++PASAY++V I+CL++AF
Sbjct: 4   EEGNTSTISNTNSAIYEDKNKYEDDGLANSGSDAIAPAELPRQPASAYVTVWILCLLIAF 63

Query: 67  GGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLG 126
           GGF+ GWDTGTIGGF+ + D++ RFG  H DG+ Y+S VRTGL+V+ FN+G AIG +V  
Sbjct: 64  GGFLYGWDTGTIGGFMKYPDFLRRFGLRHKDGTYYMSNVRTGLIVAFFNIGAAIGGIVWS 123

Query: 127 RLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISE 186
           RLG+  GR+  + +   +Y +G+VIQIASI KWYQYF+GRII+G G G I V S MLI E
Sbjct: 124 RLGNIYGRKLSLALVTVVYTIGLVIQIASISKWYQYFVGRIISGCGIGGIGVYSSMLIGE 183

Query: 187 ISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMF 246
            +PKH+RGTLVSCYQLMIT G+FLG CT  GTK Y NS+QWRVPLGL FAW+L MI  + 
Sbjct: 184 TAPKHVRGTLVSCYQLMITLGIFLGNCTELGTKNYSNSVQWRVPLGLGFAWSLFMICGLS 243

Query: 247 IVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSEL 306
            VPESPR+L+E G+IEEA+ S+AKSNK++ DDP  I E EL+  ++E+E+A G+A+W EL
Sbjct: 244 FVPESPRFLIEVGKIEEARESIAKSNKLSPDDPGVIGETELMAASIESERAVGNATWREL 303

Query: 307 FQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAST 366
           +  K K+L RT+ G+++ +L+QLTG NYFFYYGT IF A+GL+DSF+T+++  ++NFA+T
Sbjct: 304 WSPKGKILHRTIFGLMIQSLEQLTGINYFFYYGTQIFVAIGLKDSFETAIVISVINFAAT 363

Query: 367 FVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSC 426
            V ++ +D++GRR CLLWGA GM+ C+VV+ASVGV +L+PNG+D+P+SKGAG+ MI F+C
Sbjct: 364 GVGIFFIDRFGRRACLLWGALGMIACLVVYASVGVRRLFPNGRDRPASKGAGDCMICFTC 423

Query: 427 FFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYY 486
           F+I CFATTWAP  +VII+E+FPLR+K K MAL   +  +W F I FFTPFI+ AI+F Y
Sbjct: 424 FYIVCFATTWAPAGYVIIAETFPLRIKPKAMALAMTAKWIWAFLIAFFTPFISSAIHFSY 483

Query: 487 GYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEA 546
           GYVF+GC+ F++CYVF  VPETKGL LE+VN+MWEEGVLPWKS +WVPPS+R  DY+A+A
Sbjct: 484 GYVFMGCVCFAWCYVFLMVPETKGLSLEEVNVMWEEGVLPWKSTAWVPPSKRNDDYDADA 543

Query: 547 LATDDKPIYKRMFSKN 562
           +A DD P+YKRM  + 
Sbjct: 544 MAHDDVPVYKRMLGRK 559

>Kpol_1057.20 s1057 (38011..39723) [1713 bp, 570 aa] {ON}
           (38011..39723) [1713 nt, 571 aa]
          Length = 570

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/541 (61%), Positives = 417/541 (77%), Gaps = 5/541 (0%)

Query: 21  HSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGG 80
           HSS +  +   D  D    +S  +     P   Y  V  +CLM+AFGGFI GWDTGTI G
Sbjct: 29  HSSNASNKSSGDDIDLKH-ESDYVVPATGPIGQYAGVLALCLMIAFGGFIFGWDTGTISG 87

Query: 81  FLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIV 139
           F+S +D++ RFGS  H     Y SKVRTGL+V IFN+GC IG + LGR GD  GRR G++
Sbjct: 88  FVSQTDFLRRFGSYDHVKNDYYFSKVRTGLVVGIFNIGCCIGGLTLGRTGDMYGRRIGLM 147

Query: 140 IAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSC 199
           I   +Y++GI+I IASI+KWYQYFIGRII+G+G G IAVL P LISE +P HLRGT V+ 
Sbjct: 148 IVTVVYVIGIIISIASINKWYQYFIGRIISGMGVGGIAVLCPTLISETAPSHLRGTAVAF 207

Query: 200 YQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKG 259
           YQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGL FAWAL M+G M +VPES RYL ++G
Sbjct: 208 YQLMITGGIFLGYCTNYGTKKYHNSVQWRVPLGLSFAWALFMLGGMTLVPESSRYLAQQG 267

Query: 260 QIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLM 319
           ++EEAKRS+A  NK T+DDP  I E+E +   VEAE+AAGSASW+ELF TK K+  R LM
Sbjct: 268 RLEEAKRSLAICNKCTVDDPIVIHEMEEIMAGVEAERAAGSASWAELFVTKGKIFHRVLM 327

Query: 320 GVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRR 379
           GV++ +LQQLTG NYFFYYGT +F +VGL+D F+ +++ G+VNFASTFV L+ V+++GRR
Sbjct: 328 GVMIQSLQQLTGNNYFFYYGTTLFVSVGLDDGFEAAIVIGVVNFASTFVGLWTVERFGRR 387

Query: 380 TCLLWGAAGMVCCMVVFASVGVTKLWPNG---QDQPSSKGAGNTMIVFSCFFIFCFATTW 436
            CLLWGAA M+CC VV+ASVGVT+L+P G   +++ +S+GAGN MIVF+CFFIFCFATTW
Sbjct: 388 RCLLWGAATMMCCFVVYASVGVTRLYPRGYGQREEYTSEGAGNCMIVFTCFFIFCFATTW 447

Query: 437 APIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVF 496
           APIP+VI+SE+FPLR++ + +AL   +N +W F I FFTPFITGAI+F YGYVF+GCLVF
Sbjct: 448 APIPYVIVSETFPLRIRGRAIALSVGANWLWGFLISFFTPFITGAIHFAYGYVFMGCLVF 507

Query: 497 SYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYK 556
           ++ YVF FV ETKGL LE+VN M+EEGVLPWKSA W+P S+R   Y+AEA   DDKP YK
Sbjct: 508 AWFYVFFFVCETKGLTLEEVNEMYEEGVLPWKSAGWIPSSKREGGYDAEAALHDDKPWYK 567

Query: 557 R 557
           R
Sbjct: 568 R 568

>KLTH0C00462g Chr3 complement(49362..51074) [1713 bp, 570 aa] {ON}
           highly similar to uniprot|P23585 Saccharomyces
           cerevisiae YMR011W HXT2 High-affinity glucose
           transporter of the major facilitator superfamily
           expression is induced by low levels of glucose and
           repressed by high levels of glucose
          Length = 570

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/559 (61%), Positives = 425/559 (76%), Gaps = 5/559 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEID----SQIIEIPKKPASAYLSVCI 59
           ++S    D+  +   +   SQS     K S D  +I     ++  EIP+KP S Y+ V  
Sbjct: 10  NRSNNNTDLAIAGTSTNLDSQSATPSNKMSDDAFDIKGSPAAEAHEIPQKPLSEYILVMC 69

Query: 60  MCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKY-LSKVRTGLLVSIFNVGC 118
           +CLMVAFGGF+ GWDTGTI GF++ +D+  RFG  ++   +Y LS VRTGL+V+IFN+GC
Sbjct: 70  LCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGDYNTTTEEYYLSNVRTGLIVAIFNIGC 129

Query: 119 AIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAV 178
           A+G + LGRLGD  GRR G++  + +Y+VGIVIQI++  KWYQYFIGRI++GLG G IAV
Sbjct: 130 AVGGLTLGRLGDMQGRRLGLMAVILVYVVGIVIQISASGKWYQYFIGRIVSGLGVGGIAV 189

Query: 179 LSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWA 238
           LSP LISE +PKHLRGT VS YQLMIT G+FLGYCTNYGTKTY NS+QWR+PLGLCF WA
Sbjct: 190 LSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKTYTNSVQWRLPLGLCFLWA 249

Query: 239 LVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAA 298
           + MIG M  VPESPRYL+EKG+ EEAKRS+AKSNK+  +D   + E++L+   VEAE+ A
Sbjct: 250 IFMIGGMVFVPESPRYLIEKGRFEEAKRSIAKSNKLDTEDSGVLAEVDLINAGVEAEKLA 309

Query: 299 GSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIF 358
           G+A W ELF  + K+LQR +MG ++ +LQQLTG NYFFYYGT IF+AVGL+DSFQTS+I 
Sbjct: 310 GNARWGELFSPRGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFQAVGLDDSFQTSIIL 369

Query: 359 GIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAG 418
           G+VNF STFV LY V+K+GRR CLLWG+A M  C VVFASVGVTKL+PNG+D P+SK AG
Sbjct: 370 GVVNFMSTFVGLYTVEKFGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPTSKSAG 429

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MI F+C FIF FATTWAPI +VI+SE++PLRVK + MA+   SN +W F IGFFTPFI
Sbjct: 430 NAMIFFTCLFIFFFATTWAPIAYVIVSETYPLRVKNRAMAMSVGSNWIWGFLIGFFTPFI 489

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           T AI FYYGYVF+GCLVFS+ YVF FV ETKGL LE+VN M+EEGVLPWKS SWVP  +R
Sbjct: 490 TSAIGFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYEEGVLPWKSESWVPALRR 549

Query: 539 GTDYNAEALATDDKPIYKR 557
              Y+      D KP YKR
Sbjct: 550 DESYDVNETHEDGKPFYKR 568

>NDAI0G04470 Chr7 complement(1071044..1072729) [1686 bp, 561 aa]
           {ON} 
          Length = 561

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/519 (63%), Positives = 413/519 (79%), Gaps = 2/519 (0%)

Query: 20  VHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIG 79
           +++S +  +  K++   +E+D+    I  KP ++Y++V  +CLM+AFGGFI GWDTGTI 
Sbjct: 33  LNTSSNSPKTDKETLLVSEVDTT--TIATKPLTSYITVICLCLMIAFGGFIFGWDTGTIS 90

Query: 80  GFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIV 139
           GF++ +D+I RFG   S+G   LS VRTGL+V IFN+GCA G ++LGRLGD  GRR G++
Sbjct: 91  GFVAQTDFIERFGILQSNGEYKLSNVRTGLIVGIFNIGCAFGGLLLGRLGDYFGRRIGLM 150

Query: 140 IAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSC 199
           +   +YI GI IQI+S DKWYQYFIGR+I+G+G G IAVLSP LISEI+PKHLRG  VS 
Sbjct: 151 VVAVVYIGGITIQISSSDKWYQYFIGRVISGMGVGGIAVLSPGLISEIAPKHLRGMCVSL 210

Query: 200 YQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKG 259
           YQLMIT G+F+GYC NYGTK+Y+NS+QWRVPLGL +AWAL MI  M++VPESPRYL+  G
Sbjct: 211 YQLMITAGIFVGYCANYGTKSYNNSVQWRVPLGLGYAWALFMILGMWLVPESPRYLISVG 270

Query: 260 QIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLM 319
           + +EAK S+A+SNK T++D   + E + +   VEAE+ AG+A+W ELF  K KVL R +M
Sbjct: 271 KKDEAKASLARSNKTTVEDTLVLAEFDAISAGVEAEKLAGNATWRELFSRKNKVLNRVIM 330

Query: 320 GVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRR 379
           GV++ +LQQLTGCNYFFYYGT+IFKAVGLEDSFQTS+I G VNFASTFVAL+ V+++GRR
Sbjct: 331 GVMIQSLQQLTGCNYFFYYGTLIFKAVGLEDSFQTSIILGAVNFASTFVALWTVERFGRR 390

Query: 380 TCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPI 439
            CLLWG+A M CC VVFASVGVT+LWPNG+DQ +S GAGN MIVF+CFFIFCFA TWAPI
Sbjct: 391 KCLLWGSAAMACCFVVFASVGVTRLWPNGKDQATSTGAGNCMIVFTCFFIFCFAITWAPI 450

Query: 440 PFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYC 499
            FVI++E++PLR+K + MA+   +N +W F IGF TPFIT AINFYYGYVF+GCLVFS+ 
Sbjct: 451 AFVIVAETYPLRMKQRAMAIAVGANWIWGFAIGFCTPFITSAINFYYGYVFMGCLVFSFI 510

Query: 500 YVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           YVF FV ETKGL LE+VN M+ EGV PWKS +W PP+ R
Sbjct: 511 YVFFFVCETKGLTLEEVNQMYIEGVKPWKSTNWTPPANR 549

>NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/550 (62%), Positives = 426/550 (77%), Gaps = 4/550 (0%)

Query: 14  SSTAGSVHSSQSFQEMKKDSQDFN-EIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISG 72
           SS   S  +S SF   +    +   E DSQ+     KP      VC+ C+MV+FGGFI G
Sbjct: 45  SSVPRSQGTSNSFTTKEDQMSELQKEADSQL---ESKPRKDLFFVCLCCIMVSFGGFIFG 101

Query: 73  WDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV 132
           WDTGTI GF+  +D+I RFG + ++G+ YLS VRTGL+VSIFN+G AIG + L + GD  
Sbjct: 102 WDTGTISGFIRQTDFIRRFGQTRANGTHYLSTVRTGLIVSIFNIGAAIGGITLSKTGDMW 161

Query: 133 GRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHL 192
           GRR G++  + IYIVGI+IQI S +KWYQYFIGRII+GLG G I VL+PMLISE++PK L
Sbjct: 162 GRRLGLITVIGIYIVGILIQITSFNKWYQYFIGRIISGLGVGGITVLAPMLISEVAPKKL 221

Query: 193 RGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           RGT+VSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWAL MI  M +VPESP
Sbjct: 222 RGTMVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMISGMTLVPESP 281

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           RYLVE G+I EA+R +A+ NKV+ D P    E+E  + +VEAE+ AG+ASW EL   K  
Sbjct: 282 RYLVEVGKIAEARRGLARVNKVSEDSPLVQLELEKYESSVEAERLAGNASWGELVTGKPA 341

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           +L+RT+MG+++ +LQQLTG NYFFYYGT IF+AVGL DSF+T+++ G+VNF STF ALY 
Sbjct: 342 MLRRTIMGMMIQSLQQLTGANYFFYYGTTIFQAVGLSDSFETAIVLGVVNFVSTFFALYF 401

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCF 432
           VD YGRR CLLWG  GMVCC VV+ASVGVT+L PNG + P+SKGAGN MIVF+CFFIFCF
Sbjct: 402 VDHYGRRLCLLWGCVGMVCCYVVYASVGVTRLHPNGMNNPTSKGAGNCMIVFACFFIFCF 461

Query: 433 ATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLG 492
           ATTWAPI +V+ SE++PLRV+ K M++ +  N +W F I FFTPFIT AINF YGYVF+G
Sbjct: 462 ATTWAPIAYVVTSETYPLRVRGKAMSIASACNWIWGFLISFFTPFITSAINFSYGYVFMG 521

Query: 493 CLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDK 552
           C+VF++ +VF FVPETKGL LE+VN M+EEGVLPWKS+SWVPPS+R  DY+ +AL  D +
Sbjct: 522 CMVFAFFFVFFFVPETKGLTLEEVNEMYEEGVLPWKSSSWVPPSKRTADYDIDALQQDTR 581

Query: 553 PIYKRMFSKN 562
           P YK++ ++N
Sbjct: 582 PFYKKILNRN 591

>TPHA0H01570 Chr8 complement(354813..356744) [1932 bp, 643 aa] {ON}
           Anc_5.396 YHR096C
          Length = 643

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/558 (62%), Positives = 435/558 (77%), Gaps = 10/558 (1%)

Query: 13  HSSTAGSVHSSQSFQEM-------KKDSQDFNEIDSQI-IEIPKKPASAYLSVCIMCLMV 64
           HS  AG    S   +E        +KD     E ++ + ++  KK    ++++C  C+MV
Sbjct: 56  HSVLAGKSAGSNLQEEGSIFNEPGEKDELTVMEKEADMQVKTKKKKDLTFVAIC--CVMV 113

Query: 65  AFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVV 124
           AFGGFI GWDTGTI GF+  +D+I RFG + SDG+ YLS VRTGL+VSIFN+GCAIG +V
Sbjct: 114 AFGGFIFGWDTGTISGFIRQTDFIRRFGQTRSDGTSYLSNVRTGLVVSIFNIGCAIGGIV 173

Query: 125 LGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLI 184
           L ++GD  GR+ G+   V +YI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPMLI
Sbjct: 174 LTKVGDVYGRKIGLYFVVTVYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLI 233

Query: 185 SEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGA 244
           SE+SPK LRGTLVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGL FAWAL MI  
Sbjct: 234 SEVSPKQLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLSFAWALFMIIG 293

Query: 245 MFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS 304
              VPESPR+LVE G+IEEAKR++AK+NK + D    + E+E  + A+EAE  AG A WS
Sbjct: 294 TSFVPESPRFLVETGRIEEAKRALAKTNKTSPDSSFVLVELEKYEAAIEAETVAGKAGWS 353

Query: 305 ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFA 364
           EL   K ++ +RT++G+++ +LQQLTG NYFFYYGT IF+AVGL DSF+T+++ GIVNFA
Sbjct: 354 ELVTGKPQMFRRTIIGMMIQSLQQLTGANYFFYYGTTIFQAVGLSDSFETAIVLGIVNFA 413

Query: 365 STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVF 424
           STFVALYVVD+YGRR CLLWG  GMVCC VV+ASVGVT+L+PNGQ QP+S+GAGN MIVF
Sbjct: 414 STFVALYVVDRYGRRNCLLWGCVGMVCCYVVYASVGVTRLYPNGQSQPTSQGAGNCMIVF 473

Query: 425 SCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINF 484
           +CFFIFCFATTWAPI +VI+SE++PLR++ K +++    N +W F I FFTPFIT AINF
Sbjct: 474 ACFFIFCFATTWAPIAYVIVSETYPLRIRGKAISIANACNWIWGFLISFFTPFITSAINF 533

Query: 485 YYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNA 544
           YYGYVF+GC+VF+Y +VF  VPETKGL LE+VN M+EE VLPWKS++W+PPS+R  +YN 
Sbjct: 534 YYGYVFMGCMVFAYFFVFFIVPETKGLTLEEVNEMYEENVLPWKSSAWIPPSRRDANYNV 593

Query: 545 EALATDDKPIYKRMFSKN 562
           + L  D +P YKRM  +N
Sbjct: 594 DQLKEDKRPWYKRMPGQN 611

>Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011W
           (REAL)
          Length = 541

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/536 (62%), Positives = 421/536 (78%), Gaps = 1/536 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDS-QDFNEIDSQIIEIPKKPASAYLSVCIMCL 62
           S+  T     +S   S+HS+ + ++++ D  Q   + +    E+P+KP +AY +V  +CL
Sbjct: 2   SELATNPVESASQEPSIHSTSAVKKLETDDFQLQTKSEHNSAELPQKPITAYWTVICLCL 61

Query: 63  MVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGS 122
           M+AFGGF+ GWDTGTI GF++ SD+  RFG   SDG+ YLS VRTGL+VSIFN+GCA+G 
Sbjct: 62  MIAFGGFVFGWDTGTISGFVNQSDFKRRFGQMKSDGTYYLSDVRTGLIVSIFNIGCAVGG 121

Query: 123 VVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPM 182
           + LGRLGD  GR+ G++  + +YIVGIVIQIAS DKWYQYFIGRII+G+G G IAVLSP 
Sbjct: 122 LTLGRLGDIYGRKIGLMCVILVYIVGIVIQIASTDKWYQYFIGRIISGMGVGGIAVLSPT 181

Query: 183 LISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMI 242
           LISE +PKH+RGT VS YQLMIT G+FLGYCTNYGTK Y NSIQWRVPLG+ FA+A+ MI
Sbjct: 182 LISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSIQWRVPLGMNFAFAIFMI 241

Query: 243 GAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS 302
             M +VPESPR+LVEKG+ E+AKRS+A+SNKVTI+DP+ I E++ ++  VE E+ AG+AS
Sbjct: 242 AGMLMVPESPRFLVEKGRYEDAKRSLARSNKVTIEDPSIIAEMDTIRANVEVERLAGNAS 301

Query: 303 WSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVN 362
           W ELF +K  +L R +MG+++ +LQQLTG NYFFYYGT IF AVG++DSFQTS++ GIVN
Sbjct: 302 WGELFSSKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVN 361

Query: 363 FASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMI 422
           FASTFVALY VDK+GRR CLL G+A M  C V+F++VGVT L+PNG+DQ SSKGAGN MI
Sbjct: 362 FASTFVALYTVDKFGRRKCLLGGSAFMAICFVIFSTVGVTSLYPNGKDQASSKGAGNVMI 421

Query: 423 VFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI 482
           +F+C FIF FA +WAPI +VI+SES+PLRVK + MA+   +N +W F IGFFTPFIT AI
Sbjct: 422 IFTCLFIFFFAISWAPIAYVIVSESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAI 481

Query: 483 NFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           +F YGYVF+GCLVFS+ YVF FV ETKGL LE+VN M+ EGV PWKS SW+    R
Sbjct: 482 SFSYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYVEGVKPWKSGSWISKENR 537

>Kpol_1059.39 s1059 (87634..89325) [1692 bp, 563 aa] {ON}
           (87634..89325) [1692 nt, 564 aa]
          Length = 563

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/555 (62%), Positives = 431/555 (77%), Gaps = 11/555 (1%)

Query: 19  SVHSSQSFQEMK----KDSQDFNEIDSQIIEI--PKKPASAYLSVCIMCLMVAFGGFISG 72
           S HSS++   M+    KD+ +    D Q  EI  P    +AY++V I C+MVAFGGFI G
Sbjct: 9   SSHSSRAVDVMEDKEDKDAFELTNPDQQYHEIENPNSGFAAYMTVSICCIMVAFGGFIFG 68

Query: 73  WDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV 132
           WDTGTI GF++ SD+  RFGS   +G  YLSKVRTGL+VSIFN+GCAIG V L ++GD  
Sbjct: 69  WDTGTISGFVNMSDFKERFGSISGEGKPYLSKVRTGLVVSIFNIGCAIGGVTLTKVGDVK 128

Query: 133 GRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHL 192
           GR+ G+   +  YIVGI+IQIASI+KWYQYFIGRII+G+G G IAVL P+LISE+SPKHL
Sbjct: 129 GRKAGLTTVIGTYIVGIIIQIASINKWYQYFIGRIISGMGVGGIAVLCPLLISEVSPKHL 188

Query: 193 RGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESP 252
           RGTLVS YQL +T G+F+GYCTNYGTKTY NS+QWRVPLGL FAWAL M+G +  VPESP
Sbjct: 189 RGTLVSIYQLNVTAGIFVGYCTNYGTKTYTNSVQWRVPLGLGFAWALFMLGGLTFVPESP 248

Query: 253 RYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTK 312
           R+L+EK + EEA+ S+AK NK+  D P   QEIEL+  +VE    AG ASW EL + K  
Sbjct: 249 RFLLEKEREEEARASLAKINKLPGDHPFIQQEIELITASVEESAMAGDASWMELIKGKPA 308

Query: 313 VLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYV 372
           +L+RT+MG+++ +LQQLTGCNYFFYYGT IF+AVGLED+F+T+++FG+VNFASTF ALY 
Sbjct: 309 MLRRTMMGIMLHSLQQLTGCNYFFYYGTTIFQAVGLEDAFETAIVFGVVNFASTFFALYT 368

Query: 373 VDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQ---PSSKGAGNTMIVFSCFFI 429
           VD +GRR CLLWG  GMVCC VV+ASVGVT+LWP+G D     +SKGAGN MIVF+CFFI
Sbjct: 369 VDHFGRRGCLLWGCVGMVCCYVVYASVGVTRLWPDGYDNRDFNTSKGAGNCMIVFACFFI 428

Query: 430 FCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYV 489
           F FATTWAP+PFVII+ES+PLRVKAK M++   +N +W F I FFTPFIT AINFYYGYV
Sbjct: 429 FSFATTWAPVPFVIIAESYPLRVKAKAMSVAIGANWIWGFLISFFTPFITEAINFYYGYV 488

Query: 490 FLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALAT 549
           F+GC+VF++ YV+ FVPET+GL LE+VN M+ +GV+PW+S+ WVP S+RG DYN +AL  
Sbjct: 489 FMGCMVFAFFYVYFFVPETQGLTLEEVNDMYADGVVPWRSSEWVPLSKRGQDYNPDALVE 548

Query: 550 D--DKPIYKRMFSKN 562
           D    P +K+  SK 
Sbjct: 549 DTTKAPFFKKFMSKK 563

>Kpol_1049.20 s1049 (47753..49456) [1704 bp, 567 aa] {ON}
           (47753..49456) [1704 nt, 568 aa]
          Length = 567

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/542 (64%), Positives = 419/542 (77%), Gaps = 3/542 (0%)

Query: 19  SVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTI 78
           S  +S    +M  D  D      +       P S Y  V  +CLMVAFGGFI GWDTGTI
Sbjct: 24  SSQNSTPSNKMGGDDMDLKAEGHEEYIQEVGPLSQYFGVLALCLMVAFGGFIFGWDTGTI 83

Query: 79  GGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGI 138
            GF++  D++ R GS + +G  Y SKVRTGL+V IFNVGCAIG + LG  GD  GRR G+
Sbjct: 84  SGFIAQKDFLRRLGSLNDEGVYYFSKVRTGLVVGIFNVGCAIGGLTLGGTGDRYGRRIGL 143

Query: 139 VIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVS 198
           +I   +YIVGIVIQIA+I+KWYQYFIGRII+G+G G IAVLSP LISE +P HLRGT V+
Sbjct: 144 MIVTVVYIVGIVIQIATINKWYQYFIGRIISGMGVGGIAVLSPTLISETAPAHLRGTAVA 203

Query: 199 CYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEK 258
            YQLMIT G+FLGYCTNYGTK YDNS+QWRVPLGL FAWAL M+G M +VPESPRYLV++
Sbjct: 204 FYQLMITAGIFLGYCTNYGTKNYDNSVQWRVPLGLGFAWALFMLGGMTLVPESPRYLVQE 263

Query: 259 GQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTL 318
           G+IEEAKRS+A SNK T+D P  I E E +   VEAE++AGSA+W ELF T  K+LQR +
Sbjct: 264 GRIEEAKRSLAISNKCTVDSPVVIGEYENIAAGVEAERSAGSATWGELFSTNGKILQRVI 323

Query: 319 MGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGR 378
           MGV+V +LQQLTG NYFFYYGT +F+AVGLEDSF+TS++FGIVNFASTFVAL+ V+++GR
Sbjct: 324 MGVMVNSLQQLTGANYFFYYGTTVFQAVGLEDSFETSIVFGIVNFASTFVALWTVERFGR 383

Query: 379 RTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP---SSKGAGNTMIVFSCFFIFCFATT 435
           R CLLWG+A M CC V++ASVGVT+L+P+G D     +S GAGN MI F+CFFIFCFATT
Sbjct: 384 RRCLLWGSATMTCCFVIYASVGVTRLYPDGIDNKEISTSTGAGNCMICFTCFFIFCFATT 443

Query: 436 WAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLV 495
           WAP  +VIISESFPLR++AK +++   +N +W F I FFTPFIT AINFYYGYVF+GCLV
Sbjct: 444 WAPTAYVIISESFPLRIRAKAISVAVGANWLWGFLISFFTPFITEAINFYYGYVFMGCLV 503

Query: 496 FSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIY 555
           FS+ YVF FV ETKGL LE+VN M+EEGVLPWKS +WVP  +R   Y+A+A   D+KP Y
Sbjct: 504 FSWFYVFFFVCETKGLSLEEVNEMYEEGVLPWKSPNWVPSGRRDMGYDADAALHDNKPWY 563

Query: 556 KR 557
           KR
Sbjct: 564 KR 565

>Smik_6.68 Chr6 (125842..127482) [1641 bp, 546 aa] {ON} YFL011W
           (REAL)
          Length = 546

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/534 (63%), Positives = 416/534 (77%), Gaps = 7/534 (1%)

Query: 6   SPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFN-EIDSQIIEIPKKPASAYLSVCIMCLMV 64
           SP    + +ST  S   S      +KD      E+    I+IP KP  AY +V  +CLM+
Sbjct: 3   SPNVSVLETSTKASTSPS------RKDVVKLTPEVKEASIDIPYKPIIAYWTVMGLCLMI 56

Query: 65  AFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVV 124
           AFGGFI GWDTGTI GF++ +D+  RFG    DGS  LS VRTGL+V IFN+GCA+G + 
Sbjct: 57  AFGGFIFGWDTGTISGFINQTDFKRRFGEMQEDGSFQLSDVRTGLIVGIFNIGCALGGLT 116

Query: 125 LGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLI 184
           LGRLGD  GR+ G++  + +Y+VGIVIQI+S DKWYQYFIGRII+G+G G +AVLSP LI
Sbjct: 117 LGRLGDIYGRKIGLMFVILVYVVGIVIQISSTDKWYQYFIGRIISGMGVGGVAVLSPTLI 176

Query: 185 SEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGA 244
           SEISPKHLRGT VS YQLMIT G+FLGYCTNYGTK Y NSIQWRVPLGLCFAWA+ M+  
Sbjct: 177 SEISPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKKYSNSIQWRVPLGLCFAWAIFMVIG 236

Query: 245 MFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS 304
           M +VPESPRYLV+KG+ EEA+RS+AKSNKVT+ DP  + E + +   +E E A G+ASW 
Sbjct: 237 MAMVPESPRYLVKKGRYEEARRSLAKSNKVTVTDPGVVFEFDAIVANMELETAIGNASWH 296

Query: 305 ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFA 364
           ELF  K ++L R +MGV++ +LQQLTGCNYFFYYGT IF AVG++DSF+TS++ G+VNFA
Sbjct: 297 ELFSNKGEILPRVIMGVVIQSLQQLTGCNYFFYYGTTIFNAVGMQDSFETSIVLGVVNFA 356

Query: 365 STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVF 424
           STFVALY+VDK+GRR CLLWG+A M  C V+FASVGVT+LWP+G+DQPSS+ AGN MIVF
Sbjct: 357 STFVALYIVDKFGRRKCLLWGSASMAVCFVIFASVGVTRLWPHGKDQPSSQSAGNVMIVF 416

Query: 425 SCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINF 484
           +CFFIFCFA TWAPI +VI++E++PLRVK + MA+   +N MW F IGFFTPFIT AI+F
Sbjct: 417 TCFFIFCFAITWAPIAYVIVAETYPLRVKNRAMAIAVGANWMWGFLIGFFTPFITRAISF 476

Query: 485 YYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
            YGYVF+GCL+FSY YVF FV ETKGL LE+VN M+EE + PWKS  W+P S+R
Sbjct: 477 SYGYVFMGCLIFSYFYVFFFVCETKGLTLEEVNEMYEERIKPWKSGDWIPSSRR 530

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/549 (59%), Positives = 419/549 (76%), Gaps = 9/549 (1%)

Query: 11  DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFI 70
           D H+ T       + + E  K    F       IE  KKPASAYL+V ++C++V+FGGF+
Sbjct: 26  DSHTPTV----PDKFYAEEPKGGDGFEPEFQPTIE--KKPASAYLTVSLLCVLVSFGGFL 79

Query: 71  SGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
            GWDTG + GF++  D+  RFGS +H   + YLS VRTGLLV+IF+ GCA G + L +LG
Sbjct: 80  PGWDTGIMAGFVNMDDFKQRFGSYNHKTETYYLSNVRTGLLVAIFSAGCAFGGLTLPKLG 139

Query: 130 DTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISP 189
           D  GRR G++I + +Y+VG +IQI++ DKWYQYFIG+II G G G ++VL+PMLISE +P
Sbjct: 140 DIYGRRLGLMIVIVLYVVGTIIQISAQDKWYQYFIGKIIYGWGVGGVSVLAPMLISETAP 199

Query: 190 KHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVP 249
           KHLRGTL+SCYQLM+TFG+FLGYC  YGT+ Y++S QWR+P+GLCF WA+++IG M  VP
Sbjct: 200 KHLRGTLISCYQLMVTFGIFLGYCAVYGTRKYNSSAQWRIPVGLCFLWAMIIIGGMTFVP 259

Query: 250 ESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQT 309
           ESPR+LVE G++EEAKRSVA+SNKV  ++     EI+L+   VEAE+  G ASW ELF T
Sbjct: 260 ESPRFLVEVGRMEEAKRSVARSNKVDPEEVGVQIEIDLIAAGVEAERQQGKASWGELFST 319

Query: 310 KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVA 369
           KTKVLQR + G+++ +  QLTG NYFFYYGT IFK++GL DSF+TS++ GIVNFASTF++
Sbjct: 320 KTKVLQRLITGILMQSFLQLTGENYFFYYGTTIFKSIGLTDSFETSIVLGIVNFASTFLS 379

Query: 370 LYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQD-QPSSKGAGNTMIVFSCFF 428
           +YVVD +GRR CLLWGAAGM  CMVVFASVGVT LWPNG++   +SKGAGN MIVF+CFF
Sbjct: 380 MYVVDAFGRRKCLLWGAAGMTACMVVFASVGVTSLWPNGENVGEASKGAGNCMIVFTCFF 439

Query: 429 IFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGY 488
           IFCFATTWAPI +V+++ESFPLRVK+K M++ T  N +W F IGFFTPFIT AI FYYGY
Sbjct: 440 IFCFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWLWQFLIGFFTPFITSAIKFYYGY 499

Query: 489 VFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEAL- 547
           VF+GCLV  + YVF F+PET GL LE+V ++++EG+ PW+SA WVPPS+R    +   L 
Sbjct: 500 VFMGCLVAMFLYVFFFLPETSGLTLEEVQILYDEGIPPWRSADWVPPSRRFDGPSPVDLE 559

Query: 548 ATDDKPIYK 556
           A   KP YK
Sbjct: 560 AGAKKPWYK 568

>YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}
           HXT2High-affinity glucose transporter of the major
           facilitator superfamily, expression is induced by low
           levels of glucose and repressed by high levels of
           glucose
          Length = 541

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/536 (62%), Positives = 413/536 (77%), Gaps = 1/536 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFN-EIDSQIIEIPKKPASAYLSVCIMCL 62
           S+  T      S   S+HS+   Q+++ D      + +    E+P KP +AY +V  +CL
Sbjct: 2   SEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCL 61

Query: 63  MVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGS 122
           M+AFGGF+ GWDTGTI GF++ +D+  RFG   SDG+ YLS VRTGL+V IFN+GCA G 
Sbjct: 62  MIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGG 121

Query: 123 VVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPM 182
           + LGRLGD  GRR G++  V +YIVGIVIQIAS DKWYQYFIGRII+G+G G IAVLSP 
Sbjct: 122 LTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPT 181

Query: 183 LISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMI 242
           LISE +PKH+RGT VS YQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGL FA+A+ MI
Sbjct: 182 LISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMI 241

Query: 243 GAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS 302
             M +VPESPR+LVEKG+ E+AKRS+AKSNKVTI+DP+ + E++ +   VE E+ AG+AS
Sbjct: 242 AGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNAS 301

Query: 303 WSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVN 362
           W ELF  K  +L R +MG+++ +LQQLTG NYFFYYGT IF AVG++DSFQTS++ GIVN
Sbjct: 302 WGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVN 361

Query: 363 FASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMI 422
           FASTFVALY VDK+GRR CLL G+A M  C V+F++VGVT L+PNG+DQPSSK AGN MI
Sbjct: 362 FASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMI 421

Query: 423 VFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI 482
           VF+C FIF FA +WAPI +VI++ES+PLRVK + MA+   +N +W F IGFFTPFIT AI
Sbjct: 422 VFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAI 481

Query: 483 NFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
            F YGYVF+GCLVFS+ YVF FV ETKGL LE+VN M+ EGV PWKS SW+   +R
Sbjct: 482 GFSYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYVEGVKPWKSGSWISKEKR 537

>NCAS0J00170 Chr10 complement(17702..19309) [1608 bp, 535 aa] {ON} 
          Length = 535

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/512 (62%), Positives = 408/512 (79%)

Query: 45  EIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSK 104
           E+PKKP S Y+  CI+ L VAFGGFI+GWDTGTI G ++  D+I RFG   S+GS +LS 
Sbjct: 21  ELPKKPLSDYIVACILSLAVAFGGFITGWDTGTISGIVAQEDFIQRFGERRSNGSHHLSN 80

Query: 105 VRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFI 164
            RTG++VS+FN+GCA+G +VL R+GD  GR+KG+++ + IYIVG+++QI++   WYQYFI
Sbjct: 81  ARTGIIVSLFNIGCAVGGIVLSRVGDKFGRKKGLMVVIVIYIVGVIVQISTQKAWYQYFI 140

Query: 165 GRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNS 224
           GR+++GLG G IAVL PMLISEISPKHLRGT +S YQLMIT G+FLGYCTNYGTK Y+NS
Sbjct: 141 GRVVSGLGVGGIAVLCPMLISEISPKHLRGTCISFYQLMITAGIFLGYCTNYGTKDYNNS 200

Query: 225 IQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQE 284
           +QWRVPLGL FAWAL+MI  +F VPESPR+L E    E+AKRS+AK + V++ DP+   E
Sbjct: 201 VQWRVPLGLSFAWALIMIVILFFVPESPRFLCEINDPEKAKRSIAKIHNVSVKDPSVQTE 260

Query: 285 IELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFK 344
           ++L+   VE+E+ AGSASW EL  T+TKV QR +MG+++L LQQLTG NYFFYYGTI+F+
Sbjct: 261 VDLIMSGVESEKLAGSASWRELLSTRTKVRQRVIMGIMILMLQQLTGDNYFFYYGTIVFR 320

Query: 345 AVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKL 404
           +VGL DSFQTS++FG+VNF STF ALY VD  GRR  LLW  A M  C+++++SVGVT+L
Sbjct: 321 SVGLNDSFQTSIVFGVVNFFSTFFALYTVDNVGRRLMLLWAGAAMTACLIIYSSVGVTRL 380

Query: 405 WPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSN 464
           WP+G+   SSKGAGN MIVF+ F+IFC+A +WAPIP+V+++ES+P+RVK+K MA+   SN
Sbjct: 381 WPHGEGNGSSKGAGNCMIVFTSFYIFCYAMSWAPIPWVLVAESYPIRVKSKCMAVSAASN 440

Query: 465 QMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGV 524
            +W F I FFTPFIT +INFYYGYVF+GCLVFS+ YVF F+PETKGL LE++  +W+EGV
Sbjct: 441 WIWGFLISFFTPFITSSINFYYGYVFVGCLVFSWFYVFFFIPETKGLSLEEIQTLWDEGV 500

Query: 525 LPWKSASWVPPSQRGTDYNAEALATDDKPIYK 556
            PWKSA WV PS+R  DY+ E    D+ P YK
Sbjct: 501 APWKSAKWVRPSKRTYDYDLEKFQKDENPWYK 532

>KAFR0E04120 Chr5 (826520..828211) [1692 bp, 563 aa] {ON} Anc_5.396
           YHR096C
          Length = 563

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/531 (63%), Positives = 420/531 (79%), Gaps = 1/531 (0%)

Query: 30  KKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYIN 89
           +K SQ+  E  ++ I  P    + YL + I C MVAFGGFI GWDTGTI GF++ +D++ 
Sbjct: 30  EKASQEVFEPQTEEIAPPNTGKNVYLGISISCAMVAFGGFIFGWDTGTISGFVAQTDFVR 89

Query: 90  RFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVG 148
           RFG  +HS    YLS VRTGLLV IFN+GCAIG ++L RLGD  GR+ G++    IY++G
Sbjct: 90  RFGQRTHSGHEPYLSNVRTGLLVGIFNIGCAIGGILLSRLGDMYGRKIGLISVTVIYVIG 149

Query: 149 IVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGM 208
           I+IQIASIDKWYQYFIGRII+GLG G I VLSPMLISE++PK +RGTLVS +QLMIT G+
Sbjct: 150 IIIQIASIDKWYQYFIGRIISGLGVGGITVLSPMLISEVAPKEMRGTLVSSFQLMITLGI 209

Query: 209 FLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSV 268
           FLGYCTNYGTK+Y +S QWRVPLGLCFAWA+ M+  M  VPESPRYLVE G+IEEA++++
Sbjct: 210 FLGYCTNYGTKSYSDSTQWRVPLGLCFAWAIFMVIGMTFVPESPRYLVEAGKIEEARQNL 269

Query: 269 AKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQ 328
           AK+NK   D P    E++L++ +VE  +AAGSASW EL   K  +L+RT +G+++ +LQQ
Sbjct: 270 AKANKCPADHPFITHELDLIEASVEEARAAGSASWGELVTGKPAMLKRTTLGIMIQSLQQ 329

Query: 329 LTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAG 388
           LTG NYFFYYGT IF AVG+ DSF+T+++ GIVNF ST V+LY VDK GRR C+L+G  G
Sbjct: 330 LTGDNYFFYYGTTIFAAVGMNDSFETAIVLGIVNFVSTCVSLYTVDKLGRRNCMLYGCLG 389

Query: 389 MVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESF 448
           M+ C  V+ASVGVT+LWPNG+   SSKGAGN MIVF+CF+IFCFATTWAPI +VI+SE+F
Sbjct: 390 MIACYCVYASVGVTRLWPNGKGNGSSKGAGNCMIVFACFYIFCFATTWAPIAYVIVSETF 449

Query: 449 PLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPET 508
           PLRVK+K MA+ T +N MW F I FFTPFITGAINFYYGYVF+GC+ F+Y YVF FVPET
Sbjct: 450 PLRVKSKAMAVSTAANWMWGFLISFFTPFITGAINFYYGYVFMGCMCFAYFYVFFFVPET 509

Query: 509 KGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMF 559
           KGL LE+V+ M+ EGVLPWKSA+WVPPS+RG DYNA+ L  D+ P YK +F
Sbjct: 510 KGLTLEEVDDMYAEGVLPWKSANWVPPSRRGADYNADDLMHDETPFYKAIF 560

>Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W
           (REAL)
          Length = 546

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/509 (64%), Positives = 405/509 (79%)

Query: 30  KKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYIN 89
           K + Q   E+    ++IP KP  AY +V  +CLM+AFGGFI GWDTGTI GF++ +D+  
Sbjct: 22  KDEVQLTPEVKEASLDIPYKPIIAYWTVMGLCLMIAFGGFIFGWDTGTISGFINQTDFKR 81

Query: 90  RFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGI 149
           RFG    DGS  LS VRTGL+V IFN+GCA+G + LGRLGD  GRR G++  + +Y+VGI
Sbjct: 82  RFGEVQRDGSFQLSDVRTGLIVGIFNIGCAVGGLTLGRLGDIYGRRIGLMWVILVYVVGI 141

Query: 150 VIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMF 209
           VIQIAS DKWYQYFIGRI++G+G G +AVLSP LISEISPKHLRGT VS YQLMIT G+F
Sbjct: 142 VIQIASTDKWYQYFIGRIVSGMGVGGVAVLSPTLISEISPKHLRGTCVSFYQLMITLGIF 201

Query: 210 LGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVA 269
           LGYCTNYGTK Y NSIQWRVPLGLCFAWA+ M+  M +VPESPRYLV+KG+ EEA+RS+A
Sbjct: 202 LGYCTNYGTKKYSNSIQWRVPLGLCFAWAVFMVVGMVMVPESPRYLVKKGRFEEARRSLA 261

Query: 270 KSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQL 329
           +SNKV + D   I E++ +   +E E+A G+ASWSELF  K  +L R +MGV++ +LQQL
Sbjct: 262 RSNKVAVTDLGVISEVDAIVANMELERAVGNASWSELFSNKGAILPRVIMGVVIQSLQQL 321

Query: 330 TGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGM 389
           TGCNYFFYYGT IF AVG+EDSF+TS++ G+VNFASTFVALY+VDK+GRR CLL G+A M
Sbjct: 322 TGCNYFFYYGTTIFNAVGMEDSFETSIVLGVVNFASTFVALYIVDKFGRRKCLLCGSASM 381

Query: 390 VCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFP 449
             C V+FA++GVT+LWP+G+D PSS+ AGN MIVF+CFFIFCFA TWAPI +VI++E++P
Sbjct: 382 AVCFVIFATIGVTRLWPHGKDYPSSQNAGNVMIVFTCFFIFCFAITWAPIAYVIVAETYP 441

Query: 450 LRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETK 509
           LRVK + MA+   +N MW F IGFFTPFIT AI F YGYVF+GCL+FSY YVF FV ETK
Sbjct: 442 LRVKNRAMAIAVGANWMWGFLIGFFTPFITRAIGFSYGYVFMGCLIFSYFYVFFFVCETK 501

Query: 510 GLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           GL LE+VN M+EE + PWKS  W+P S+R
Sbjct: 502 GLTLEEVNEMYEERIKPWKSGDWIPSSRR 530

>Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094C
           (REAL)
          Length = 547

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/533 (62%), Positives = 414/533 (77%), Gaps = 5/533 (0%)

Query: 19  SVHSSQSFQEMKKDS---QDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDT 75
           S++S+   ++++ D    Q  +E  S   EIP KP +AY +V  +CLM+AFGGF+ GWDT
Sbjct: 17  SINSTPVVKKLETDESPIQAKSEYTSA--EIPAKPITAYWTVICLCLMIAFGGFVFGWDT 74

Query: 76  GTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRR 135
           GTI GF++ SD+  RFG   SDG+ YLS VRTGL+V IFN+GCAIG + LGRLGD  GRR
Sbjct: 75  GTISGFVNQSDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAIGGLTLGRLGDIYGRR 134

Query: 136 KGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGT 195
            G++  V +YIVGIVIQIAS +KWYQYFIGRII+G+G G IAVLSP LISE +PKH+RGT
Sbjct: 135 IGLMCVVLVYIVGIVIQIASSNKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGT 194

Query: 196 LVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYL 255
            VS YQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGL FA+A+ MI  M +VPESPR+L
Sbjct: 195 CVSFYQLMITLGIFLGYCTNYGTKDYTNSVQWRVPLGLGFAFAIFMIAGMLMVPESPRFL 254

Query: 256 VEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQ 315
           VEKG+ E+AKRS+AKSNKVT+DDP+ + E++ +   VE E+ AG+ASW ELF  K  +L 
Sbjct: 255 VEKGRYEDAKRSLAKSNKVTVDDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILP 314

Query: 316 RTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDK 375
           R +MG+++ +LQQLTG NYFFYYGT IF AVG++DSFQTS++ GIVNFASTFVALY VDK
Sbjct: 315 RVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDK 374

Query: 376 YGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATT 435
           +GRR CLL G+A M  C V+F+SVGVT L+P+G+DQPSSK AGN MIVF+C FIF FA +
Sbjct: 375 FGRRKCLLGGSAAMAICFVIFSSVGVTSLYPDGKDQPSSKAAGNVMIVFTCLFIFFFAIS 434

Query: 436 WAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLV 495
           WAPI +VI++ES+PLRVK + MA+   +N +W F IGFFTPFIT AI F YGYVF+GCLV
Sbjct: 435 WAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLV 494

Query: 496 FSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALA 548
           FS+ YVF FV ETKGL LE+VN M+ EGV PWKS +W+    R  +   E  A
Sbjct: 495 FSFFYVFFFVCETKGLTLEEVNEMYVEGVKPWKSGNWIAKENRVYEEELETEA 547

>Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345C
           (REAL)
          Length = 541

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/536 (61%), Positives = 415/536 (77%), Gaps = 1/536 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFN-EIDSQIIEIPKKPASAYLSVCIMCL 62
           S+   G     S   SVHS+   Q+++ D      + +    E+P KP SAY +V  +CL
Sbjct: 2   SEFAAGRIESGSQQTSVHSTPVVQKLETDESPIQTKSEYTNAELPAKPISAYWTVICLCL 61

Query: 63  MVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGS 122
           M+AFGGF+ GWDTGTI GF++ +D+  RFG   SDG+ YLS VRTGL+V IFN+GCAIG 
Sbjct: 62  MIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAIGG 121

Query: 123 VVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPM 182
           + LGRLGD  GRR G++  V +YIVGIVIQIAS DKWYQYFIGRI++G+G G IAVLSP 
Sbjct: 122 LTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIVSGMGVGGIAVLSPT 181

Query: 183 LISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMI 242
           LISE +PKH+RGT VS YQLMIT G+FLGYCTNYGTK Y NS+QWRVPLGL FA+A+ MI
Sbjct: 182 LISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMI 241

Query: 243 GAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS 302
             M +VPESPR+LVEKG+ E+AKRS+AKSNKVT++DP+ + E++ +   VE E+ AG+A+
Sbjct: 242 AGMLMVPESPRFLVEKGKYEDAKRSLAKSNKVTVEDPSILAEMDTILANVEIERLAGNAT 301

Query: 303 WSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVN 362
           W ELF +K  +L R +MG+++ +LQQLTG NYFFYYGT IF AVG++DSFQTS++ GIVN
Sbjct: 302 WGELFSSKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVN 361

Query: 363 FASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMI 422
           FASTFVALY VDK+GRR CLL G+A M  C V+F++VGVT L+P+G+DQPSSK AGN MI
Sbjct: 362 FASTFVALYTVDKFGRRKCLLGGSATMAICFVIFSTVGVTSLYPHGKDQPSSKAAGNVMI 421

Query: 423 VFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAI 482
           VF+C FIF FA +WAPI +VI++ES+PLRVK + MA+   +N +W F IGFFTPFIT AI
Sbjct: 422 VFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAI 481

Query: 483 NFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
            F YGYVF+GCLVFS+ YVF FV ETKGL LE+VN M+ EG+ PWKS +W+   +R
Sbjct: 482 GFSYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYVEGIKPWKSGNWISKEKR 537

>TPHA0H03110 Chr8 (742931..744616) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/558 (60%), Positives = 433/558 (77%), Gaps = 4/558 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIP---KKPASAYLSVCIM 60
           S+  T   V +S+ G+V +  S   +  +  + +++D +  E P     P S Y  V  +
Sbjct: 2   SEPVTDLQVTASSEGNVEAVSSNNSIASNKVEGDDMDLKAPEDPIHATGPLSQYFGVLSL 61

Query: 61  CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAI 120
           CLM+AFGGFI GWDTGTIGGF+SH D++ RFGS HSDG+ Y SKVRTGL+V IFNVGCAI
Sbjct: 62  CLMIAFGGFIFGWDTGTIGGFVSHEDFLRRFGSRHSDGTYYFSKVRTGLVVGIFNVGCAI 121

Query: 121 GSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLS 180
           G + LGR GD  GR+ G++I V +Y++GI+I IASIDKWYQYFIGRII+GLG G IAVLS
Sbjct: 122 GGLTLGRTGDMYGRKPGLMIVVVVYVIGIIISIASIDKWYQYFIGRIISGLGVGGIAVLS 181

Query: 181 PMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKT-YDNSIQWRVPLGLCFAWAL 239
           P LI+E +P HLRGT V+ YQL+IT G+FLGYCTNYGT   Y +S QWRVPLGL FAWAL
Sbjct: 182 PTLIAETAPAHLRGTAVAFYQLLITGGIFLGYCTNYGTHHGYKDSTQWRVPLGLSFAWAL 241

Query: 240 VMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAG 299
            MIG M +VPES R+LV+KG++EEAK S++K+NK T+D P  ++E + +  AVEAE+AAG
Sbjct: 242 FMIGGMLLVPESARFLVQKGRLEEAKVSLSKTNKATVDSPIVVREFDEIFAAVEAERAAG 301

Query: 300 SASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFG 359
           +ASW E+F  K  +L+RT+MGV++ +LQQLTG NYFFYYG+ +F +VGL+D ++ S++ G
Sbjct: 302 NASWGEIFSRKGAILKRTIMGVMIQSLQQLTGNNYFFYYGSTLFNSVGLDDGYEASIVIG 361

Query: 360 IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGN 419
           IVNFASTFVAL+ V+++GRR CLL GAA M  C V++ASVGVT+L+ +G D P+SKGAGN
Sbjct: 362 IVNFASTFVALWTVERFGRRNCLLVGAATMAACFVIYASVGVTRLYIDGYDGPTSKGAGN 421

Query: 420 TMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFIT 479
            MIVF+CF+IFCFATTWAP+ +VI+SE++PLR++ + M L   +N MW F I FFTPFIT
Sbjct: 422 CMIVFTCFYIFCFATTWAPLAYVIVSETYPLRIRGRAMGLSIGANWMWGFLISFFTPFIT 481

Query: 480 GAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRG 539
           GAI+F YGYVF GCL+F + YVF FV ETKGL LE+V+ M+ EGVLPWKS SWVPPSQRG
Sbjct: 482 GAIHFAYGYVFFGCLIFMFFYVFFFVCETKGLTLEEVDEMYLEGVLPWKSTSWVPPSQRG 541

Query: 540 TDYNAEALATDDKPIYKR 557
            DY+A A A DD+P Y+R
Sbjct: 542 VDYDASAAAHDDRPWYQR 559

>KNAG0D05370 Chr4 (984855..986225) [1371 bp, 456 aa] {ON} 
          Length = 456

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/455 (70%), Positives = 388/455 (85%), Gaps = 1/455 (0%)

Query: 108 GLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRI 167
           GL+V+IFN+GCAIG +   RLGD  GRR  +V    +Y++G++I IASI+KWYQYFIGRI
Sbjct: 2   GLIVAIFNIGCAIGGLAWSRLGDIYGRRLALVWVTTVYMIGLIISIASINKWYQYFIGRI 61

Query: 168 IAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKT-YDNSIQ 226
           I+G G G IAV SP+LISE+SPKH+RGTLVSCYQLM+T G+FLGYCTNYGT+  Y NS Q
Sbjct: 62  ISGCGVGGIAVYSPLLISEVSPKHVRGTLVSCYQLMVTLGIFLGYCTNYGTEHGYSNSTQ 121

Query: 227 WRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIE 286
           WRVPLGL FAWAL MI AMF VPESPR+L+E G++EEAK S+A+SNK++ DDP+ I E+E
Sbjct: 122 WRVPLGLGFAWALFMIAAMFFVPESPRFLIEVGKMEEAKISMARSNKLSADDPSVIAEVE 181

Query: 287 LVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAV 346
            +   +EAE+ AGSASW ELF TK K+LQRT++GV++ +LQQLTG NYFF+YGT IF+AV
Sbjct: 182 YLAAGIEAEREAGSASWMELFSTKGKILQRTILGVMIQSLQQLTGANYFFFYGTQIFQAV 241

Query: 347 GLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWP 406
           GL DS++T+++ GIVNFASTF ++Y V+++GRRT LLWGAAGM+CC VVFASVGVT+L+P
Sbjct: 242 GLPDSYETAIVIGIVNFASTFPSIYFVERFGRRTGLLWGAAGMICCFVVFASVGVTRLYP 301

Query: 407 NGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQM 466
           NG+DQPSSKGAGN MI F+CFFIFCFATTWAP  +VI+SESFPLRVKAKGMAL   +N +
Sbjct: 302 NGRDQPSSKGAGNCMICFTCFFIFCFATTWAPTAYVIVSESFPLRVKAKGMALSIAANWI 361

Query: 467 WNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLP 526
           WNF +GFFTPFITGAINFYYGYVF+GCL FS+ YVF FVPETKGL LE+VN+MWEE VLP
Sbjct: 362 WNFLLGFFTPFITGAINFYYGYVFMGCLCFSWVYVFFFVPETKGLSLEEVNIMWEESVLP 421

Query: 527 WKSASWVPPSQRGTDYNAEALATDDKPIYKRMFSK 561
           WKSASWVPPS+RG DYNA+A+A DD+P YKRM  K
Sbjct: 422 WKSASWVPPSRRGADYNADAMAHDDQPFYKRMLGK 456

>YFL011W Chr6 (112345..113985) [1641 bp, 546 aa] {ON}  HXT10Putative
           hexose transporter, expressed at low levels and
           expression is repressed by glucose
          Length = 546

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/524 (62%), Positives = 408/524 (77%)

Query: 15  STAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWD 74
           S  G+   + +    K + +   E     ++IP KP  AY +V  +CLM+AFGGFI GWD
Sbjct: 7   SILGTSAKASTSLSRKDEIKLTPETREASLDIPYKPIIAYWTVMGLCLMIAFGGFIFGWD 66

Query: 75  TGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGR 134
           TGTI GF++ +D+  RFG    DGS  LS VRTGL+V IFN+GCA+G + LGRLGD  GR
Sbjct: 67  TGTISGFINQTDFKRRFGELQRDGSFQLSDVRTGLIVGIFNIGCALGGLTLGRLGDIYGR 126

Query: 135 RKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRG 194
           + G++  + +Y+VGIVIQIAS DKWYQYFIGRI++G+G G +AVLSP LISEISPKHLRG
Sbjct: 127 KIGLMCVILVYVVGIVIQIASSDKWYQYFIGRIVSGMGVGGVAVLSPTLISEISPKHLRG 186

Query: 195 TLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRY 254
           T VS YQLMIT G+FLGYCTNYGTK Y NSIQWRVPLGLCFAWA+ M+  M +VPESPRY
Sbjct: 187 TCVSFYQLMITLGIFLGYCTNYGTKKYSNSIQWRVPLGLCFAWAIFMVIGMVMVPESPRY 246

Query: 255 LVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVL 314
           LVEKG+ EEA+RS+AKSNKVT+ DP  + E + +   +E E+A G+ASW ELF  K  +L
Sbjct: 247 LVEKGKYEEARRSLAKSNKVTVTDPGVVFEFDTIVANMELERAVGNASWHELFSNKGAIL 306

Query: 315 QRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVD 374
            R +MG+++ +LQQLTGCNYFFYYGT IF AVG++DSF+TS++ G VNFASTFVALY+VD
Sbjct: 307 PRVIMGIVIQSLQQLTGCNYFFYYGTTIFNAVGMQDSFETSIVLGAVNFASTFVALYIVD 366

Query: 375 KYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFAT 434
           K+GRR CLLWG+A M  C V+FA+VGVT+LWP G+DQPSS+ AGN MIVF+CFFIF FA 
Sbjct: 367 KFGRRKCLLWGSASMAICFVIFATVGVTRLWPQGKDQPSSQSAGNVMIVFTCFFIFSFAI 426

Query: 435 TWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCL 494
           TWAPI +VI++E++PLRVK + MA+   +N MW F IGFFTPFIT +I F YGYVF+GCL
Sbjct: 427 TWAPIAYVIVAETYPLRVKNRAMAIAVGANWMWGFLIGFFTPFITRSIGFSYGYVFMGCL 486

Query: 495 VFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           +FSY YVF FV ETKGL LE+VN M+EE + PWKS  W+P S+R
Sbjct: 487 IFSYFYVFFFVCETKGLTLEEVNEMYEERIKPWKSGGWIPSSRR 530

>Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 159] FULL
          Length = 567

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/540 (57%), Positives = 406/540 (75%), Gaps = 6/540 (1%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQII---EIPKKPASAYLSVCIM 60
           S S T     +  A SV  S +    KK   D    D Q+    E+PKKPASAY++V ++
Sbjct: 8   SNSATAAQTPTQGASSVVDSHTATVPKKFYMDEGN-DGQMADMAELPKKPASAYVTVSLL 66

Query: 61  CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCA 119
           C++V+FGGF+ GWDTG + GF++  D+  RFG+   S    YLS VRTGLLV+IF+ GCA
Sbjct: 67  CVLVSFGGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLSNVRTGLLVAIFSAGCA 126

Query: 120 IGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVL 179
           +G + L +LGD  GRR  ++  V +Y+VG +IQI++ DKWYQYFIG+II G G G ++VL
Sbjct: 127 LGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSVL 186

Query: 180 SPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWAL 239
           +PMLISE +PKHLRGTL+SCYQLM+TFG+FLGYC  Y T+ YD S QWR+PLGL F WAL
Sbjct: 187 APMLISETAPKHLRGTLISCYQLMVTFGIFLGYCVVYATRKYDGSEQWRIPLGLSFLWAL 246

Query: 240 VMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAG 299
           +++  M  VPESPR+LVE G+IEEA+RS+A SNK  ++DPA   EI+L+  +VEAE+A G
Sbjct: 247 IIVAGMVFVPESPRFLVEVGRIEEARRSIASSNKTPVEDPAIQAEIDLIAASVEAEKAQG 306

Query: 300 SASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFG 359
            A W+ELF TKTKV QR + G+++ +  QLTG NYFFYYGT IFK++GL DSFQTS++ G
Sbjct: 307 KARWAELFSTKTKVFQRLITGILMQSFLQLTGENYFFYYGTTIFKSIGLTDSFQTSIVLG 366

Query: 360 IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQD-QPSSKGAG 418
            VNF S+F+++Y VD +GRR CLLWGAA M  CMV+FASVGVT LWP+G++   +SK AG
Sbjct: 367 TVNFFSSFLSMYTVDAFGRRKCLLWGAAAMTVCMVIFASVGVTSLWPHGENVGEASKPAG 426

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MIVF+C FI  FATTWAPI +V+++ESFPLRVK+K M++ T  N +W F IGFFTPFI
Sbjct: 427 NVMIVFTCLFICFFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWLWQFLIGFFTPFI 486

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           T AI FYYGYVF+GCLV  + YVF F+PET GL LE+V +++EEG+  W+SA+WVPP++R
Sbjct: 487 TNAIKFYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYEEGIPAWRSANWVPPTRR 546

>Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 187] FULL
          Length = 567

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/540 (57%), Positives = 405/540 (75%), Gaps = 6/540 (1%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQII---EIPKKPASAYLSVCIM 60
           S S T     +  A SV  S +    KK   D    D Q+    E+PKKPASAY++V ++
Sbjct: 8   SNSATAAQTPTQGASSVVDSHTATVPKKFYMDEGN-DGQMADMAELPKKPASAYVTVSLL 66

Query: 61  CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCA 119
           C++V+FGGF+ GWDTG + GF++  D+  RFG+   S    YLS VRTGLLV+IF+ GCA
Sbjct: 67  CVLVSFGGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLSNVRTGLLVAIFSAGCA 126

Query: 120 IGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVL 179
           +G + L +LGD  GRR  ++  V +Y+VG +IQI++ DKWYQYFIG+II G G G ++VL
Sbjct: 127 LGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSVL 186

Query: 180 SPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWAL 239
           +PMLIS  +PKH+RGTL+SCYQLM+TFG+FLGYC  Y T+ YD S QWR+PLGL F WAL
Sbjct: 187 APMLISLTAPKHVRGTLISCYQLMVTFGIFLGYCVVYATRKYDGSEQWRIPLGLSFLWAL 246

Query: 240 VMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAG 299
           +++  M  VPESPR+LVE G+IEEA+RS+A SNK  ++DPA   EI+L+  +VEAE+A G
Sbjct: 247 IIVAGMVFVPESPRFLVEVGRIEEARRSIASSNKTPVEDPAIQAEIDLIAASVEAEKAQG 306

Query: 300 SASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFG 359
            A W+ELF TKTKV QR + G+++ +  QLTG NYFFYYGT IFK++GL DSFQTS++ G
Sbjct: 307 KARWAELFSTKTKVFQRLITGILMQSFLQLTGENYFFYYGTTIFKSIGLTDSFQTSIVLG 366

Query: 360 IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQD-QPSSKGAG 418
            VNF S+F+++Y VD +GRR CLLWGAA M  CMV+FASVGVT LWP+G++   +SK AG
Sbjct: 367 TVNFFSSFLSMYTVDAFGRRKCLLWGAAAMTVCMVIFASVGVTSLWPHGENVGEASKPAG 426

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MIVF+C FI  FATTWAPI +V+++ESFPLRVK+K M++ T  N +W F IGFFTPFI
Sbjct: 427 NVMIVFTCLFICFFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWLWQFLIGFFTPFI 486

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           T AI FYYGYVF+GCLV  + YVF F+PET GL LE+V +++EEG+  W+SA+WVPP++R
Sbjct: 487 TNAIKFYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYEEGIPAWRSANWVPPTRR 546

>NCAS0A08630 Chr1 complement(1704322..1706103) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/497 (62%), Positives = 394/497 (79%)

Query: 49  KPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTG 108
           KPA++Y +V I+CL++AFGGFI GWDTGTI GF++ +D+I RFG+  SDGS  LS VR G
Sbjct: 35  KPAASYFTVIILCLLIAFGGFIFGWDTGTISGFVAQTDFIKRFGTQQSDGSFALSDVRKG 94

Query: 109 LLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRII 168
           L+V IFN+GC +G + L   GD  GR+ G+++   +Y+VGI+IQI S  KWYQYF+GRI+
Sbjct: 95  LMVGIFNIGCLLGGLFLAGAGDKWGRKPGLMLVAAVYVVGIIIQITSSTKWYQYFVGRIV 154

Query: 169 AGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWR 228
           +G+G G IAVLSP LISEI+PK LRGT +S YQLMIT G+FLGYC N+GTK Y+N++QWR
Sbjct: 155 SGMGVGGIAVLSPTLISEIAPKQLRGTCISLYQLMITGGIFLGYCANFGTKRYNNAVQWR 214

Query: 229 VPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELV 288
           +PLGL FAWA  MI  +  VPESPRYL +KG+I  AK S+AKSNK T+DD   + E++ +
Sbjct: 215 LPLGLGFAWAFFMIIGLLFVPESPRYLFKKGKISAAKHSLAKSNKTTVDDILVLSELDNI 274

Query: 289 QIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGL 348
           +  +EAE  AG+ASW ELF  K K+ QR  MGV++ +LQQLTGCNYFFYYGT IF+AVG+
Sbjct: 275 RAGIEAENNAGNASWKELFSLKNKIFQRVFMGVMIQSLQQLTGCNYFFYYGTTIFQAVGM 334

Query: 349 EDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNG 408
           +DSF TS++ G+VNFASTF+AL +V+  GRR CLL G+A M CC V+FASVGVT+LWPNG
Sbjct: 335 DDSFVTSIVLGVVNFASTFIALGIVEWLGRRKCLLLGSASMACCFVIFASVGVTRLWPNG 394

Query: 409 QDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWN 468
           +DQP+SKGAG+ MIVF+C FIFCFATTWAPI FVI++ES+PLRVK + MA+   +N +W 
Sbjct: 395 KDQPTSKGAGDCMIVFTCIFIFCFATTWAPIGFVIVAESYPLRVKQRAMAIAIGANWIWG 454

Query: 469 FCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWK 528
           F IGFFTPFIT AINFYYG+VF+GCL+FS+ YVF FV ETKGL LE+V+ M+ E + PWK
Sbjct: 455 FLIGFFTPFITSAINFYYGFVFMGCLIFSFFYVFFFVRETKGLTLEEVDEMYLENIKPWK 514

Query: 529 SASWVPPSQRGTDYNAE 545
           SASW P ++R   Y+ +
Sbjct: 515 SASWSPRNRRDGAYDND 531

>TPHA0N01930 Chr14 (410871..412556) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/558 (58%), Positives = 416/558 (74%), Gaps = 4/558 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDS-QDFNEIDSQIIEIPKK--PASAYLSVCIM 60
           SQ    E+V++  A    S+      +K+S +D +  +    + P +  P S YL V  +
Sbjct: 2   SQEDINENVNAEAANLASSASQSIASQKESPEDMDLKNENYADTPHEVGPLSQYLGVLSL 61

Query: 61  CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAI 120
           CLM+AFGGFI GWDTGTI GF+S  D++ RFGS H DG+ Y SKVRTGL+V IFNVGCAI
Sbjct: 62  CLMIAFGGFIFGWDTGTISGFVSQDDFLRRFGSKHHDGTYYFSKVRTGLVVGIFNVGCAI 121

Query: 121 GSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLS 180
           G + LGR GD  GR+ G++I V +Y +GI+I IASI+KWYQYFIGRII+GLG G IAVLS
Sbjct: 122 GGLTLGRTGDMYGRKPGLMIVVVVYTIGIIISIASINKWYQYFIGRIISGLGVGGIAVLS 181

Query: 181 PMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKT-YDNSIQWRVPLGLCFAWAL 239
           P LI+E +P HLRGT V+ YQLMIT G+FLGYCTNYGT   Y +S QWRVPLGL FAWAL
Sbjct: 182 PTLIAETAPAHLRGTAVAFYQLMITLGIFLGYCTNYGTHHHYKDSTQWRVPLGLSFAWAL 241

Query: 240 VMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAG 299
            MIG M  VPES RYLV++G++EEAK S++K+NK  ID P  + E + +   VEAE+AAG
Sbjct: 242 FMIGGMLFVPESARYLVQQGRLEEAKVSLSKTNKAPIDSPIVVTEFDEISAGVEAERAAG 301

Query: 300 SASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFG 359
           SA+W ELF     VLQR +MG+++ +LQQLTG NYFFYYGT IF +VGL D F+ +++ G
Sbjct: 302 SATWGELFSRNGAVLQRVIMGIMLQSLQQLTGNNYFFYYGTTIFNSVGLNDGFEAAIVIG 361

Query: 360 IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGN 419
           IVNFAST  +L+ V+ +GRRTCLL GA  M CC +++ASVGVT+L+ +G D P+SKGAGN
Sbjct: 362 IVNFASTSFSLWTVNHFGRRTCLLVGAFTMACCFLIYASVGVTRLYLDGYDGPTSKGAGN 421

Query: 420 TMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFIT 479
            +IVF+ FFIFCFA +WAP+ +VI+SE+FPLR++ + M L   +N +W F I FFTPFIT
Sbjct: 422 CLIVFTMFFIFCFANSWAPLAYVIVSETFPLRIRGRAMGLSIGANWIWGFLISFFTPFIT 481

Query: 480 GAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRG 539
           GAI+F YGYVF GCL+F++ YVF FV ET GL LE+V+ M+ EG LPWKS SWVPPSQRG
Sbjct: 482 GAIHFAYGYVFFGCLLFAFFYVFFFVCETSGLTLEEVDEMYIEGTLPWKSTSWVPPSQRG 541

Query: 540 TDYNAEALATDDKPIYKR 557
            DY+ +A   DD+P YKR
Sbjct: 542 ADYDVDAAGHDDRPWYKR 559

>NDAI0B03060 Chr2 complement(775021..776817) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/530 (61%), Positives = 415/530 (78%), Gaps = 4/530 (0%)

Query: 32  DSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRF 91
           D +D + I  +I ++P+KP   Y+   ++CL VAFGGF++GWDTGTI GF+  +D+I RF
Sbjct: 71  DDEDRDRI-PRINQLPRKPLKEYVVANLLCLCVAFGGFMTGWDTGTISGFVVQTDFIRRF 129

Query: 92  GSSHSDGSKY-LSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIV 150
           G   +  + Y LS+VR GLLVSI N+GCAIG +VL + GD  GRRKG+ I   +Y+VGI+
Sbjct: 130 GHLDTAVNTYVLSRVRLGLLVSIVNIGCAIGGIVLSKAGDVYGRRKGLTIVTMVYMVGII 189

Query: 151 IQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFL 210
           IQI++++KWYQYFIGRIIAG G G IAV  P+LISEISPK+ RGT VS YQLMIT G+F+
Sbjct: 190 IQISAVNKWYQYFIGRIIAGFGIGGIAVFCPILISEISPKYYRGTCVSFYQLMITAGIFV 249

Query: 211 GYCTNYGTKTYDNSIQWRVPLGLCFAWALV-MIGAMFIVPESPRYLVEKGQIEEAKRSVA 269
           GYCTN+GTK Y NS+QWRVPLGL FAW+L  MI  + +VPESPRYL E  Q+++AK S+A
Sbjct: 250 GYCTNFGTKKYTNSVQWRVPLGLSFAWSLFYMILVLTVVPESPRYLCENNQVQKAKESIA 309

Query: 270 KSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQL 329
           +SN+V+ DDPA   E++ + ++VE+E+ AG+A+W ELF  ++ V QR +MG+++  LQQL
Sbjct: 310 RSNRVSPDDPAVQTEMDFIMVSVESEKLAGNAAWGELFSKRSTVFQRVIMGIMIQMLQQL 369

Query: 330 TGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGM 389
           TG NYFFYYGTIIFK+VGLEDSFQTS+I G+VNFASTFVALY VD+ GRR+ LLWG   M
Sbjct: 370 TGNNYFFYYGTIIFKSVGLEDSFQTSIIIGVVNFASTFVALYTVDRIGRRSMLLWGCLTM 429

Query: 390 VCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFP 449
           + CMV+++SVGVT+L+PN    P SKGAG  MI F+CF+IFC+A +WAPI +VI+SESFP
Sbjct: 430 ISCMVIYSSVGVTRLYPNSATSP-SKGAGACMICFTCFYIFCYAISWAPIAWVIVSESFP 488

Query: 450 LRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETK 509
           LRV++K MAL   SN +W F I FFTPFITGAINFYYGYVF GC+VFS+ YVF F+PETK
Sbjct: 489 LRVRSKCMALACASNWIWGFLISFFTPFITGAINFYYGYVFTGCIVFSFFYVFFFIPETK 548

Query: 510 GLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMF 559
           GL LE++  +WEE VLPWKS +W+PPS+R  DY+ EALA  D P YK  F
Sbjct: 549 GLSLEEIQELWEERVLPWKSTAWIPPSKRTVDYDIEALAIHDGPWYKAFF 598

>Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON}
           YEL069C (REAL)
          Length = 567

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/566 (55%), Positives = 414/566 (73%), Gaps = 7/566 (1%)

Query: 1   MDYSQSPTGED--VHSSTAGSVHSSQSFQEMKKDSQDFNEI-DSQIIEIPKKPASAYLSV 57
           M   QS  G D  + +++   VH +   ++   D  D NE+ +   IE PK+    YL +
Sbjct: 1   MSTVQSSVGSDTDIQNASNADVHIAPRVEKEWSDEFDDNEVLNGDTIEPPKRGLLGYLVI 60

Query: 58  CIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNV 116
            ++C  ++FGGF+ GWD+G   GF++  ++   FGS  HS G  YLS VR GLLV++F+V
Sbjct: 61  YLLCYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSV 120

Query: 117 GCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTI 176
           GCAIG V   R  D +GRR  IVI V +Y+VG +IQI+S  KWYQYF+G+II GLG+G  
Sbjct: 121 GCAIGGVSFARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGC 180

Query: 177 AVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFA 236
           +VL PML+SEI+PK LRG L+S YQL +TFG+FLGYC+ YGT+ YDN+ QWRVPLGLCF 
Sbjct: 181 SVLCPMLLSEIAPKDLRGGLISLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFL 240

Query: 237 WALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQ 296
           WAL++I  M +VPESPRYL+E  + E+A  S+AK NKV+ +DP   +++E + + V A++
Sbjct: 241 WALIIIIGMLLVPESPRYLIECERHEDACISIAKINKVSPEDPWVQRQVEEINVGVLAQK 300

Query: 297 AAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSL 356
             G ASW ELF  KTKVLQR + G++V    QLTG NYFF+YGT IFK+VGL D F+TS+
Sbjct: 301 ELGEASWKELFSIKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSI 360

Query: 357 IFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKG 416
           + G VNF ST +A+ VVDK GRR CLL+GAAGM+ CMV+FAS+GV  L+P+GQD PSSKG
Sbjct: 361 VLGTVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKG 420

Query: 417 AGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTP 476
           AGN MIVF+CF+IFCFATTWAP+ +++++ESFP +VK++ M++ T  N +W F IGFFTP
Sbjct: 421 AGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTAFNWLWQFLIGFFTP 480

Query: 477 FITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPS 536
           FITG+I+FYYGYVF+GCLV  + Y+F F+PET GL LE++ L++EEGV PWKS SWVPPS
Sbjct: 481 FITGSIHFYYGYVFVGCLVAMFLYIFFFLPETIGLSLEEIQLLYEEGVKPWKSTSWVPPS 540

Query: 537 QRGTDYNAEALATDDKPIYKRM-FSK 561
           +RG   ++E   T DK   K + FSK
Sbjct: 541 RRGV--HSEETETQDKDWKKFLKFSK 564

>Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072W
           (REAL)
          Length = 564

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/563 (55%), Positives = 416/563 (73%), Gaps = 7/563 (1%)

Query: 5   QSPTGED--VHSSTAGSVHSSQSFQEMKKDSQDFNEI-DSQIIEIPKKPASAYLSVCIMC 61
           Q+  G D  + +++A  VH +   ++   D  D NE+     +E PK+    YL++ ++C
Sbjct: 2   QASIGADTEIQNASAVDVHDAPPVEKEWSDGFDDNEVLKGDTVEAPKRGLLGYLTIYLLC 61

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAI 120
             V+FGGF+ GWD+G   GF++  ++   FGS  HS G  YLS VR GLLV++F+VGCAI
Sbjct: 62  YPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAI 121

Query: 121 GSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLS 180
           G ++  R  D +GRR  IVI V +Y+VG +IQI+S  KWYQYF+G+II GLG+G  +VL 
Sbjct: 122 GGLIFARFADKLGRRLAIVIVVLVYMVGAIIQISSSHKWYQYFVGKIIYGLGAGGCSVLC 181

Query: 181 PMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALV 240
           PML+SEI+PK LRG L+S YQL +TFG+FLGYC+ YGT+ YD++ QWRVPLGLCF WAL+
Sbjct: 182 PMLLSEIAPKDLRGGLISLYQLNMTFGIFLGYCSVYGTRKYDDTAQWRVPLGLCFLWALI 241

Query: 241 MIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGS 300
           +I  M +VPESPRYL+E+ + EEA+ S+AK NKV+ DDP   ++ E +   V A++  G 
Sbjct: 242 IIVGMLLVPESPRYLIEREKHEEARISLAKINKVSPDDPWVQRQAEEIIAGVVAQRELGE 301

Query: 301 ASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGI 360
           ASW ELF  KTKVLQR + G+++    QLTG NYFF+YGT IFK+VGL D F+TS++ G 
Sbjct: 302 ASWKELFSVKTKVLQRLITGILIQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGT 361

Query: 361 VNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNT 420
           VNF ST +A+ VVDK GRR CLL+GAAGM+ CMV+FAS+GV  L+P+GQD PSSKGAGN 
Sbjct: 362 VNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDAPSSKGAGNA 421

Query: 421 MIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITG 480
           MIVF+CF+IFCFA+TWAP+ +++++ESFP +VK++ M++ T  N +W F IGFFTPFITG
Sbjct: 422 MIVFTCFYIFCFASTWAPVAYIVVAESFPSKVKSRAMSISTAFNWLWQFLIGFFTPFITG 481

Query: 481 AINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGT 540
           +I+FYYGYVF+GCLV  + YVF  +PET GL LE++ L++EEGV PWKSASWVPPS+RG+
Sbjct: 482 SIHFYYGYVFVGCLVAMFLYVFFLLPETIGLSLEEIQLLYEEGVKPWKSASWVPPSRRGS 541

Query: 541 DYNAEALATDDKPIYKRM-FSKN 562
              +E + T  K   K + FSK+
Sbjct: 542 --FSEEIETQKKDWKKFLKFSKS 562

>YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}
           HXT13Hexose transporter, induced in the presence of
           non-fermentable carbon sources, induced by low levels of
           glucose, repressed by high levels of glucose
          Length = 564

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/565 (55%), Positives = 415/565 (73%), Gaps = 6/565 (1%)

Query: 1   MDYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNE-IDSQIIEIPKKPASAYLSVCI 59
           M  +QS    D     A  +H +   ++   D  D NE I+   +E PK+    YL + +
Sbjct: 1   MSSAQSSIDSDGDVRDA-DIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYL 59

Query: 60  MCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGC 118
           +C  ++FGGF+ GWD+G   GF++  ++   FGS  HS G  YLS VR GLLV++F++GC
Sbjct: 60  LCYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGC 119

Query: 119 AIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAV 178
           AIG ++  RL DT+GRR  IVI V +Y+VG +IQI+S  KWYQYF+G+II GLG+G  +V
Sbjct: 120 AIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSV 179

Query: 179 LSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWA 238
           L PML+SEI+P  LRG LVS YQL +TFG+FLGYC+ YGT+ YDN+ QWRVPLGLCF WA
Sbjct: 180 LCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWA 239

Query: 239 LVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAA 298
           L++I  M +VPESPRYL+E  + EEA+ S+AK NKV+ +DP  +++ + +   V A++  
Sbjct: 240 LIIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQREL 299

Query: 299 GSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIF 358
           G ASW ELF  KTKVLQR + G++V    QLTG NYFF+YGT IFK+VGL D F+TS++ 
Sbjct: 300 GEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVL 359

Query: 359 GIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAG 418
           G VNF ST +A+ VVDK GRR CLL+GAAGM+ CMV+FAS+GV  L+P+GQD PSSKGAG
Sbjct: 360 GTVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAG 419

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
           N MIVF+CF+IFCFATTWAP+ +++++ESFP +VK++ M++ T  N +W F IGFFTPFI
Sbjct: 420 NAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFI 479

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           TG+I+FYYGYVF+GCLV  + YVF F+PET GL LE++ L++EEG+ PWKSASWVPPS+R
Sbjct: 480 TGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRR 539

Query: 539 GTDYNAEALATDDKPIYKRM-FSKN 562
           G   ++E   T+ K   K + FSKN
Sbjct: 540 GI--SSEESKTEKKDWKKFLKFSKN 562

>YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexose
           transporter, up-regulated in media containing raffinose
           and galactose at pH 7.7 versus pH 4.7, repressed by high
           levels of glucose
          Length = 564

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/561 (54%), Positives = 411/561 (73%), Gaps = 5/561 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNE-IDSQIIEIPKKPASAYLSVCIMCL 62
           S + +  D+       +H +   ++   D  D NE I+   +E PK+    YL + ++C 
Sbjct: 3   SSTESDRDIQDGPDADIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLLCY 62

Query: 63  MVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
            ++FGGF+ GWD+G   GF++  ++   FGS  HS G  YLS VR GLLV++F++GCAIG
Sbjct: 63  PISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIG 122

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
            ++  RL DT+GRR  IVI V +Y+VG +IQI+S  KWYQYF+G+II GLG+G  +VL P
Sbjct: 123 GLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCP 182

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           ML+SEI+P  LRG LVS YQL +TFG+FLGYC+ YGT+ YDN+ QWRVPLGLCF W L++
Sbjct: 183 MLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWTLII 242

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
           I  M +VPESPRYL+E  + EEA+ S+AK NKV+ +DP  +++ + +   V A++  G A
Sbjct: 243 IIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELGEA 302

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           SW ELF  KTKVLQR + G++V    QLTG NYFF+YGT IFK+VGL D F+TS++ G V
Sbjct: 303 SWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGTV 362

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           NF ST +A+ VVDK GRR CLL+GAAGM+ CMV+FAS+GV  L+P+GQD PSSKGAGN M
Sbjct: 363 NFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGNAM 422

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           IVF+CF+IFCFATTWAP+ +++++ESFP +VK++ M++ T  N +W F IGFFTPFITG+
Sbjct: 423 IVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFITGS 482

Query: 482 INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTD 541
           I+FYYGYVF+GCLV  + YVF F+PET GL LE++ L++EEG+ PWKSASWVPPS+RG  
Sbjct: 483 IHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRGIP 542

Query: 542 YNAEALATDDKPIYKRM-FSK 561
             +E   T+ K   K + FSK
Sbjct: 543 --SEESKTEKKDWKKFLKFSK 561

>KAFR0C00180 Chr3 (24352..26028) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/557 (57%), Positives = 406/557 (72%), Gaps = 4/557 (0%)

Query: 8   TGEDVHSSTAGSVHSSQSFQEMKKDSQDFN---EIDSQIIEIPKKPASAYLSVCIMCLMV 64
           T  D  +S + S  SS S +  + DS +F    ++D+  I +PKKP   YL + ++C  V
Sbjct: 3   TELDSKTSDSNSHLSSISNKLFEDDSDNFQVAGKVDTVAI-MPKKPMKEYLKISVLCYCV 61

Query: 65  AFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVV 124
           AFGGFI+GWDTG+I G  + +D++ RF   H DG+   S VR GL+V I N+G A G ++
Sbjct: 62  AFGGFIAGWDTGSISGITNQTDFLQRFAQHHKDGTYEFSNVRKGLVVGIVNIGAAFGGII 121

Query: 125 LGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLI 184
           L +LGD  GR+ G+V  V  Y+VG +I I + DKWYQY IGRII G+G G IAVLSPMLI
Sbjct: 122 LCKLGDVFGRKGGLVCVVCTYMVGCLICITAADKWYQYTIGRIITGMGIGGIAVLSPMLI 181

Query: 185 SEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGA 244
           S   PK +RGTLVSC+QL  TFG+F+ YCTNYG K Y NS  WRVP+GLCFAWAL++IG 
Sbjct: 182 SRKFPKAIRGTLVSCFQLNQTFGIFIAYCTNYGVKDYSNSASWRVPVGLCFAWALILIGG 241

Query: 245 MFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS 304
           +  VPESPRYL E  +IEEAKRS+A SNK+  DDPA            E E+  GSA+W+
Sbjct: 242 LTFVPESPRYLCENNKIEEAKRSIAMSNKLEPDDPAVQVLNRADSAGFEVERQEGSATWA 301

Query: 305 ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFA 364
           +LF T+TKV QR +MG+++ AL QLTG NYFFYYGT IFK+VGLEDSF+TS+I G++NF 
Sbjct: 302 DLFTTRTKVFQRLIMGIMLKALDQLTGDNYFFYYGTSIFKSVGLEDSFETSIILGVINFC 361

Query: 365 STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVF 424
           STF+ALY++D YGRRTCLLWG+ GM  CM V+ASVGV  L+P+G+D  +SKGAGN MIVF
Sbjct: 362 STFLALYIIDHYGRRTCLLWGSTGMTICMCVYASVGVKALYPHGRDNEASKGAGNAMIVF 421

Query: 425 SCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINF 484
           +CFFIFCFATTW P+ +VI+SE+FP+R++AKGMAL T SN +W F I FFTPFI  AI+F
Sbjct: 422 TCFFIFCFATTWPPVCYVIVSETFPMRIRAKGMALATASNWLWGFLISFFTPFINSAIHF 481

Query: 485 YYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNA 544
            YGYVF+GCL FS+ YVF FVPETKGL LE+V  MW + VLPWKSA W+P ++R  D+N 
Sbjct: 482 AYGYVFMGCLFFSWFYVFFFVPETKGLTLEEVEEMWLDNVLPWKSAEWIPAARRTADFNE 541

Query: 545 EALATDDKPIYKRMFSK 561
           E    D K  YK + SK
Sbjct: 542 EEFRHDHKAWYKALLSK 558

>AFL204C Chr6 complement(51587..53194) [1608 bp, 535 aa] {ON}
           Unclear if syntenic homolog of Saccharomyces cerevisiae
           YHR096C (HXT5) and YDR342C (HXT7)
          Length = 535

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/528 (60%), Positives = 395/528 (74%), Gaps = 6/528 (1%)

Query: 23  SQSFQEMKKDSQDFNEIDSQ-----IIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGT 77
           + S  E+  D  + + I+S+     +I    KP SAY+  C+ C MVAFGGFI GWDTGT
Sbjct: 8   TPSKSELSGDGSNSHPIESKKDIVSVISTETKPFSAYIFACLCCFMVAFGGFIFGWDTGT 67

Query: 78  IGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKG 137
           I GF+  +D+I RFG     G   LS  RTGL+VSIFN+GCA+G + L ++GD  GR+ G
Sbjct: 68  ISGFVKQTDFIARFGQLSPSGEYELSDDRTGLIVSIFNIGCAVGGIFLSKIGDAYGRKIG 127

Query: 138 IVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLV 197
           +     +Y++GIVIQI++ DKWYQYF+GRII+GLG G IAVLSPMLISE SPKHLRG+LV
Sbjct: 128 LATVTAVYVIGIVIQISASDKWYQYFVGRIISGLGVGGIAVLSPMLISETSPKHLRGSLV 187

Query: 198 SCYQLMITFGMFLGYCTNYGTKT-YDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLV 256
           SCYQLMIT G+FLGYCTNYGTKT Y +S QWR+PLGL FAWAL+MIG M  VPESPRYLV
Sbjct: 188 SCYQLMITAGIFLGYCTNYGTKTNYTDSRQWRIPLGLGFAWALLMIGGMAFVPESPRYLV 247

Query: 257 EKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQR 316
           E   + +A+ S+A++NKV  D P    E+  +Q A+E E+ AG A   +LF  K K+ QR
Sbjct: 248 EAENLPKARMSIARANKVAEDHPIVEHELNTLQTAIELEKLAGKARIVDLFNVKKKIFQR 307

Query: 317 TLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKY 376
            ++G+ + +LQQL G NYFFYYGT IF AVG++D F TS++ GIVNF STF +LY VDK+
Sbjct: 308 LIIGIFIQSLQQLIGNNYFFYYGTTIFNAVGMDDPFVTSIVLGIVNFGSTFFSLYTVDKF 367

Query: 377 GRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTW 436
           GRR CL+WGA  M  CM +FASVGVTKLWPNG+DQPSSK AGN MIVF+C +IF FATTW
Sbjct: 368 GRRKCLIWGAFAMAICMAIFASVGVTKLWPNGEDQPSSKPAGNVMIVFTCIYIFFFATTW 427

Query: 437 APIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVF 496
           API +VIISE +PLRVKA+ MAL T +N +W F I FFTP IT AI F YGYVF+GCL+F
Sbjct: 428 APIAYVIISEIYPLRVKARAMALATAANWIWGFLIAFFTPRITSAIKFCYGYVFMGCLIF 487

Query: 497 SYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNA 544
           ++ Y+F FVPETKGL LEDV+ MW+EGV+PW S SW+P S R   ++A
Sbjct: 488 AFFYIFFFVPETKGLTLEDVDEMWQEGVVPWGSESWLPRSDREVAHDA 535

>Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072W
           (REAL)
          Length = 636

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/566 (55%), Positives = 414/566 (73%), Gaps = 7/566 (1%)

Query: 1   MDYSQSPTGED--VHSSTAGSVHSSQSFQEMKKDSQDFNEI-DSQIIEIPKKPASAYLSV 57
           M   QS  G D  + ++T   V+ +   ++   D  D NEI +   IE PK+    YL +
Sbjct: 70  MSTVQSSRGSDADIQNATNTDVYVAPPAEKDCSDEFDDNEILNGDTIEPPKRGLLGYLVI 129

Query: 58  CIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNV 116
            ++C  ++FGGF+ GWD+G   GF++  ++   FGS  HS G  YLS VR GLLV++F+V
Sbjct: 130 YLLCYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSV 189

Query: 117 GCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTI 176
           GCAIG V   R  D +GRR  IVI V +Y+VG +IQI+S  KWYQYF+G+II GLG+G  
Sbjct: 190 GCAIGGVSFARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGC 249

Query: 177 AVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFA 236
           +VL PML+SEI+PK LRG L+S YQL +TFG+FLGYC+ YGT+ YDN+ QWRVPLGLCF 
Sbjct: 250 SVLCPMLLSEIAPKDLRGGLISLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFL 309

Query: 237 WALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQ 296
           WAL++I  M +VPESPRYLVE  + E+A  S+AK NKV+ +DP   +++E + + V A++
Sbjct: 310 WALIIIIGMLLVPESPRYLVECERHEDACISIAKINKVSPEDPWVQRQVEEINVGVLAQK 369

Query: 297 AAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSL 356
             G ASW ELF  KTKVLQR + G++V    QLTG NYFF+YGT IFK+VGL D F+TS+
Sbjct: 370 ELGEASWKELFSIKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSI 429

Query: 357 IFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKG 416
           + G VNF ST +A+ VVDK GRR CLL+GAAGM+ CMV+FAS+GV  L+P+GQD PSSKG
Sbjct: 430 VLGTVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKG 489

Query: 417 AGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTP 476
           AGN MIVF+CF+IFCFATTWAP+ +++++ESFP +VK++ M++ T  N +W F IGFFTP
Sbjct: 490 AGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTAFNWLWQFLIGFFTP 549

Query: 477 FITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPS 536
           FITG+I+FYYGYVF+GCLV  + Y+F F+PET GL LE++ L++EEGV PWKS SWVPPS
Sbjct: 550 FITGSIHFYYGYVFVGCLVAMFLYIFFFLPETIGLSLEEIQLLYEEGVKPWKSTSWVPPS 609

Query: 537 QRGTDYNAEALATDDKPIYKRM-FSK 561
           +RG   ++E   T DK   K + FSK
Sbjct: 610 RRGV--HSEETETQDKDWKKFLKFSK 633

>Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON}
           YJR158W (REAL)
          Length = 573

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/557 (55%), Positives = 410/557 (73%), Gaps = 11/557 (1%)

Query: 1   MDYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQD---FNEI-DSQIIEIPKKPASAYLS 56
           M   +S  G +     A    S Q     KK+S D    NE+ +   IE PK+    YL+
Sbjct: 1   MPSEKSSAGSNTEIQNA----SIQVEPPAKKESSDGFYDNEVLNGDTIEAPKRGLLGYLT 56

Query: 57  VCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFN 115
           + ++C  V+FGGF+ GWD+G   GF++  ++   FGS  HS G  YLS VR GLLV++F+
Sbjct: 57  IYLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFS 116

Query: 116 VGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGT 175
           +GC++G V   RL DT+GRR  IVI V +Y+VG +IQI+S  KWYQYF+G+II GLG+G 
Sbjct: 117 IGCSLGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGG 176

Query: 176 IAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCF 235
            +VL PML+SEI+PK LRG LVS +QL +TFG+FLGYC+ YGT+ YDN+ QWR+P+GLCF
Sbjct: 177 CSVLCPMLLSEIAPKDLRGGLVSLFQLNVTFGIFLGYCSVYGTRKYDNTAQWRIPVGLCF 236

Query: 236 AWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAE 295
            WAL++I  M +VPESPRYL+E+G+ EEA+ S+AK N V+ +DP   ++ E +   V A+
Sbjct: 237 LWALIIIIGMLLVPESPRYLIERGKNEEARISIAKINMVSPEDPWVHRQAEEIIAGVVAQ 296

Query: 296 QAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTS 355
           +  G ASW +LF  KTKVLQR + G+++    QLTG NYFF+YGT IFK+VGL D F+TS
Sbjct: 297 REQGEASWKDLFSVKTKVLQRLITGILIQTFLQLTGENYFFFYGTTIFKSVGLTDGFETS 356

Query: 356 LIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSK 415
           +I G VNF ST +A+ VVDK GRR CLL+GAA M+ CMV+FAS+GV  L+P+GQ+ PSSK
Sbjct: 357 IILGTVNFFSTIIAVMVVDKIGRRKCLLFGAAAMMACMVIFASIGVKCLYPHGQNAPSSK 416

Query: 416 GAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFT 475
           GAGN MIVF+CF+IFCFA+TWAP+ +++++ESFP +VK+KGM++ T  N +W F IGFFT
Sbjct: 417 GAGNAMIVFTCFYIFCFASTWAPVAYIVVAESFPSKVKSKGMSISTAFNWLWQFLIGFFT 476

Query: 476 PFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPP 535
           PFITG+I+FYYGYVF+GCLV  + YVF F+PET GL LE++ L++EEGV PWKSASWVPP
Sbjct: 477 PFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGVKPWKSASWVPP 536

Query: 536 SQRGTDYNAEALATDDK 552
           S+RG   ++E + T  K
Sbjct: 537 SRRGG--SSEKIETQKK 551

>YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}
           HXT15Protein of unknown function with similarity to
           hexose transporter family members, expression is induced
           by low levels of glucose and repressed by high levels of
           glucose
          Length = 567

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/558 (54%), Positives = 402/558 (72%), Gaps = 3/558 (0%)

Query: 2   DYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDS-QDFNEIDSQIIEIPKKPASAYLSVCIM 60
           + S      D  +S+A  VH     ++   D   D   I+    + PK+    YL + ++
Sbjct: 4   EQSSPEINADNLNSSAADVHVQPPGEKEWSDGFYDKEVINGNTPDAPKRGFLGYLIIYLL 63

Query: 61  CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCA 119
           C  V+FGGF+ GWD+G   GF++  ++   FGS  HS G  YLS VR GLLV++F+VGC+
Sbjct: 64  CYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCS 123

Query: 120 IGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVL 179
           IG V   RL DT+GRR  IVI V +Y+VG +IQI+S  KWYQYF+G+II GLG+G  +VL
Sbjct: 124 IGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL 183

Query: 180 SPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWAL 239
            PML+SEI+P  LRG LVS YQL +TFG+FLGYC+ YGT+ Y N+ QWR+P+GLCF WAL
Sbjct: 184 CPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIPVGLCFLWAL 243

Query: 240 VMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAG 299
           ++I  M +VPESPRYL+E  + EEA  S+AK NKV+ +DP  +++ + +   V A++  G
Sbjct: 244 IIIVGMLLVPESPRYLIECERHEEACVSIAKINKVSPEDPWVLKQADEINAGVLAQRELG 303

Query: 300 SASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFG 359
            ASW ELF  KTKVLQR + G++V    QLTG NYFF+YGT IFK+VGL D F+TS++ G
Sbjct: 304 EASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLG 363

Query: 360 IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGN 419
            VNF ST +A+ VVDK GRR CLL+GAA M+ CMV+FAS+GV  L+P+GQD PSSKGAGN
Sbjct: 364 TVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFASIGVKCLYPHGQDGPSSKGAGN 423

Query: 420 TMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFIT 479
            MIVF+CF+IFCFATTWAP+ +++++ESFP +VK+K M++ T  N +W F IGFFTPFIT
Sbjct: 424 AMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFLIGFFTPFIT 483

Query: 480 GAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRG 539
           G+I+FYYGYVF+GCLV  + YVF F+PET GL LE++ L++EEG+ PWKSASWVPPS+RG
Sbjct: 484 GSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRG 543

Query: 540 -TDYNAEALATDDKPIYK 556
            +    EA     K + K
Sbjct: 544 ASSRETEAKKKSWKEVLK 561

>YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Protein
           of unknown function with similarity to hexose
           transporter family members, expression is repressed by
           high levels of glucose
          Length = 567

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/558 (54%), Positives = 401/558 (71%), Gaps = 3/558 (0%)

Query: 2   DYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDS-QDFNEIDSQIIEIPKKPASAYLSVCIM 60
           + S      D  +S+A  VH     ++   D   D   I+    + PK+    YL + ++
Sbjct: 4   EQSSPEINADNLNSSAADVHVQPPGEKEWSDGFYDKEVINGNTPDAPKRGFLGYLIIYLL 63

Query: 61  CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCA 119
           C  V+FGGF+ GWD+G   GF++  ++   FGS  HS G  YLS VR GLLV++F+VGC+
Sbjct: 64  CYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCS 123

Query: 120 IGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVL 179
           IG V   RL DT+GRR  IVI V +Y+VG +IQI+S  KWYQYF+G+II GLG+G  +VL
Sbjct: 124 IGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL 183

Query: 180 SPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWAL 239
            PML+SEI+P  LRG LVS YQL +TFG+FLGYC+ YGT+ Y N+ QWR+P+GLCF WAL
Sbjct: 184 CPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIPVGLCFLWAL 243

Query: 240 VMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAG 299
           ++I  M +VPESPRYL+E  + EEA  S+AK +KV+ +DP  +++ + +   V A++  G
Sbjct: 244 IIIVGMLLVPESPRYLIECERHEEACVSIAKIDKVSPEDPWVLKQADEINAGVLAQRELG 303

Query: 300 SASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFG 359
            ASW ELF  KTKVLQR + G++V    QLTG NYFF+YGT IFK+VGL D F+TS++ G
Sbjct: 304 EASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLG 363

Query: 360 IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGN 419
            VNF ST +A+ VVDK GRR CLL+GAA M+ CMV+FAS+GV  L+P+GQD PSSKGAGN
Sbjct: 364 TVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFASIGVKCLYPHGQDGPSSKGAGN 423

Query: 420 TMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFIT 479
            MIVF+CF+IFCFATTWAP+ +++++ESFP +VK+K M++ T  N +W F IGFFTPFIT
Sbjct: 424 AMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFLIGFFTPFIT 483

Query: 480 GAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRG 539
           G+I+FYYGYVF+GCLV  + YVF F+PET GL LE+  L++EEG+ PWKSASWVPPS+RG
Sbjct: 484 GSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEETQLLYEEGIKPWKSASWVPPSRRG 543

Query: 540 -TDYNAEALATDDKPIYK 556
            +    EA     K + K
Sbjct: 544 ASSRETEAKKKSWKEVLK 561

>YIL170W Chr9 (19847..21220) [1374 bp, 457 aa] {ON}  HXT12Possible
           pseudogene in strain S288C; YIL170W/HXT12 and the
           adjacent ORF, YIL171W, together encode a non-functional
           member of the hexose transporter family
          Length = 457

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/455 (68%), Positives = 372/455 (81%), Gaps = 2/455 (0%)

Query: 108 GLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRI 167
           GL+VSIFN+GCAIG +VL ++GD  GRR G++    IY+VGI+IQI SI+KWYQYFIGRI
Sbjct: 2   GLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRI 61

Query: 168 IAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQW 227
           I+G+G G IAVLSPMLISE++PKH+RGTLV  YQLM T G+FLGYCTNYGTK Y N+ QW
Sbjct: 62  ISGIGVGGIAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQW 121

Query: 228 RVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIEL 287
           RV LGLCFAWA  M+  M  VPESPRYL+E G+ EEAK S++KSNKV++DDPA + E + 
Sbjct: 122 RVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKDEEAKHSLSKSNKVSVDDPALLAEYDT 181

Query: 288 VQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVG 347
           ++  +E E+ AG+ASWSEL  TKTKV QR LMGVI+ +LQQLTG NYFFYYGT IFK+VG
Sbjct: 182 IKAGIEIEKLAGNASWSELLSTKTKVFQRVLMGVIIQSLQQLTGDNYFFYYGTTIFKSVG 241

Query: 348 LEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPN 407
           L+DSFQTS+I G+VNF S+F+A+Y ++++GRRTCLLWGAA M+CC  VFASVGVTKLWP 
Sbjct: 242 LKDSFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQ 301

Query: 408 GQDQP--SSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQ 465
           G      +S+GAGN MIVF+ FFIF FATTWA   FVI+SE+FPLR K++GMA+ T +N 
Sbjct: 302 GSSHQDITSQGAGNCMIVFTMFFIFSFATTWAGGCFVIVSETFPLRAKSRGMAIATAANW 361

Query: 466 MWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVL 525
           MW F I FFTPFITGAINFYYGYVFLGCLVF+Y YVF FVPETKGL LE+VN MW EGV 
Sbjct: 362 MWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVP 421

Query: 526 PWKSASWVPPSQRGTDYNAEALATDDKPIYKRMFS 560
            WKSASWVPP +R  DY+A+A+  D++PIYKR FS
Sbjct: 422 AWKSASWVPPERRTADYDADAIDHDNRPIYKRFFS 456

>Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081W
           (REAL)
          Length = 588

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/554 (54%), Positives = 403/554 (72%), Gaps = 9/554 (1%)

Query: 11  DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFI 70
           DV +++   VH +   ++   D    NE     +E P +    YL++ ++C+ ++FGGF+
Sbjct: 32  DVRNASTADVHVTPPIEKEGSDEFALNE---GPLEPPTRGFLGYLTIYLLCIPISFGGFL 88

Query: 71  SGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
            GWD+G   GF++  ++   FGS  HS G  YLS VR GLLV++F+VGCAIG ++  RL 
Sbjct: 89  PGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARLA 148

Query: 130 DTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISP 189
           DT+GRR  IVI V +YIVG +IQI+S  KWYQYF+G+II GLG+G  +VL PML+SEI+P
Sbjct: 149 DTLGRRLAIVIVVLVYIVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAP 208

Query: 190 KHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVP 249
           K LRG L+S YQL +TFG+FLGYC+ YGT+ YDN+ QWR+P+GLCF WAL++I  M +VP
Sbjct: 209 KDLRGGLISLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRIPIGLCFLWALIIIIGMLLVP 268

Query: 250 ESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQT 309
           ESPRYL+E  + EEA+ S+AK NKV+ +DP    E E +   V A++  G ASW EL   
Sbjct: 269 ESPRYLIESEKHEEARTSIAKVNKVSPEDPWVYGEAEEIIAGVLAQREQGEASWKELLSV 328

Query: 310 KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVA 369
           K+KV  R + G++V    QLTG NYFF+YGT IFK+VGL D F+TS+I G VNF ST +A
Sbjct: 329 KSKVFPRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIILGTVNFFSTILA 388

Query: 370 LYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFI 429
           +  VDK GRR CLL+GAAGM+ CMV+FASVGV  L+P+G D PSSKGAGN MIVF+CF+I
Sbjct: 389 VMGVDKIGRRKCLLFGAAGMMACMVIFASVGVKCLYPHGVDGPSSKGAGNAMIVFTCFYI 448

Query: 430 FCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYV 489
           FCFATTWAP+ +++++ESFP + K++ M++ T  N +W F IGFFTPFITG+I+FYYGYV
Sbjct: 449 FCFATTWAPVAYIVVAESFPSKFKSRAMSISTAFNWLWQFLIGFFTPFITGSIHFYYGYV 508

Query: 490 FLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALAT 549
           F+GCL+  + Y+F F+PET GL LE++ L++EEGV PWKSASWVPPS+RG   N    A 
Sbjct: 509 FVGCLIAMFFYIFFFLPETIGLSLEEIQLLYEEGVKPWKSASWVPPSRRG---NTSEQAQ 565

Query: 550 DDKPIYKRM--FSK 561
            +K  +K+   FSK
Sbjct: 566 VEKKNWKKFLKFSK 579

>ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]
           {ON} similar to uniprot|P43581 Saccharomyces cerevisiae
           YFL011W HXT10 Putative hexose transporter expressed at
           low levels and expression is repressed by glucose
          Length = 616

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/535 (56%), Positives = 398/535 (74%), Gaps = 2/535 (0%)

Query: 5   QSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMV 64
           ++PT      +   S + S   Q++  +  +  EIDS I    K   + + S+   CLM+
Sbjct: 67  RTPTNRSRDETIEYSSNYSHFSQKLTPEKSEHLEIDS-IPSTEKGSVTNHWSIICSCLMI 125

Query: 65  AFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKY-LSKVRTGLLVSIFNVGCAIGSV 123
           AFGGF+ GWDTGTI GF++ +D+  RFG   S   ++ LS+ R GL+VS+FNVGCAIG  
Sbjct: 126 AFGGFVFGWDTGTISGFINMTDFKRRFGHWDSTNEEFQLSEARMGLIVSVFNVGCAIGGF 185

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
            LGRLGD  GRR+G++ +V +Y+VGIV+QIASI+ WYQYF GRI++GLG G+++VLSP L
Sbjct: 186 TLGRLGDIYGRREGLMCSVLVYVVGIVVQIASINTWYQYFFGRILSGLGVGSLSVLSPTL 245

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISEISPK LRGT VS YQLMIT G+FLGYCT+YGTK Y NS+QWRVPLGLCF WA+ M+ 
Sbjct: 246 ISEISPKQLRGTCVSFYQLMITLGIFLGYCTDYGTKFYANSVQWRVPLGLCFLWAIFMLV 305

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            + +VPESPR+L+EKG  EEA +SV++ NK+  D P  I+E+E +  A+E  +  G ASW
Sbjct: 306 GLMVVPESPRFLLEKGFKEEAIQSVSRLNKLPQDHPTVIEELESINAAIEVGRLEGEASW 365

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            ELF  + ++ +R  +G ++L+LQQLTG NYFFYYGT IF+ +GL+DSF+TS+I G++N 
Sbjct: 366 KELFSNRGQIFRRVKIGAMILSLQQLTGNNYFFYYGTTIFRTIGLDDSFETSIILGVINL 425

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
            STFVAL+ VD++GRR  LL G+  M  C ++FASVGVTKLWP+G+D+PSSK AGN M+ 
Sbjct: 426 VSTFVALWTVDRFGRRKSLLTGSLAMSACFLIFASVGVTKLWPHGRDEPSSKPAGNAMVA 485

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           F+C FIF FATTWAP  +VI+SE++PLRVK + MA+    ++MW F IGF TPFIT +I+
Sbjct: 486 FACLFIFSFATTWAPTAYVIVSETYPLRVKNRAMAIAVGCDKMWGFLIGFLTPFITSSIH 545

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           FYYGYVFLGCL+FS+ YVF FV ETKGL LE+VN M+EEG   W S++W P SQR
Sbjct: 546 FYYGYVFLGCLIFSFFYVFFFVCETKGLTLEEVNEMYEEGTKAWHSSNWTPQSQR 600

>KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/535 (50%), Positives = 374/535 (69%), Gaps = 6/535 (1%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDS-QDFNEIDSQIIE----IPKKPASAYLSVCIMCLMV 64
           E       GS + S S +  +K S + FNE  S++++    +PKKP + Y    ++   +
Sbjct: 88  EHEQLQRTGSSNDSYSLEPHEKVSGESFNEYHSEVLDEAPGLPKKPITEYAGTILIFFCI 147

Query: 65  AFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVV 124
           AFG FI GWDTGTI GF++  +++  FG    D + YLS VRTGL+V+IFN+GCA+G + 
Sbjct: 148 AFGEFIYGWDTGTISGFVAFDNFLENFGEKRKDDTYYLSNVRTGLIVAIFNIGCAVGGIF 207

Query: 125 LGRLGDTVGRRKGIVIAVFIYIVGIVIQIASI-DKWYQYFIGRIIAGLGSGTIAVLSPML 183
           L ++GD  GR+ GI+    IYI+G +I I S+  KWYQY IGRII+GL  G    L P+ 
Sbjct: 208 LSKIGDIYGRKIGIIFMNVIYIIGQLICITSMKHKWYQYTIGRIISGLAVGGFMTLIPIF 267

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ++E +PKHLRG  +S    M T G+ LGYC N G K Y  + QWR+PLGL FAWA+++  
Sbjct: 268 LAETAPKHLRGLAISVGMFMCTLGILLGYCANLGLKDYTTTAQWRIPLGLTFAWAILLFA 327

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            + + PESPRYL E  +IE AK+SVA+SNKV  DDPA   EI+ +  +++ E+  G+ASW
Sbjct: 328 GVLVTPESPRYLCECKKIELAKKSVARSNKVHSDDPAVQSEIDAMLASIQYEKEVGTASW 387

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
           +ELF TK K+LQR ++G+ + A QQLTG NYFFYY T IFK+VG+ +S+ TS+I G +NF
Sbjct: 388 AELFSTKDKILQRLIIGIFIQAFQQLTGDNYFFYYATTIFKSVGMSNSYITSIILGAINF 447

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
            S+F++++ VD  GRR  LLWGAA M  CMV++AS+GVT+L+P+G+ QP SK AG+ MIV
Sbjct: 448 GSSFISMWSVDHIGRRRSLLWGAALMAICMVIYASLGVTRLYPHGRSQPPSKAAGDVMIV 507

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAIN 483
           F+C +I  FATTW P  ++I+SE +PLR+++KGM+L + +N ++ F I FFTPFI  AI+
Sbjct: 508 FTCLYILFFATTWEPCAWLIVSEIYPLRIRSKGMSLASSANWIFGFLISFFTPFINSAIH 567

Query: 484 FYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           F YGYVF+GCLV  + +VF FVPET GL LE++  M+EEGVL WKS  WVP ++R
Sbjct: 568 FSYGYVFMGCLVAMFLFVFFFVPETTGLSLEEIGEMFEEGVLAWKSRDWVPSAKR 622

>Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072W
           (REAL)
          Length = 487

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/479 (58%), Positives = 361/479 (75%), Gaps = 6/479 (1%)

Query: 86  DYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFI 144
           ++   FGS  HS G  YLS VR GLLV++F+VGCAIG ++  RL DT+GRR  IVI V +
Sbjct: 3   NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARLADTLGRRLAIVIVVLV 62

Query: 145 YIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMI 204
           YIVG +IQI+S  KWYQYF+G+II GLG+G  +VL PML+SEI+PK LRG L+S YQL +
Sbjct: 63  YIVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 122

Query: 205 TFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEA 264
           TFG+FLGYC+ YGT+ YDN+ QWR+P+GLCF WAL++I  M +VPESPRYL+E  + EEA
Sbjct: 123 TFGIFLGYCSVYGTRKYDNTAQWRIPIGLCFLWALIIIIGMLLVPESPRYLIESEKHEEA 182

Query: 265 KRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVL 324
           + S+AK NKV+ +DP    E E +   V A++  G ASW EL   K+KV  R + G++V 
Sbjct: 183 RTSIAKVNKVSPEDPWVYGEAEEIIAGVLAQREQGEASWKELLSVKSKVFPRLITGILVQ 242

Query: 325 ALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLW 384
              QLTG NYFF+YGT IFK+VGL D F+TS+I G VNF ST +A+  VDK GRR CLL+
Sbjct: 243 TFLQLTGENYFFFYGTTIFKSVGLTDGFETSIILGTVNFFSTILAVMGVDKIGRRKCLLF 302

Query: 385 GAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVII 444
           GAAGM+ CMV+FASVGV  L+P+G D PSSKGAGN MIVF+CF+IFCFATTWAP+ ++++
Sbjct: 303 GAAGMMACMVIFASVGVKCLYPHGDDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVV 362

Query: 445 SESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAF 504
           +ESFP + K++ M++ T  N +W F IGFFTPFITG+I+FYYGYVF+GCL+  + Y+F  
Sbjct: 363 AESFPSKFKSRAMSISTAFNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLIAMFFYIFFL 422

Query: 505 VPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRM--FSK 561
           +PET GL LE++ L++EEGV PWKSASWVPPS+RG   N    A  +K  +K+   FSK
Sbjct: 423 LPETIGLSLEEIQLLYEEGVKPWKSASWVPPSRRG---NISEQAQVEKKDWKKFLKFSK 478

>Kwal_26.6680 s26 complement(19490..20740) [1251 bp, 416 aa] {ON}
           YEL069C (HXT13) - high-affinity hexose transporter
           [contig 294] FULL
          Length = 416

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/403 (61%), Positives = 315/403 (78%)

Query: 139 VIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVS 198
           ++ + +Y+VG +IQI +  KWY YFIG+II G G G ++VLSPMLISEISPKHLRGTLVS
Sbjct: 1   MLVMIVYVVGAIIQITADRKWYHYFIGKIIYGWGVGGMSVLSPMLISEISPKHLRGTLVS 60

Query: 199 CYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEK 258
           C+QLM+TFG+FLGYC  YGT+ Y +S QWR+P+GL F WA++++  MF VPESPRYLVE 
Sbjct: 61  CFQLMVTFGIFLGYCAVYGTRQYSDSAQWRIPVGLSFLWAIIIVTGMFFVPESPRYLVEA 120

Query: 259 GQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTL 318
            ++EEAKRS+A++ K+++DDP   +E +L+   VEA++  G ASW ELF  KTKVLQR +
Sbjct: 121 NKVEEAKRSIARAFKLSVDDPEVQEETDLIVAGVEAQREQGEASWGELFSVKTKVLQRLI 180

Query: 319 MGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGR 378
            G+++ +  QLTG NYFFYYGT IF ++GL DSFQTS++ G VN AS+F+++Y VD  GR
Sbjct: 181 TGILMQSFLQLTGENYFFYYGTTIFDSIGLTDSFQTSIVLGTVNLASSFISMYTVDALGR 240

Query: 379 RTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAP 438
           R CLLWGAAGM  CMV+FASVGVT L PNG D  +SK AGN M+VF C FI CFATTWAP
Sbjct: 241 RKCLLWGAAGMAICMVIFASVGVTSLRPNGPDGEASKSAGNCMVVFICLFILCFATTWAP 300

Query: 439 IPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSY 498
           I +V++SESFPLRVK+K M++ T  N +W F I FFTPFITGAINFYYGYVF GCLV  +
Sbjct: 301 ISYVVVSESFPLRVKSKCMSISTAFNWLWQFLISFFTPFITGAINFYYGYVFFGCLVAMF 360

Query: 499 CYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTD 541
            YVF FVPET GL LE+V  +++EGV  W+S SWVPP +R ++
Sbjct: 361 LYVFFFVPETGGLTLEEVQTLYDEGVPAWRSTSWVPPGRRSSN 403

>Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1407
           bp, 468 aa] {ON} YJL214W (REAL)
          Length = 468

 Score =  469 bits (1207), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 226/348 (64%), Positives = 278/348 (79%), Gaps = 1/348 (0%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
           ED HSS   S H S    E  K     N  ++Q I IP+KPAS YL+V IMCL VAFGGF
Sbjct: 16  EDNHSSNGNSSHLSTPTVEDNKACSKENGEEAQEIVIPEKPASTYLTVSIMCLCVAFGGF 75

Query: 70  ISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRL 128
           ISGWDTGTI GF++ +D++ RFG+ SHS    YLS VRTGL+VSIFNVG AIG + L +L
Sbjct: 76  ISGWDTGTISGFVNQTDFLRRFGNYSHSKDVYYLSNVRTGLIVSIFNVGSAIGCLFLSKL 135

Query: 129 GDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEIS 188
           GD  GR  G+VI + +Y+VGIVIQIAS+DKWYQYFIGRI+AG+G+G+I+VL+PMLISE +
Sbjct: 136 GDIYGRCMGLVIVIVVYMVGIVIQIASVDKWYQYFIGRIVAGVGAGSISVLAPMLISETA 195

Query: 189 PKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIV 248
           PK +RGTL++C+QLM+TF +FLGYCTNYGTK+Y NSIQWRVPLGLCFAWA++MIG M  V
Sbjct: 196 PKQIRGTLLACWQLMVTFAIFLGYCTNYGTKSYSNSIQWRVPLGLCFAWAIIMIGGMMFV 255

Query: 249 PESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQ 308
           PESPR+LV+ G++E+AK S AKSNK++IDDPA I EI+L+   VEAE+A G+ASW ELF 
Sbjct: 256 PESPRFLVQVGRVEKAKASFAKSNKLSIDDPAVIAEIDLLVAGVEAEEAMGTASWKELFS 315

Query: 309 TKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSL 356
            KTKV QR  M V++ +LQQLTG NYFFYYGT IFK+VG+ DSF+TS+
Sbjct: 316 RKTKVFQRLTMTVMINSLQQLTGDNYFFYYGTTIFKSVGMNDSFETSI 363

 Score =  164 bits (416), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 75/116 (64%), Positives = 90/116 (77%), Gaps = 2/116 (1%)

Query: 444 ISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFA 503
           +++SF   +K   M++ T +N +W F IGFFTPFIT AINFYYGYVF+GCL FSY YVF 
Sbjct: 355 MNDSFETSIKC--MSVATSANLLWGFLIGFFTPFITSAINFYYGYVFMGCLAFSYFYVFL 412

Query: 504 FVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMF 559
           FVPETKGL LE+V+ MW +GVLPWKS SW+P S+RGTDY+ E L  DDKP YKRM 
Sbjct: 413 FVPETKGLALEEVDEMWIDGVLPWKSESWIPSSRRGTDYDNEKLQHDDKPWYKRML 468

>Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON}
           YJL214W (REAL)
          Length = 470

 Score =  454 bits (1167), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 218/356 (61%), Positives = 279/356 (78%), Gaps = 3/356 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEI--PKKPASAYLSVCIMC 61
           + S   E V      + +SSQ      ++++ + E + + +EI  P+KPAS YL+V IMC
Sbjct: 10  NNSAVAEAVDDKNPSTRNSSQLPTPTVEENKAYFEDNGEALEIVIPEKPASTYLTVSIMC 69

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAI 120
           L VAFGGFISGWDTGTI GF++ +D++ RFG+ SHS  + YLS VRTGL+VSIFNVG AI
Sbjct: 70  LCVAFGGFISGWDTGTISGFVNQTDFLRRFGNYSHSRNAYYLSNVRTGLIVSIFNVGSAI 129

Query: 121 GSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLS 180
           G + L +LGD  GR  G++I + +Y+VGIVIQIAS+DKWYQYFIGRI+AG+G+G+I+VL+
Sbjct: 130 GCLFLSKLGDIYGRCVGLIIVIVVYMVGIVIQIASVDKWYQYFIGRIVAGIGAGSISVLA 189

Query: 181 PMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALV 240
           PMLISE +PK +RGTL++C+QLM+TF +FLGYCTNYGTK+Y NSIQWRVPLGLCFAWA++
Sbjct: 190 PMLISETAPKQIRGTLLACWQLMVTFAIFLGYCTNYGTKSYSNSIQWRVPLGLCFAWAII 249

Query: 241 MIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGS 300
           MIG M  VPESPR+LV+ G++E+AK S AKSNK+ I D   I EI+L+   VEAE+A G+
Sbjct: 250 MIGGMMFVPESPRFLVQVGRVEKAKASFAKSNKLAIADSVVIAEIDLLIAGVEAEEAMGT 309

Query: 301 ASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSL 356
           ASW ELF  KTKV QR  M VI+ +LQQLTG NYFFYYGT IFK+VG+ DSF+TS+
Sbjct: 310 ASWKELFSRKTKVFQRLTMTVIINSLQQLTGDNYFFYYGTTIFKSVGMNDSFETSI 365

 Score =  162 bits (411), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 74/116 (63%), Positives = 89/116 (76%), Gaps = 2/116 (1%)

Query: 444 ISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFA 503
           +++SF   +K   M++ T +N +W F IGFFTPFIT AINFYYGYVF+GCL FSY YVF 
Sbjct: 357 MNDSFETSIKC--MSVATSANLLWGFLIGFFTPFITSAINFYYGYVFMGCLAFSYFYVFL 414

Query: 504 FVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMF 559
           FVPETKGL LE+V+ MW +GVLPWKS SWVP S+RG DY+ E L  D+KP YKRM 
Sbjct: 415 FVPETKGLALEEVDEMWMDGVLPWKSESWVPSSRRGADYDNEKLQRDEKPWYKRML 470

>Suva_2.513 Chr2 complement(917149..917883) [735 bp, 244 aa] {ON}
           YDR343C (REAL)
          Length = 244

 Score =  402 bits (1033), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 212/242 (87%)

Query: 319 MGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGR 378
           MG ++ +LQQLTG NYFFYYGT IFKAVG+ DSF+TS++ GIVNFASTFV +YVVDKYGR
Sbjct: 1   MGAMIQSLQQLTGDNYFFYYGTTIFKAVGMSDSFETSIVLGIVNFASTFVGIYVVDKYGR 60

Query: 379 RTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAP 438
           RTCLLWGAA M  CMVV+ASVGVT+LWPNG+ QPSSKGAGN MIVF+CF+IFCFATTWAP
Sbjct: 61  RTCLLWGAASMTACMVVYASVGVTRLWPNGKSQPSSKGAGNCMIVFACFYIFCFATTWAP 120

Query: 439 IPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSY 498
           IP+V++SE+FPLR+K+K M++ T +N  W F IGFFTPFITGAINFYYGYVF+GCLVF +
Sbjct: 121 IPYVVVSETFPLRIKSKAMSIATAANWFWGFLIGFFTPFITGAINFYYGYVFMGCLVFMF 180

Query: 499 CYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRM 558
            YV   VPETKGL LE+VN MWEEGVLPWKSASWVPPS+R  DY+A+A+  DDKP+YKRM
Sbjct: 181 FYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRNADYDADAMMHDDKPMYKRM 240

Query: 559 FS 560
           FS
Sbjct: 241 FS 242

>Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)
          Length = 315

 Score =  399 bits (1024), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 240/298 (80%), Gaps = 1/298 (0%)

Query: 13  HSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISG 72
            SS   S   S+   E  K   D N  +++ I +P+KPASAY++V IMCL +AFGGF+SG
Sbjct: 18  QSSAENSSRLSKHTVEENKAFSDTNGEEAEEIVLPEKPASAYVTVSIMCLCMAFGGFMSG 77

Query: 73  WDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDT 131
           WDTGTI GF++ +D++ RFG+ SHS G+ YLS VRTGL+VSIFNVG AIG + L +LGD 
Sbjct: 78  WDTGTISGFVNQTDFLRRFGNYSHSKGTYYLSNVRTGLIVSIFNVGSAIGCLFLSKLGDI 137

Query: 132 VGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKH 191
            GR  G++I + +Y+VGIVIQIAS+DKWYQYFIGRIIAG+G+G+I+VL+PMLISE +PK 
Sbjct: 138 YGRCTGLIIVIVVYMVGIVIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKQ 197

Query: 192 LRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPES 251
           +RGTL++C+QLM+TF +FLGYCTNYGTK+Y NS+QWRVPLGLCFAWA++MIG M  VPES
Sbjct: 198 IRGTLLACWQLMVTFAIFLGYCTNYGTKSYSNSVQWRVPLGLCFAWAIIMIGGMMFVPES 257

Query: 252 PRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQT 309
           PR+LV+  + EEA+ S AKSNK+++DDPA I EI+L++  VEAE+A G+ASW ELF T
Sbjct: 258 PRFLVQVKKTEEARASFAKSNKLSVDDPAVIAEIDLLEAGVEAEEAMGTASWKELFST 315

>Suva_68.1 Chr68 complement(3..833) [831 bp, 277 aa] {ON} YOL156W
           (REAL)
          Length = 277

 Score =  391 bits (1005), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 183/277 (66%), Positives = 223/277 (80%), Gaps = 2/277 (0%)

Query: 195 TLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRY 254
            LV  YQLM T G+FLGYCTNYGTK YD+S QWRV LGLCFAWA  MI  M  VPESPR+
Sbjct: 1   NLVQLYQLMGTMGIFLGYCTNYGTKNYDDSTQWRVGLGLCFAWATFMISGMMFVPESPRF 60

Query: 255 LVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVL 314
           LVE G+ EEAKRS++KSNKV++DDPA + E + ++  +E E+ AG+ASW EL  TKTKV 
Sbjct: 61  LVEVGKHEEAKRSISKSNKVSVDDPALLAEYDAIRAGIELEKLAGNASWGELLSTKTKVF 120

Query: 315 QRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVD 374
           QR LMGV++ +LQQLTG NYFFYYGT IFK++GL+DSFQTS+I G VNF S+FVA+Y ++
Sbjct: 121 QRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSIGLKDSFQTSIIIGAVNFFSSFVAIYTIE 180

Query: 375 KYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSKGAGNTMIVFSCFFIFCF 432
           ++GRRTCLLWGAA M+CC +VFASVGVTKLWP G D    +S+GAGN MIVF+ FFIF F
Sbjct: 181 RFGRRTCLLWGAAAMLCCFIVFASVGVTKLWPQGSDHQDITSQGAGNCMIVFTMFFIFSF 240

Query: 433 ATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNF 469
           ATTWA   +VI+SE+FPLRVK++GMA+ T +N MW F
Sbjct: 241 ATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGF 277

>SAKL0C07920g Chr3 complement(735512..737317) [1806 bp, 601 aa] {ON}
           similar to uniprot|P42833 Saccharomyces cerevisiae
           YNL318C
          Length = 601

 Score =  402 bits (1034), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 206/477 (43%), Positives = 303/477 (63%), Gaps = 13/477 (2%)

Query: 53  AYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS--SHSDGSKYLSKVRTGLL 110
           + L   ++CL  +FGGFI GWD GTIGG  +   + N FG+  +   G+ Y   +  GL+
Sbjct: 114 SLLKPIVLCLSTSFGGFIFGWDVGTIGGISNMESFKNNFGTLFNARTGTHYFPDMLIGLV 173

Query: 111 VSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAG 170
           +SIFN+GCA+G + L ++GD  GR+ GI  ++ +Y+VG++IQ+ +  +WYQ+F+GRI +G
Sbjct: 174 ISIFNIGCAVGGLTLAKVGDWKGRKIGIYASLLVYVVGLLIQVVNSTRWYQFFVGRIFSG 233

Query: 171 LGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYG-TKTYDNSI---Q 226
           L  G+ AVL PM ISE +P  +RG +V  YQLMIT G+ +G   NY   KT  +++    
Sbjct: 234 LAVGSTAVLVPMFISESAPLQIRGAMVVLYQLMITLGILMGNVVNYACKKTIADALANKN 293

Query: 227 WRVPLGLCFAWALVMIGAMFIVPESPRYL-VEKGQIEEAKRSVAKSNKVTIDDPATIQEI 285
           W++P+ L F W+LV+   +F +PES ++L V+K  ++ A RSVA  N ++  DP   +++
Sbjct: 294 WQIPVALGFVWSLVIAVGIFFMPESAQFLVVKKNDVDGALRSVAIMNSLSAKDPFVAEQV 353

Query: 286 ELVQI--AVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIF 343
           E + +     +     + +W E    + ++  R L G++V+A QQL+G NYFFYYGT +F
Sbjct: 354 EHLALYDIDRSPDTQSNTNWLEFLVGRPRLGLRLLTGMLVMAFQQLSGANYFFYYGTTLF 413

Query: 344 KAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTK 403
            +VG++DS+ TS++   VNFASTF  +Y+V+K GR++CLL G+AGM  CM V+AS+G   
Sbjct: 414 DSVGVDDSYVTSILLSGVNFASTFGGIYLVEKLGRKSCLLLGSAGMFVCMTVYASIGSFA 473

Query: 404 LWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVS 463
           L   G +       G  MI F+C +I  FA T  P+ FV+ISE FP R KA  MA+ T  
Sbjct: 474 LHVGGYNVV----PGAVMIAFTCIYIMFFACTTGPVSFVVISELFPARTKAISMAICTSI 529

Query: 464 NQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMW 520
           N   NF I  FTP+IT  I F YGYVF GCL+ S  +V+  VPETKGL +E V+ ++
Sbjct: 530 NWFANFLISLFTPYITSEIGFRYGYVFAGCLLLSVVFVWCMVPETKGLTIEQVDELY 586

>Suva_6.49 Chr6 (85313..85525,85525..86397) [1086 bp, 361 aa] {ON}
           YFL011W (REAL)
          Length = 361

 Score =  387 bits (993), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 183/275 (66%), Positives = 228/275 (82%)

Query: 264 AKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIV 323
           ++RS+AKSNKVT+ DP  I E++ +   +EAE+AAG+ASWSELF  K  +L R +MGV++
Sbjct: 71  SRRSLAKSNKVTVTDPGVISEVDAIVANMEAERAAGNASWSELFSNKGAILPRVIMGVVI 130

Query: 324 LALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLL 383
            +LQQLTGCNYFFYYGT IF AVG+EDSF+TS++ G+VNFASTFVALY+VDK+GRR CLL
Sbjct: 131 QSLQQLTGCNYFFYYGTTIFNAVGMEDSFETSIVLGVVNFASTFVALYIVDKFGRRKCLL 190

Query: 384 WGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVI 443
           WG+A M  C V+FASVGVT+LWP+G+DQPSS+ AGN MIVF+CFFIFCFA TWAPI +VI
Sbjct: 191 WGSASMAICFVIFASVGVTRLWPHGKDQPSSQSAGNVMIVFTCFFIFCFAITWAPIAYVI 250

Query: 444 ISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFA 503
           ++ES+PLRVK + MA+   +N MW F IGFFTPFIT AI+F YGYVF+GCL+FSY YVF 
Sbjct: 251 VAESYPLRVKNRAMAIAVGANWMWGFLIGFFTPFITRAISFSYGYVFMGCLIFSYFYVFF 310

Query: 504 FVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQR 538
           FV ETKGL LE+VN M+EE + PWKS  W+P ++R
Sbjct: 311 FVCETKGLTLEEVNEMYEERIKPWKSGGWIPSAKR 345

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 3/59 (5%)

Query: 20 VHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTI 78
          + +S S +E  K + +  E+     +IP KP  AY +V  +CLM+AFGGFI GWDTGTI
Sbjct: 15 ISTSPSGKEEVKRTPEVREVSP---DIPNKPIIAYWTVMGLCLMIAFGGFIFGWDTGTI 70

>Skud_87.1 Chr87 (1..726) [726 bp, 242 aa] {ON} YDR343C (REAL)
          Length = 242

 Score =  381 bits (978), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 206/242 (85%)

Query: 280 ATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYG 339
           + + E+E V   +EAE+ AGSASW ELF T+TKVLQR +MG ++ +LQQLTG NYFFYYG
Sbjct: 1   SVLAEVEGVLAGIEAEKLAGSASWVELFSTRTKVLQRLIMGAMIQSLQQLTGDNYFFYYG 60

Query: 340 TIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASV 399
           T IFKAVGL DSF+TS++ GIVNFASTFV +YVVDKYGRRTCLLWGAA M  CMVV+ASV
Sbjct: 61  TTIFKAVGLSDSFETSIVLGIVNFASTFVGIYVVDKYGRRTCLLWGAASMTACMVVYASV 120

Query: 400 GVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMAL 459
           GVT+LWPNGQDQPSSKGAGN MIVF+CF+IFCFATTWAPIP+V++SE+FPLRVK+K M++
Sbjct: 121 GVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSI 180

Query: 460 GTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLM 519
            T +N  W F IGFFTPFIT AINFYYGYVF+GCLVF + YV   VPETKGL LE+VN M
Sbjct: 181 ATAANWFWGFLIGFFTPFITSAINFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTM 240

Query: 520 WE 521
           WE
Sbjct: 241 WE 242

>Skud_4.614 Chr4 complement(1092655..1093665) [1011 bp, 336 aa] {ON}
           YDR345C (REAL)
          Length = 336

 Score =  383 bits (983), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 197/326 (60%), Positives = 246/326 (75%), Gaps = 2/326 (0%)

Query: 6   SPTGEDVHSSTAGSVHSSQ--SFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           SP     +S+     +SSQ  +  E K    DF     Q+   P     AY++V I C+M
Sbjct: 9   SPQKSSENSNAELPSNSSQVMNMPEEKGVQDDFQTEADQVFTNPNTGKGAYVTVSICCVM 68

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGGF+ GWDTGTI GF++ +D++ RFG  H DG+ YLSKVRTGL+V+IFN+GCAIG +
Sbjct: 69  VAFGGFVFGWDTGTISGFVAQTDFVRRFGMKHHDGTPYLSKVRTGLIVAIFNIGCAIGGI 128

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
           VL +LGD  GR+ G+++ V IYI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPML
Sbjct: 129 VLAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPML 188

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE++PK +RGTLVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWAL MIG
Sbjct: 189 ISEVAPKEMRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG 248

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            M  VPESPRYLVE GQI+EA+ S+AK NK   D P   QE+E ++ +VE  +AAGSASW
Sbjct: 249 GMTFVPESPRYLVEAGQIDEARASLAKVNKTAPDHPFIQQELEFIEASVEEARAAGSASW 308

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQL 329
            ELF  K  +LQRT+MG+++ +LQ +
Sbjct: 309 GELFTGKPAMLQRTMMGIMIQSLQTI 334

>Skud_4.613 Chr4
           complement(1091965..1092006,1092030..1092095,
           1092099..1092257,1092301..1092384,1092388..1092603,
           1092607..1092651,1092658..1093665) [1620 bp, 540 aa]
           {ON} YDR345C (PSEUDO)
          Length = 540

 Score =  383 bits (983), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 197/326 (60%), Positives = 246/326 (75%), Gaps = 2/326 (0%)

Query: 6   SPTGEDVHSSTAGSVHSSQ--SFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           SP     +S+     +SSQ  +  E K    DF     Q+   P     AY++V I C+M
Sbjct: 9   SPQKSSENSNAELPSNSSQVMNMPEEKGVQDDFQTEADQVFTNPNTGKGAYVTVSICCVM 68

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGGF+ GWDTGTI GF++ +D++ RFG  H DG+ YLSKVRTGL+V+IFN+GCAIG +
Sbjct: 69  VAFGGFVFGWDTGTISGFVAQTDFVRRFGMKHHDGTPYLSKVRTGLIVAIFNIGCAIGGI 128

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
           VL +LGD  GR+ G+++ V IYI+GI+IQIASI+KWYQYFIGRII+GLG G IAVLSPML
Sbjct: 129 VLAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPML 188

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE++PK +RGTLVSCYQLMIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWAL MIG
Sbjct: 189 ISEVAPKEMRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG 248

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            M  VPESPRYLVE GQI+EA+ S+AK NK   D P   QE+E ++ +VE  +AAGSASW
Sbjct: 249 GMTFVPESPRYLVEAGQIDEARASLAKVNKTAPDHPFIQQELEFIEASVEEARAAGSASW 308

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQL 329
            ELF  K  +LQRT+MG+++ +LQ +
Sbjct: 309 GELFTGKPAMLQRTMMGIMIQSLQTI 334

>Ecym_2797 Chr2 complement(1548238..1549803) [1566 bp, 521 aa] {ON}
           similar to Ashbya gossypii AFR602W
          Length = 521

 Score =  379 bits (972), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 206/513 (40%), Positives = 300/513 (58%), Gaps = 17/513 (3%)

Query: 22  SSQSFQEMKKDSQDFNEIDSQIIEIPKKPASA-----YLSVCIMCLMVAFGGFISGWDTG 76
           SS S Q   K+     E  +  IE P     A      L   ++CL  +FGGFI GWD G
Sbjct: 5   SSTSTQLSDKEGYAIYEFMASTIESPSPAELASRRKRLLKPVLLCLASSFGGFILGWDVG 64

Query: 77  TIGGFLSHSDYINRFGS--SHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGR 134
           TIGG  + S + N FG+  +   G K   +  +G +++IFN+GCA+G + L +LGD  GR
Sbjct: 65  TIGGIANMSSFQNHFGTMINPETGLKGFPEKLSGAIIAIFNIGCALGGLTLAKLGDIKGR 124

Query: 135 RKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRG 194
           R GI +A+  YI G++IQI S   WYQ+FIGRI+ G   GT  VL PM ISE +P  +RG
Sbjct: 125 RFGIFVALIFYIAGLLIQILSNANWYQFFIGRIVTGFAVGTTTVLVPMFISESAPIQIRG 184

Query: 195 TLVSCYQLMITFGMFLGYCTNYGTKTYD----NSIQWRVPLGLCFAWALVMIGAMFIVPE 250
           ++V  YQLMIT G+ +G   N+  K       +++ W++P+ L   W + ++  + ++PE
Sbjct: 185 SMVVLYQLMITLGILIGNLVNFACKELVEDSLSNVSWQIPINLGILWTVFVLLGLSLMPE 244

Query: 251 SPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAG-SASWSELFQT 309
           S ++ V KG IE+A+ S A  N +  D P  I +I  +  ++  E++ G   SW  LF  
Sbjct: 245 STQFYVSKGNIEKAQESFAIMNSLPKDHPFVIDQISFLASSMIREESRGCHGSWEFLFG- 303

Query: 310 KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVA 369
           K ++  R  +GV+++A QQL+G NYF YY T +F +VG+ DS+ T++I   VNF STF  
Sbjct: 304 KPRLGLRLFIGVMIMAFQQLSGINYFLYYSTTLFDSVGVGDSYVTAIILSSVNFISTFSG 363

Query: 370 LYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFI 429
           +Y+V+K GRR CL+ G+ GM   M+ +A +G   L     D       G+ M+ F+C FI
Sbjct: 364 VYIVEKLGRRCCLILGSVGMFISMLTYACIGTHFL----DDDSIRVNTGSIMVAFTCAFI 419

Query: 430 FCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYV 489
             FA T  PI FV+I+E FP R K+  MA+ T  N + NF I   TP +  AI F +GY+
Sbjct: 420 MFFACTSGPISFVVIAELFPTRTKSISMAICTSVNWIVNFVIAICTPSVIAAIGFKFGYL 479

Query: 490 FLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEE 522
           F GCL+ S  + +  +PETKGL  E V+ ++E+
Sbjct: 480 FAGCLMTSTIFFYCMIPETKGLTAEQVDAIYEK 512

>KAFR0A08520 Chr1 (1708192..1709877) [1686 bp, 561 aa] {ON} Anc_3.23
           YNL318C
          Length = 561

 Score =  376 bits (965), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 204/522 (39%), Positives = 312/522 (59%), Gaps = 25/522 (4%)

Query: 11  DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFI 70
           D+ +   G     Q  Q     S  +N I+S+  +  KKP    L   ++CL+++FGGFI
Sbjct: 49  DLDADQVGEADLGQIIQHSPGLSDTYN-INSE--QEQKKPT--LLIPALICLVISFGGFI 103

Query: 71  SGWDTGTIGGFLSHSDYINRFGSSHS--DGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRL 128
            GWD GTIGG ++  ++   FG+ +      KYL  ++ GL++SI N+G   G ++L +L
Sbjct: 104 FGWDVGTIGGVVNMEEFRETFGTRYDILTDRKYLPTLQLGLMISIVNIGAMFGGLLLPKL 163

Query: 129 GDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEIS 188
           G + GR+ GI+I+  IY+ GI+ Q+ + D W+Q+F+GR I G+G G++ VL PM ISEI+
Sbjct: 164 GVSRGRKLGILISTMIYMAGILAQLINCDAWFQFFVGRAICGMGIGSLTVLVPMFISEIA 223

Query: 189 PKHLRGTLVSCYQLMITFGMFLGYCTNYGT--KTYDNSIQWRVPLGLCFAWALVMIGAMF 246
           P  +RG++V+ YQLMITFG+ +G  TNY        N  +W++P+GL   WA +++  + 
Sbjct: 224 PLQIRGSMVALYQLMITFGILVGNLTNYAVIRNVKYNGDEWKIPIGLGILWASILLLGLN 283

Query: 247 IVPES-PRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS- 304
           +VPES P  ++++  IE AK S AK N ++ +     + +E  Q++ EA +         
Sbjct: 284 MVPESAPFLIIKRADIEGAKESFAKMNNISPNAHMVAEFVE--QMSTEAFKNNELLKQKK 341

Query: 305 ----ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGI 360
               E    K ++  R L+G++++  QQL+G NYFFYY T +F  +G++DS+ TSLI   
Sbjct: 342 EIPFEFINGKPRLGLRLLIGIMIMVFQQLSGINYFFYYSTSLFANIGIQDSYITSLILST 401

Query: 361 VNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNT 420
           VNF +TF  + +V+++GR+ CLL G+ GM  CM+++ASV        G    S+  +G  
Sbjct: 402 VNFFTTFGGIILVERWGRKMCLLVGSVGMFFCMIIYASV--------GSFVSSNIKSGVI 453

Query: 421 MIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITG 480
           MIV +C +I  FA T  P+ FV++SE FP+R KA  MA+    N M NF I  FTP IT 
Sbjct: 454 MIVVTCIYIMFFAATTGPVSFVLVSELFPMRTKAISMAICNSMNWMVNFVISMFTPAITS 513

Query: 481 AINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEE 522
            I F YGYVF GCL+ S  +V   VPETK    ++++ ++E 
Sbjct: 514 KIGFKYGYVFAGCLLASIVFVITLVPETKNKNEQEIDKIYER 555

>Skud_8.155 Chr8
           complement(264872..264913,264917..265015,265033..265140,
           265195..265299,265412..265510,265514..265570,
           265574..266584) [1521 bp, 507 aa] {OFF} YHR094C (PSEUDO)
          Length = 507

 Score =  374 bits (959), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 188/325 (57%), Positives = 238/325 (73%), Gaps = 1/325 (0%)

Query: 4   SQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLM 63
           S S    D+ S  + +V++     E   D+   N+    +   P     AY+ V I C+M
Sbjct: 13  SNSSETYDLESGRSKAVNTPDGKNESFHDNLSENQTQPAV-SPPNTGKGAYVMVSICCVM 71

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGGFI GWDTGTI GF++  D++ RFG  H DGS YLSKVRTGL+VSIFN+GCAIG +
Sbjct: 72  VAFGGFIFGWDTGTISGFVAQKDFLKRFGMKHHDGSHYLSKVRTGLIVSIFNIGCAIGGI 131

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
           VL +LGD  GRR G+++ V IY +GI+IQIASIDKWYQYFIGRII+GLG G I VLSPML
Sbjct: 132 VLSKLGDMYGRRIGLIVVVVIYTIGIIIQIASIDKWYQYFIGRIISGLGVGGITVLSPML 191

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
           ISE++P  +RGTLVSCYQ+MIT G+FLGYCTN+GTK Y NS+QWRVPLGLCFAWA+ M+ 
Sbjct: 192 ISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWAIFMVA 251

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            M  VPESPRYL+E G+I+EA+ S+AK NK   D P    E+E ++ +VE  +AAG+ASW
Sbjct: 252 GMLFVPESPRYLIEAGRIDEARASLAKVNKCPPDHPFVQYELETIEASVEEMKAAGTASW 311

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQ 328
            ELF  K  +LQRT+MG+++ +LQ 
Sbjct: 312 GELFTGKPAMLQRTMMGIMIQSLQN 336

>NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {ON}
           Anc_3.23
          Length = 530

 Score =  373 bits (958), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 196/496 (39%), Positives = 296/496 (59%), Gaps = 19/496 (3%)

Query: 37  NEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHS 96
           NE D + +  P+K  S  L   ++C+ +AF GF  GWD GTIGG  S   + NRFG+S+ 
Sbjct: 38  NEQDGRYVNKPEK--SHLLIPILICIAIAFAGFTLGWDIGTIGGMTSMESFQNRFGTSYD 95

Query: 97  D--GSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIA 154
              G +Y   +  GL++SIFN+GCA+GSV L +L D  GR+ G+ + V IY++G++IQI 
Sbjct: 96  SQRGVQYFPDLLLGLIISIFNIGCAVGSVTLAKLADWFGRKTGLYVTVIIYVIGLLIQII 155

Query: 155 SIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCT 214
           +   W Q+FIGRI+ G   G+  V++PM ++E++P  +RG ++  YQ+M+TFG+ +G   
Sbjct: 156 NDRTWIQFFIGRIVCGFAIGSSNVVAPMFLAEVAPVRIRGGIIVFYQIMLTFGILMGNIV 215

Query: 215 NYGTKTY----DNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYL-VEKGQIEEAKRSVA 269
           NY         + +  W+ PLGL FAWA +M+G ++  PE   YL ++KG+I+ AK S A
Sbjct: 216 NYACHQSFPGPNQNEAWKTPLGLGFAWACIMMGGIWCSPEPAPYLALKKGRIDSAKESFA 275

Query: 270 KSNKVTIDDPATIQEIELVQIAVEAE--QAAGSASWSELFQTKTKVLQRTLMGVIVLALQ 327
             N V+ D   T + IE +   ++ E         W E  + + ++  R  +G I++A Q
Sbjct: 276 MMNGVSKDSKLTDEFIEDMNQKMKEEIILKKQPRKWFEFVRGEPRLGYRVFIGTILMASQ 335

Query: 328 QLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAA 387
           QL+G NYFFYYG  +FK  GL D +  +++  IVNF  TF  +Y+V++ GR+ CL++G+ 
Sbjct: 336 QLSGINYFFYYGVTLFKNAGLNDPYVAAIVMSIVNFVGTFGGIYLVERVGRKLCLVYGSF 395

Query: 388 GMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISES 447
           GM CCM+V++++G   L        +  G    MIV +C +I  FATT  P+  V+++E 
Sbjct: 396 GMFCCMIVYSTIGSFAL--------NLPGTNIGMIVVACIYIAFFATTLGPVTVVLVAEL 447

Query: 448 FPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPE 507
           FPLR KA  MA  + +N + NF I F +P I   I F YGYVF  CL FS  +    VPE
Sbjct: 448 FPLRTKAISMATCSDANWLANFAISFTSPLIISQIGFRYGYVFAACLFFSTIFSVTNVPE 507

Query: 508 TKGLQLEDVNLMWEEG 523
           TK     +++ M+ +G
Sbjct: 508 TKDKTTSEIDDMFIKG 523

>Smik_78.1 Chr78 complement(3..839) [837 bp, 279 aa] {ON} YEL069C
           (REAL)
          Length = 279

 Score =  363 bits (932), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 165/272 (60%), Positives = 215/272 (79%)

Query: 270 KSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQL 329
           K NKV+ +DP   +++E + + V A++  G ASW ELF  KTKVLQR + G++V    QL
Sbjct: 1   KINKVSPEDPWVQRQVEEINVGVLAQKELGEASWKELFSIKTKVLQRLITGILVQTFLQL 60

Query: 330 TGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGM 389
           TG NYFF+YGT IFK+VGL D F+TS++ G VNF ST +A+ VVDK GRR CLL+GAAGM
Sbjct: 61  TGENYFFFYGTTIFKSVGLTDGFETSIVLGTVNFFSTIIAVMVVDKIGRRKCLLFGAAGM 120

Query: 390 VCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFP 449
           + CMV+FAS+GV  L+P+GQD PSSKGAGN MIVF+CF+IFCFATTWAP+ +++++ESFP
Sbjct: 121 MACMVIFASIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFP 180

Query: 450 LRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETK 509
            +VK++ M++ T  N +W F IGFFTPFITG+I+FYYGYVF+GCLV  + Y+F F+PET 
Sbjct: 181 SKVKSRAMSISTAFNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYIFFFLPETI 240

Query: 510 GLQLEDVNLMWEEGVLPWKSASWVPPSQRGTD 541
           GL LE++ L++EEGV PWKS SWVPPS+RG  
Sbjct: 241 GLSLEEIQLLYEEGVKPWKSTSWVPPSRRGVH 272

>AFR602W Chr6 (1523461..1525137) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YNL318C (HXT14),
           YHR096C (HXT5) and YMR011W (HXT2)
          Length = 558

 Score =  372 bits (956), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 194/480 (40%), Positives = 289/480 (60%), Gaps = 11/480 (2%)

Query: 50  PASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHS--DGSKYLSKVRT 107
           P  + +   + CL VAF G I GWD GTIGG  +   + N  G   +   G         
Sbjct: 80  PEGSLVRPVLYCLSVAFCGIIFGWDLGTIGGISTMPSFQNTLGPRFNGDTGLHEFPGRLL 139

Query: 108 GLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRI 167
           GLL+ IFN+GCAIG + + RLGD  GR+  I+ ++ +Y VG+ +Q+ S   WY+YFIGR+
Sbjct: 140 GLLIGIFNIGCAIGGLTIARLGDIKGRKIAILTSLLVYAVGMFVQLGSGHFWYRYFIGRL 199

Query: 168 IAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTK--TYD--N 223
           IAGL  G   VL PM +SE++P  +RG ++  YQ++I  G+ LG   NY  K   +D  +
Sbjct: 200 IAGLAVGATMVLVPMFLSELAPVRIRGAMIVLYQVVICLGIALGSIVNYACKELVHDTLS 259

Query: 224 SIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQ 283
           ++ W+VP+     + +++  A+ I PES  +L  KG +E+AKRS A  N ++ D P   +
Sbjct: 260 NMTWKVPIFFQIGFTVLLSLALLITPESAEFLAMKGHLEKAKRSFAVMNGLSKDHPFVEE 319

Query: 284 EI-ELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTII 342
            +   VQ++++++    S    E  +   ++  R  +GV V+ALQ L+G NYFFYYGT +
Sbjct: 320 RVASFVQVSMKSDDIEHSGDRWEFIRGNPRLGLRLFIGVTVMALQMLSGVNYFFYYGTTL 379

Query: 343 FKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVT 402
           F+ VG+ED++ TS+I G V+   TF+ +Y+V++ GR+ CLL GA GM  CM V+A +G  
Sbjct: 380 FRFVGIEDAYVTSIIIGCVDLLGTFIGVYIVERLGRKICLLSGATGMFICMTVYACLGSF 439

Query: 403 KLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTV 462
            L    +D  ++K  G  MI F+C F+  FA T  P+  V++SE FP+R K   MA+ T 
Sbjct: 440 AL----KDDSNNKTVGAVMIFFTCVFVMFFAATSGPVSMVVMSEIFPIRTKVMSMAICTS 495

Query: 463 SNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEE 522
            N + NF I F TP +T AIN+ +G+VF GCL+FS  +    VPETKGL  E V+ ++E+
Sbjct: 496 VNWLVNFLIAFVTPDVTDAINYRFGFVFSGCLLFSIVFFIYLVPETKGLTHEQVDAIYEK 555

>Kwal_55.20068 s55 (236586..237389) [804 bp, 267 aa] {ON} YDR345C
           (HXT3) - Low-affinity glucose transporter [contig 155]
           FULL
          Length = 267

 Score =  361 bits (926), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 167/264 (63%), Positives = 214/264 (81%), Gaps = 4/264 (1%)

Query: 298 AGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLI 357
           AG ASW+EL   K ++L+RT+ G+++++LQQLTG NYFFYYGT IF AVGL+DSFQTS+I
Sbjct: 2   AGKASWAELITGKPQMLKRTINGIMIMSLQQLTGDNYFFYYGTTIFNAVGLKDSFQTSII 61

Query: 358 FGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP--SSK 415
            GIVNF ST ++LY VDK+GRR CL++GA GM+ C  V+ASVGVT+L+P+G +    +SK
Sbjct: 62  LGIVNFVSTSLSLYTVDKFGRRNCLIYGAIGMIACYTVYASVGVTRLYPDGANHKDVTSK 121

Query: 416 GAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFT 475
           GAGN +I F+CF+IFCFATTWAPI +V+ISE++PLRVK + M+L + +N +W F I FFT
Sbjct: 122 GAGNVLICFACFYIFCFATTWAPIAYVLISETYPLRVKGRAMSLASAANWLWGFLISFFT 181

Query: 476 PFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPP 535
           PFIT AINFYYGYVF+GC+VF+  YVF  +PETKGL LE+VN M+ EGVLPWKSA+WVP 
Sbjct: 182 PFITSAINFYYGYVFMGCMVFAVFYVFFLIPETKGLTLEEVNEMYAEGVLPWKSANWVPA 241

Query: 536 SQRGTDYNAEALATDDK--PIYKR 557
           S+RG DY+A+AL  +D   P YKR
Sbjct: 242 SRRGADYDADALNHEDMSLPWYKR 265

>Skud_8.156 Chr8
           complement(264872..264913,264917..265015,265033..265140,
           265195..265299,265412..265510,265514..265570,
           265574..266464) [1401 bp, 467 aa] {OFF} YHR094C (PSEUDO)
          Length = 467

 Score =  368 bits (944), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 180/282 (63%), Positives = 222/282 (78%)

Query: 47  PKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVR 106
           P     AY+ V I C+MVAFGGFI GWDTGTI GF++  D++ RFG  H DGS YLSKVR
Sbjct: 15  PNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQKDFLKRFGMKHHDGSHYLSKVR 74

Query: 107 TGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGR 166
           TGL+VSIFN+GCAIG +VL +LGD  GRR G+++ V IY +GI+IQIASIDKWYQYFIGR
Sbjct: 75  TGLIVSIFNIGCAIGGIVLSKLGDMYGRRIGLIVVVVIYTIGIIIQIASIDKWYQYFIGR 134

Query: 167 IIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQ 226
           II+GLG G I VLSPMLISE++P  +RGTLVSCYQ+MIT G+FLGYCTN+GTK Y NS+Q
Sbjct: 135 IISGLGVGGITVLSPMLISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQ 194

Query: 227 WRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIE 286
           WRVPLGLCFAWA+ M+  M  VPESPRYL+E G+I+EA+ S+AK NK   D P    E+E
Sbjct: 195 WRVPLGLCFAWAIFMVAGMLFVPESPRYLIEAGRIDEARASLAKVNKCPPDHPFVQYELE 254

Query: 287 LVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQ 328
            ++ +VE  +AAG+ASW ELF  K  +LQRT+MG+++ +LQ 
Sbjct: 255 TIEASVEEMKAAGTASWGELFTGKPAMLQRTMMGIMIQSLQN 296

>Suva_59.1 Chr59 (1..825) [825 bp, 274 aa] {ON} YFL011W (REAL)
          Length = 274

 Score =  360 bits (925), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 172/257 (66%), Positives = 213/257 (82%)

Query: 282 IQEIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTI 341
           I E++ +   +EAE+AAG+ASWSELF  K  +L R +MGV++ +LQQLTGCNYFFYYGT 
Sbjct: 2   ISEVDAIVANMEAERAAGNASWSELFSNKGAILPRVIMGVVIQSLQQLTGCNYFFYYGTT 61

Query: 342 IFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGV 401
           IF AVG+EDSF+TS++ G+VNFASTFVALY+VDK+GRR CLLWG+A M  C V+FASVGV
Sbjct: 62  IFNAVGMEDSFETSIVLGVVNFASTFVALYIVDKFGRRKCLLWGSASMAICFVIFASVGV 121

Query: 402 TKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGT 461
           T+LWP+G+DQPSS+ AGN MIVF+CFFIFCFA TWAPI +VI++ES+PLRVK + MA+  
Sbjct: 122 TRLWPHGKDQPSSQSAGNVMIVFTCFFIFCFAITWAPIAYVIVAESYPLRVKNRAMAIAV 181

Query: 462 VSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWE 521
            +N MW F IGFFTPFIT AI+F YGYVF+GCL+FSY YVF FV ETKGL LE+VN M+E
Sbjct: 182 GANWMWGFLIGFFTPFITRAISFSYGYVFMGCLIFSYFYVFFFVCETKGLTLEEVNEMYE 241

Query: 522 EGVLPWKSASWVPPSQR 538
           E + PWKS  W+P ++R
Sbjct: 242 ERIKPWKSGGWIPSAKR 258

>Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}
           similar to Ashbya gossypii AFR602W
          Length = 530

 Score =  363 bits (932), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 199/530 (37%), Positives = 317/530 (59%), Gaps = 22/530 (4%)

Query: 2   DYSQSPTGE----DVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSV 57
           D ++  +G     DV  +    V +S + + +++       +DS ++    KP       
Sbjct: 3   DKAEKASGSSYLYDVEKADVNGVIASSTDKSVEQLVTVVPVMDSPVMGSLAKPV------ 56

Query: 58  CIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSH--SDGSKYLSKVRTGLLVSIFN 115
            + C+++AFGGFI GWD GTIGG ++   + N FG+ +  S G      +  GL++ IFN
Sbjct: 57  -LFCMVIAFGGFILGWDIGTIGGLMNMPSFKNHFGTRYNASTGLNEFPNLLLGLIIGIFN 115

Query: 116 VGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGT 175
           V CA+G + L ++GD  GR+ GI +++ +Y+ G+VI++A    W Q+FIGRI  G+G G+
Sbjct: 116 VACALGGLTLAKVGDFKGRKVGIAVSLLVYVFGVVIELAKPTHWGQFFIGRIFTGVGVGS 175

Query: 176 IAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSI----QWRVPL 231
           + VL PM ++EISP  +RG++V  +QL IT G+ +G   NYG K     I     W+VP+
Sbjct: 176 LTVLVPMYVAEISPVRIRGSMVVLFQLNITVGVLVGNFVNYGCKKGFGDILSKKHWQVPI 235

Query: 232 GLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIA 291
            L   WA V++  + ++PES  YL  K +I+EA+RS A  N + +DDP    E+  +   
Sbjct: 236 ALGPMWAAVVLLGLVMIPESSHYLASKDKIKEAERSFAVMNALEVDDPIVFSEVAAMAAK 295

Query: 292 VEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDS 351
            +  +A G   + E    K ++  R L+G++ ++LQQL+G NYFFYYGT +F +VGL+DS
Sbjct: 296 TKELKANGEEGFWEFIAGKPRLGWRLLLGMVTMSLQQLSGVNYFFYYGTSLFNSVGLDDS 355

Query: 352 FQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKL-WPNGQD 410
           + T++I   VN  +TF+ +Y+V++ GR+ C + GAAGM   M+++A +G   L   NG +
Sbjct: 356 YVTAIIISAVNLVATFLGIYIVERLGRKACAIIGAAGMCFSMLLYACLGSFILDNSNGNN 415

Query: 411 QPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFC 470
           +P+    G  MI F+C ++  FA+T  P+ FVIISE +PLR +   MA+    N + NF 
Sbjct: 416 KPT----GAAMIAFTCIYMIFFASTSGPVAFVIISELYPLRTRNTSMAICNSMNCLSNFT 471

Query: 471 IGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMW 520
           I   TP I  AI + +G+VF+  LVFS  + + ++PETKGL + +V+ ++
Sbjct: 472 ITLLTPTIVSAIGYKFGFVFVFFLVFSVFFFYKYLPETKGLTVSEVDELY 521

>Kpol_1014.21 s1014 (34471..36069) [1599 bp, 532 aa] {ON}
           (34471..36069) [1599 nt, 533 aa]
          Length = 532

 Score =  358 bits (919), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 211/537 (39%), Positives = 314/537 (58%), Gaps = 43/537 (8%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
            + ++   G+V S +S     KD  + N+ +  ++  P    S+ L   ++C M++FGGF
Sbjct: 12  REENTEAYGTVVSCESVASSCKDKAEPND-EPIVVNGP----SSLLVPVLLCSMISFGGF 66

Query: 70  ISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
           I GWD GTIGG ++   +   FG S  DG    + +  GL+VSIFN+G AIG + L +LG
Sbjct: 67  IFGWDIGTIGGIVNMPSFQLNFGLS-VDGPSSDTWI-IGLVVSIFNIGSAIGGLTLAKLG 124

Query: 130 DTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISP 189
           D  GR+ G+  A+  Y +G+ IQ+ +   WYQ+FIGRI  GL  G+IAVL PM ISE +P
Sbjct: 125 DLFGRKAGLFTALGFYNIGLFIQLINDHNWYQFFIGRIFTGLAVGSIAVLVPMFISESAP 184

Query: 190 KHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSI------QWRVPLGLCFAWALVMIG 243
             +RG++V  YQLMIT G+ LG   NYG K  D SI       W+ PL L FAWA ++  
Sbjct: 185 LKIRGSMVCMYQLMITLGILLGNVVNYGCK--DMSIVQFQNKSWQTPLSLGFAWAWIIAI 242

Query: 244 AMFIVPESPRYLVE-KGQIEEAKRSVAKSNKVTIDDPATIQEI-------------ELVQ 289
            +  +PES ++L+  K  +  AK S AK N + I+D  T + I             E  +
Sbjct: 243 GLIFIPESSQFLLRIKNDVNAAKVSFAKMNGLQINDEMTDRYIYTQQNITDSFKTEEKNE 302

Query: 290 IAVEA------EQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIF 343
           IA+E+         + + +  E    + K+  R  +G++ +  QQL+G NY+FYYGT IF
Sbjct: 303 IAIESATDDSKNDTSKNRNLFEFISGEPKLGLRLFVGIMAMIFQQLSGINYYFYYGTSIF 362

Query: 344 KAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTK 403
           K+VGL+D + TS++   VNF +TF  +Y V+  GR++CLL G+ GM CCM++++SVG   
Sbjct: 363 KSVGLDDPYITSILLSSVNFFATFGGIYFVEAIGRKSCLLVGSLGMFCCMMIYSSVGGFV 422

Query: 404 LWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVS 463
                 + P++   G  +I+F+C +I  FATT  P+ +V++SE FPLR +A  MA+ T  
Sbjct: 423 -----ANTPTT---GAVLIIFTCVYICFFATTLGPVTYVLVSELFPLRTRAISMAVCTSF 474

Query: 464 NQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMW 520
           N ++ F I  FTP I   I F +GYVF GCL+ S  +V+  VPETK    ++++ M+
Sbjct: 475 NWIFGFLISLFTPVIISKIGFLFGYVFAGCLLASAVFVWFLVPETKNKTEQEIDEMY 531

>ZYRO0C03168g Chr3 (243606..245273) [1668 bp, 555 aa] {ON} similar
           to uniprot|P42833 Saccharomyces cerevisiae YNL318C
          Length = 555

 Score =  357 bits (917), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 190/482 (39%), Positives = 286/482 (59%), Gaps = 16/482 (3%)

Query: 49  KPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS--SHSDGSKYLSKVR 106
           KP+   L    +C++++FGGFI GWD G IGG  +   +   FG   + + G  Y  ++ 
Sbjct: 80  KPSPFLLKSVALCVVISFGGFIVGWDIGIIGGITNMESFQENFGPLVNLNTGRHYFPEIL 139

Query: 107 TGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGR 166
            GL++SIF++G  IG + + + GD  GR+ G+ +++F+Y +G+ IQ+     W Q+FIGR
Sbjct: 140 VGLVISIFSIGGVIGGLTIAKAGDWKGRKLGMYLSMFVYCLGLAIQLVHDYSWSQFFIGR 199

Query: 167 IIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNY----GTKTYD 222
           I+ GL  G+ AVL PM +SE +P  +RG + + YQLM+TFG+ +G   NY    G     
Sbjct: 200 ILTGLAVGSTAVLVPMFLSESAPIAIRGAMTTLYQLMVTFGILMGNVLNYILRKGLADPL 259

Query: 223 NSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLV-EKGQIEEAKRSVAKSNKVTIDDPAT 281
           ++I W++P+ + + WA  ++  +F  PES  +L+ +KG +E AK S A  N +  DD  T
Sbjct: 260 DNISWQLPIYMGYVWAATIVTGLFFTPESANFLLTKKGCVESAKFSFATMNGIAEDDDLT 319

Query: 282 IQEIE-LVQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGT 340
            + +E  +Q   E E+ +      E    K K  +R L+G++V+  QQL+G NYFFYYGT
Sbjct: 320 NKFVEQTLQQQYETERQSNGLGLFEFVTGKPKYCKRLLVGILVMTFQQLSGINYFFYYGT 379

Query: 341 IIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVG 400
            +F+   L D + TS+    VNF STF  +Y+V+  GRR+CLL G+ GM  CM+V+A+VG
Sbjct: 380 TLFEKANLNDPYLTSIFLSSVNFVSTFGGIYLVEALGRRSCLLLGSMGMFICMLVYATVG 439

Query: 401 VTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALG 460
              L         + G+G  MI F+C +I  FATT  P+ FV++SE FP++ KA  MA+ 
Sbjct: 440 TFAL--------DASGSGIVMIAFTCIYIVFFATTLGPVSFVVVSELFPMKTKAVSMAIC 491

Query: 461 TVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMW 520
           +  N M+ F I   TP IT  I F YGY F  CL+ S  +V+  VPETKG    D++ ++
Sbjct: 492 SSFNWMFGFMISLLTPVITAKIGFAYGYFFTACLLLSAIFVWIMVPETKGKSESDIDSLY 551

Query: 521 EE 522
           E 
Sbjct: 552 EN 553

>Suva_37.1 Chr37 complement(3..797) [795 bp, 265 aa] {ON} YFL011W
           (REAL)
          Length = 265

 Score =  346 bits (887), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 200/255 (78%), Gaps = 3/255 (1%)

Query: 19  SVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTI 78
            + +S S +E  K + +  E+     +IP KP  AY +V  +CLM+AFGGFI GWDTGTI
Sbjct: 14  KISTSPSGKEEVKRTPEVREVSP---DIPNKPIIAYWTVMGLCLMIAFGGFIFGWDTGTI 70

Query: 79  GGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGI 138
            GF++ +D+  RFG    DGS  LS VRTGL+V IFN+GCA+G + LGRLGD  GRR G+
Sbjct: 71  SGFINQTDFKRRFGEEQRDGSYQLSDVRTGLIVGIFNIGCAVGGLTLGRLGDICGRRIGL 130

Query: 139 VIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVS 198
           +  + +YIVGI+IQIASIDKWYQYFIGRI++G+G G +AVLSP LISEISPKHLRGT +S
Sbjct: 131 MCVILVYIVGIIIQIASIDKWYQYFIGRIVSGMGVGGVAVLSPTLISEISPKHLRGTCIS 190

Query: 199 CYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEK 258
            YQLMIT G+FLGYCTNYGTK Y NSIQWRVPLGLCFAWA+ M+  M +VPESPR+LVEK
Sbjct: 191 FYQLMITLGIFLGYCTNYGTKKYSNSIQWRVPLGLCFAWAIFMVVGMVMVPESPRFLVEK 250

Query: 259 GQIEEAKRSVAKSNK 273
           G+ EEA+RS+AKSNK
Sbjct: 251 GRYEEARRSLAKSNK 265

>NCAS0E01350 Chr5 complement(261125..262696) [1572 bp, 523 aa] {ON}
           Anc_3.23
          Length = 523

 Score =  353 bits (906), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/523 (37%), Positives = 306/523 (58%), Gaps = 20/523 (3%)

Query: 10  EDVHSSTAGSVHSSQSFQEMK-KDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGG 68
            + H+++  S  S  S QE+    ++  N  + + I    K   + ++  ++CL ++FGG
Sbjct: 10  SNEHTTSITSTMSRSSSQEVPIALTKKRNLGNEETILQENKKNPSLITPMLICLAISFGG 69

Query: 69  FISGWDTGTIGGFLSHSDYINRFGSSHSDG--SKYLSKVRTGLLVSIFNVGCAIGSVVLG 126
           F+ GWD GTIGG  + S +  RFG+    G  +K+   +  GL++ IFN+   +G V L 
Sbjct: 70  FLFGWDIGTIGGIANMSSFKERFGTRQDQGKGTKHFPGLLIGLIIGIFNLSAGVGGVALA 129

Query: 127 RLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISE 186
           + GD  GR++     +FIY +G+++Q+     W+Q FIGR+I GL  G I V+ PM ISE
Sbjct: 130 KCGDWWGRKRATYFFIFIYSIGLLVQLIHNRAWFQIFIGRLICGLAIGGINVIVPMFISE 189

Query: 187 ISPKHLRGTLVSCYQLMITFGMFLG-----YCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           I+P  +RG++V+ YQL ITFG+ +G      C N  ++++ N   W++PLGL F WA ++
Sbjct: 190 IAPLRVRGSMVTFYQLKITFGILVGNITVFLCHNGFSRSHQNE-AWQIPLGLGFVWAFIV 248

Query: 242 IGAMFIVPESPRYL-VEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGS 300
           I  ++  PES +YL ++K + + A  S A+ N ++  D   I  +E +Q   E ++   S
Sbjct: 249 ILGLYNSPESAQYLGIKKERWDAALMSTARMNNLSTGDIRAINIVEEMQRRAEQDRLEKS 308

Query: 301 ASWS--ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIF 358
           +  +  E    K K+  R  +G++++  QQL+G NYFFYYGT IF  VGL D + T++I 
Sbjct: 309 SRRNIFEFIFGKPKLGLRLFIGIMLMIFQQLSGINYFFYYGTTIFAKVGLNDPYTTAIIL 368

Query: 359 GIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAG 418
             VNF +TF  +Y V+   RRT L++G+ GM CCM++++S+G   L        ++ G G
Sbjct: 369 SSVNFVATFFGIYFVEALRRRTSLVFGSIGMFCCMMIYSSMGSFAL--------NTDGTG 420

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
            TMIV +C +I  FA T  P+  V++SE +P+R KA  MA  + +N + NF I F TP I
Sbjct: 421 ITMIVVTCVYIALFAITLGPVTIVLVSELYPMRTKAMSMATCSFANWIMNFLITFLTPLI 480

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWE 521
           T  I F YGYVF  CL FS C+ +  VPETK     +++ M+ 
Sbjct: 481 TAQIGFKYGYVFAVCLFFSTCFDWTTVPETKNKTPTEIDNMFS 523

>Smik_14.13 Chr14 complement(23204..24826) [1623 bp, 540 aa] {ON}
           YNL318C (REAL)
          Length = 540

 Score =  353 bits (907), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 194/517 (37%), Positives = 308/517 (59%), Gaps = 40/517 (7%)

Query: 27  QEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSD 86
           +E K++SQ  N   +  + IP           ++CL+++ GGFI GWD GTIGG  +   
Sbjct: 40  KEEKEESQATNSSHNSSLHIP----------ILLCLVISLGGFIFGWDIGTIGGMTNMVS 89

Query: 87  YINRFGSS----HSD----GSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGI 138
           +  +FG++    H +     +K L+ ++ GL++SIFN+ C +G++ L ++GD VGR+ GI
Sbjct: 90  FQEKFGTTDITNHDETILISTKQLTDLQIGLIISIFNISCGVGALTLSKIGDWVGRKAGI 149

Query: 139 VIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVS 198
             A+ +Y +G+ IQI S  KWY   +GR + G+G G   VL PM +SE SP  +RG++VS
Sbjct: 150 WFALVVYCIGLTIQILSCGKWYFLTLGRAVTGIGVGISTVLVPMFLSENSPLKIRGSMVS 209

Query: 199 CYQLMITFGMFLGYCTNY-GTKTYDNSIQ---WRVPLGLCFAWALVMIGAMFIVPESPRY 254
            YQL++T G+ +G   N+   + Y +  Q   W++PL L + WA+V+  ++  VPES +Y
Sbjct: 210 MYQLIVTLGILMGNILNFICERCYKDPTQNLAWKLPLFLGYIWAIVIGMSLVYVPESAQY 269

Query: 255 LVE-KGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS--------- 304
           L + K  +  AKRS A+ N + I D   I+ I+ +      ++ +G+ S +         
Sbjct: 270 LAKIKNDVPSAKRSFARMNGIPITDSTVIEFIDDLMENNYNKEESGNESKNKTLIKRKAF 329

Query: 305 ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFA 364
           E    K K+  R ++G++++A QQL+G NYFFYYGT +FK VG++D + TS+I   VNF 
Sbjct: 330 EFMMGKPKLWLRLVIGMLIMAFQQLSGINYFFYYGTSVFKGVGIKDPYITSIILSSVNFL 389

Query: 365 STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVF 424
           ST + +Y V+K+GR+TCLL+G+  ++  M+ +A+VG       G++   S      +I+ 
Sbjct: 390 STILGIYYVEKWGRKTCLLYGSTNLLFYMMTYATVGTF-----GRETDFSNIV---LIIV 441

Query: 425 SCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINF 484
           +C FIF FA T  P+ FV++SE FPLR +A  MA+ T  N M+NF I F TP I   I+F
Sbjct: 442 TCCFIFWFAITLGPVTFVLVSELFPLRTRAISMAICTFVNWMFNFLISFLTPMIVSKIDF 501

Query: 485 YYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWE 521
             GY+F  CL+    + +  VPET+    +++N ++E
Sbjct: 502 KLGYIFAACLLALIIFSWILVPETRKKNEQEINKIFE 538

>KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weakly
           similar to uniprot|P42833 Saccharomyces cerevisiae
           YNL318C, HXT14 protein with similarity to hexose
           transporter family members, expression is induced in low
           glucose and repressed in high glucose; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studie
          Length = 528

 Score =  348 bits (894), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/495 (39%), Positives = 288/495 (58%), Gaps = 21/495 (4%)

Query: 37  NEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSS-- 94
           N+  S  IE  K P    L   ++CL  +F GFI GWD GTIGG  +   + N FG++  
Sbjct: 41  NDTKSGGIEQKKLP----LKPILLCLATSFAGFIFGWDVGTIGGITNMVSFQNFFGTNFD 96

Query: 95  HSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIA 154
            S  + Y  K+  GL+VSIFN+ CA+G + L ++ D  GR+ GI  A+ IY +G +I   
Sbjct: 97  SSSNTHYFPKLLIGLIVSIFNISCALGGLFLVKIADINGRKPGIYAAITIYSLGTLIGWT 156

Query: 155 SIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCT 214
               W+ +F  R I+GLG G  AV+ PM I+E +P ++RG +V  YQLMIT G+ LG   
Sbjct: 157 CGSSWWYFFFARFISGLGVGATAVMIPMFIAESAPINIRGAMVVLYQLMITLGILLGNVI 216

Query: 215 NYGTKT----YDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEK-GQIEEAKRSVA 269
           NY  ++     DN+  W++P+GL   WA ++   +  +PESP +L ++ G   +AK + A
Sbjct: 217 NYCCRSTLHETDNA-TWKIPVGLGNVWAAIVALGVHFMPESPVFLTKRLGSALKAKAAFA 275

Query: 270 KSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQ---TKTKVLQRTLMGVIVLAL 326
             N + +DDP     I  +  + +AE +  +   +  F+    + ++  R  +G++V+A 
Sbjct: 276 HMNNLDVDDPIVDSHIRKMMESADAEVSTHNDMKNSRFEFILGQPRLGFRLFIGIMVMAF 335

Query: 327 QQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGA 386
           QQL+G NYFFYYGT +F +VG+ED + TS++   VNF STF  +Y+V+K GR+ CL+ G+
Sbjct: 336 QQLSGANYFFYYGTTLFNSVGIEDPYLTSILLSSVNFISTFFGIYLVEKLGRKACLILGS 395

Query: 387 AGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISE 446
           AGM  CM V+ASVG   L        S + +G  M+ F+C +I  FA T  P+ FV+ISE
Sbjct: 396 AGMFTCMSVYASVGSFAL------NKSPQNSGAIMVTFTCVYIMFFACTSGPVSFVVISE 449

Query: 447 SFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVP 506
            FP R KA  MA+ T  N + NF I   TP++T  I F +G+VF GCL  S+ +    + 
Sbjct: 450 LFPSRTKAISMAVCTSINWLCNFFISLCTPYVTDKIGFKFGFVFAGCLFVSFWFFTFLLK 509

Query: 507 ETKGLQLEDVNLMWE 521
           ETK    E V+ ++ 
Sbjct: 510 ETKNKTPEQVDALYS 524

>KLTH0H13376g Chr8 complement(1167211..1168833) [1623 bp, 540 aa]
           {ON} similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011W HXT2 High-affinity glucose transporter of the
           major facilitator superfamily expression is induced by
           low levels of glucose and repressed by high levels of
           glucose
          Length = 540

 Score =  348 bits (894), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 185/485 (38%), Positives = 296/485 (61%), Gaps = 22/485 (4%)

Query: 56  SVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHSDGSKYLSKVRTGLLVSIF 114
            V + C  ++F GF  G+DTGT+GG  +   ++ RFG    S G  ++S    GL+VS F
Sbjct: 55  DVILACYGISFTGFFFGYDTGTVGGITNMQPWLRRFGHFDASSGEYHMSTALIGLVVSAF 114

Query: 115 NVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQI-ASIDKWYQYFIGRIIAGLGS 173
           ++GC  G   + RL D +GRR  I I   +Y++G+ IQ+ A   KWYQY IGR++ GL  
Sbjct: 115 HIGCITGGFTIARLADYIGRRAPIAIGCAVYMLGLAIQMSAGQGKWYQYMIGRMVTGLTV 174

Query: 174 GTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKT-YDNSIQWRVPLG 232
           G  AVL+PML+SEI+P  +RG +V+ YQ+ IT G+ +GY  ++ TK  Y +   WR+PL 
Sbjct: 175 GANAVLTPMLLSEIAPPGIRGAIVNFYQINITHGILIGYVVDFATKNHYKDDKMWRLPLI 234

Query: 233 LCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTID----DPATIQEIELV 288
             F ++++++  +   PESPR+L+++G+ ++A++  A+   + +     + A  Q+ +++
Sbjct: 235 GGFVFSVIILPMLASAPESPRFLIKRGRFDDARKVFARLRGINLKQVEGNMANSQQAQIL 294

Query: 289 QIAVEA-----------EQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFY 337
            +  E            EQ   + S+ +LF    + L+RTL G+ ++A QQ++G +YF Y
Sbjct: 295 DVINEELQYLKENYHYQEQRQRNTSFWQLF--SKRFLKRTLSGMCIMAFQQMSGIDYFLY 352

Query: 338 YGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFA 397
           YGT +FK+VG+EDS++TS+I G +N + T+V+++V D  GR+  L  G+     C+  F+
Sbjct: 353 YGTKLFKSVGIEDSYKTSIILGAINASMTYVSMFVADNLGRKKGLFLGSLCCFVCLFTFS 412

Query: 398 SVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGM 457
           +VGVT +  N  D P+ K +G  MIVF+C FI  F  +W+ I  V++SE F L +K++ M
Sbjct: 413 TVGVTTI-DNASD-PNYKLSGYIMIVFTCLFIVFFCCSWSAIAPVLVSEIFTLEIKSQAM 470

Query: 458 ALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVN 517
           AL    N   NF I   TP IT  I + +GYVF G +  +  +V+ F+PETKGL LE+++
Sbjct: 471 ALSQAFNWGANFFIALCTPIITARIGYAFGYVFTGFMFIAVPFVYFFIPETKGLTLEEID 530

Query: 518 LMWEE 522
             +E+
Sbjct: 531 DYYEK 535

>Skud_14.21 Chr14 complement(32206..33831) [1626 bp, 541 aa] {ON}
           YNL318C (REAL)
          Length = 541

 Score =  343 bits (881), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/536 (35%), Positives = 308/536 (57%), Gaps = 38/536 (7%)

Query: 9   GEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGG 68
             ++ S +    + +  + ++K++S++ +   S   +    P        ++CL++A GG
Sbjct: 19  NNELDSDSGRDYNVTIKYLDVKEESEEGHTTKSNHNDSLHIP-------ILLCLIIALGG 71

Query: 69  FISGWDTGTIGGFLSHSDYINRFGSSH--SDG------SKYLSKVRTGLLVSIFNVGCAI 120
           FI GWD GTIGG  +   +  RFG++    DG      +K L+ ++ GL++SIFN+ C +
Sbjct: 72  FIFGWDIGTIGGMTNMISFQQRFGTTDVIRDGDTVFISTKQLTDLQVGLIISIFNISCGV 131

Query: 121 GSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLS 180
           G++ L ++GD  GR+ GI  A+ +Y +GI IQI S  KWY   +GR + G+G G   VL 
Sbjct: 132 GALTLSKIGDWTGRKSGIWFALVVYCIGITIQIVSCGKWYFLALGRAVTGIGVGITTVLV 191

Query: 181 PMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTY----DNSIQWRVPLGLCFA 236
           PM +SE SP  +RG++VS YQL++T G+ +G   N+  + +      +I W++PL L + 
Sbjct: 192 PMFLSENSPLKIRGSMVSMYQLIVTLGILMGNILNFICERFYKDPTQNIAWQLPLFLGYI 251

Query: 237 WALVMIGAMFIVPESPRYLVE-KGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAE 295
           WA ++  ++  VPES +YL + K  +  AK S AK N V + D    + I+ +      E
Sbjct: 252 WATIIGMSLVYVPESAQYLAKIKNDVPSAKSSFAKMNGVPVTDSTITEFIDDLMENDYNE 311

Query: 296 QAAGSASWS----------ELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKA 345
           +   + S            E    K K+  R ++G++++A QQL+G NYFFYYGT +FK 
Sbjct: 312 EETNAKSKKMQSFVKRPTLEFIVGKPKLWLRLIIGMMIMAFQQLSGINYFFYYGTSVFKG 371

Query: 346 VGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLW 405
           VG++D + TS+I   VNF ST + +Y V+K+GR+TCLL+G+  ++  M+ +A+VG     
Sbjct: 372 VGIKDPYITSMILSGVNFLSTILGIYYVEKWGRKTCLLYGSTNLLFYMMTYATVGTF--- 428

Query: 406 PNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQ 465
             G++   S      +I+ +C FIF FA T  P+ FV++SE FPLR +A  MA+ T  N 
Sbjct: 429 --GRETDFSNIV---LIIVTCCFIFWFAITLGPVTFVLVSELFPLRTRAISMAICTFVNW 483

Query: 466 MWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWE 521
           M+NF I F TP +   I+F  GY+F  CL+    + +  VPET+    +++N ++E
Sbjct: 484 MFNFLISFLTPMVVSKIDFKLGYIFAACLLALIIFSWILVPETRKKNEQEINKIFE 539

>YNL318C Chr14 complement(38707..40329) [1623 bp, 540 aa] {ON}
           HXT14Protein with similarity to hexose transporter
           family members, expression is induced in low glucose and
           repressed in high glucose; the authentic, non-tagged
           protein is detected in highly purified mitochondria in
           high-throughput studies
          Length = 540

 Score =  343 bits (881), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/512 (37%), Positives = 303/512 (59%), Gaps = 33/512 (6%)

Query: 32  DSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRF 91
           D ++ N I+ Q  +I    AS ++ V ++CL+++ GGFI GWD GTIGG  +   +  +F
Sbjct: 38  DDKEEN-IEGQAAKISHN-ASLHIPV-LLCLVISLGGFIFGWDIGTIGGMTNMVSFQEKF 94

Query: 92  GSS---HSD-----GSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVF 143
           G++   H D      +K L+ ++ GL++SIFN+ C +G++ L ++GD +GR+ GI  A+ 
Sbjct: 95  GTTNIIHDDETIFVSTKKLTDLQIGLIISIFNISCGVGALTLSKIGDWIGRKGGIWFALV 154

Query: 144 IYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLM 203
           +Y +GI IQI S  +WY   +GR + G+G G   VL PM +SE SP  +RG++VS YQL+
Sbjct: 155 VYCIGITIQILSYGRWYFLTLGRAVTGIGVGVTTVLVPMFLSENSPLKIRGSMVSTYQLI 214

Query: 204 ITFGMFLGYCTNY----GTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVE-K 258
           +TFG+ +G   N+      K    +I W++PL L + WA+++  ++  VPESP+YL + K
Sbjct: 215 VTFGILMGNILNFICERCYKDPTQNIAWQLPLFLGYIWAIIIGMSLVYVPESPQYLAKIK 274

Query: 259 GQIEEAKRSVAKSNKVTIDDPATIQEIE---------LVQIAVEAEQAAGSASWSELFQT 309
             +  AK S A+ N +   D   I+ I+                 +Q+    +  E    
Sbjct: 275 NDVPSAKYSFARMNGIPATDSMVIEFIDDLLENNYNNEETNNESKKQSLVKRNTFEFIMG 334

Query: 310 KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVA 369
           K K+  R ++G++++A QQL+G NYFFYYGT +FK VG++D + TS+I   VNF ST + 
Sbjct: 335 KPKLWLRLIIGMMIMAFQQLSGINYFFYYGTSVFKGVGIKDPYITSIILSSVNFLSTILG 394

Query: 370 LYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFI 429
           +Y V+K+G +TCLL+G+  ++  M+ +A+VG       G++   S      +I+ +C FI
Sbjct: 395 IYYVEKWGHKTCLLYGSTNLLFYMMTYATVGTF-----GRETDFSN---IVLIIVTCCFI 446

Query: 430 FCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYV 489
           F FA T  P+ FV++SE FPLR +A  MA+ T  N M+NF I   TP I   I+F  GY+
Sbjct: 447 FWFAITLGPVTFVLVSELFPLRTRAISMAICTFINWMFNFLISLLTPMIVSKIDFKLGYI 506

Query: 490 FLGCLVFSYCYVFAFVPETKGLQLEDVNLMWE 521
           F  CL+    + +  VPET+    +++N ++E
Sbjct: 507 FAACLLALIIFSWILVPETRKKNEQEINKIFE 538

>SAKL0D10131g Chr4 complement(846993..848705) [1713 bp, 570 aa] {ON}
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011W HXT2 High-affinity glucose transporter of the
           major facilitator superfamily
          Length = 570

 Score =  342 bits (878), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/480 (38%), Positives = 288/480 (60%), Gaps = 23/480 (4%)

Query: 59  IMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKY-LSKVRTGLLVSIFNVG 117
           IMC  +AF G   G+DTGTIGG  +   ++ RFG  +    +Y +S    G++VS F+VG
Sbjct: 94  IMCFGIAFTGLFFGYDTGTIGGITNMQPWLKRFGYYNQSTLEYEMSTTIVGIIVSSFHVG 153

Query: 118 CAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIA 177
           C  G   + RL DT GRR  I IA  +Y +G+ +QIAS  +WYQ+ IGR+I GL  G  A
Sbjct: 154 CICGGFTIARLSDTFGRRTPIAIACVVYTIGLAVQIAS-KRWYQFMIGRVITGLTVGANA 212

Query: 178 VLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTK-TYDNSIQWRVPLGLCFA 236
           VL+PM +SEI+  ++RG +V+ YQ+ +T G+  GY  +Y  K  Y  S  WR+PL   F 
Sbjct: 213 VLAPMFLSEIAIPNIRGIIVNFYQIALTHGILFGYVADYAAKENYRGSKMWRLPLIGGFI 272

Query: 237 WALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAK---------SNKVTIDDPATIQEI-- 285
           ++L+++  +  VPESPRYL++KG+ EEAK+ +A+          ++   +D   + E+  
Sbjct: 273 FSLIILPMLIFVPESPRYLIQKGKFEEAKKCIARLKGKHRTILKSESEFEDATYVDEVNE 332

Query: 286 --ELVQIA--VEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTI 341
             E ++    ++  Q   +  W+ LF    + ++RT+ G+ ++  QQL+G +YF YYGT 
Sbjct: 333 EFEFLKAVYHLQEHQQRHTNFWA-LF--SKRFIKRTVSGMCIMGFQQLSGIDYFLYYGTK 389

Query: 342 IFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGV 401
           +F++VG++DS+ TS+I G +N A  +V++ V D  GR   L WG+ G   C+ +F+++GV
Sbjct: 390 LFESVGIDDSYITSIILGAINAAMAYVSILVADNVGRNRGLFWGSMGCFTCLFIFSTIGV 449

Query: 402 TKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGT 461
           T +   G +  ++K  G  MIVF+C F+  F+ +W+ I  V+ISE F + +K+K MA   
Sbjct: 450 TMIDHGGAN--NTKVPGIIMIVFTCLFLVLFSCSWSAIAPVLISEIFTMEIKSKAMAFSQ 507

Query: 462 VSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWE 521
             N   NF I   TP IT  I + +GYVF G +  +  +V   +PETKG+ LE+++  +E
Sbjct: 508 SFNWGANFFIALCTPIITARIGYGFGYVFAGSMFVAVIFVHFVIPETKGMTLEEIDDYYE 567

>Suva_9.197 Chr9 (326927..327796) [870 bp, 289 aa] {ON} YFL011W
           (REAL)
          Length = 289

 Score =  331 bits (848), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 197/259 (76%), Gaps = 3/259 (1%)

Query: 19  SVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTI 78
            + +S S +E  K + +  E+     +IP KP  AY +V  +CLM+AFGGFI GWDTGTI
Sbjct: 14  KISTSPSGKEEVKRTPEVREVSP---DIPNKPIIAYWTVMGLCLMIAFGGFIFGWDTGTI 70

Query: 79  GGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGI 138
            GF++ +D+  RFG    DGS  LS VRTGL+V IFN+GCA+G + LGRLGD  GRR G+
Sbjct: 71  SGFINQTDFKRRFGEEQRDGSYQLSDVRTGLIVGIFNIGCAVGGLTLGRLGDICGRRIGL 130

Query: 139 VIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVS 198
           +  + +YIVGI+IQIASIDKWYQYFIGRI++G+G G +AVLSP LISEISPKHLRGT +S
Sbjct: 131 MCVILVYIVGIIIQIASIDKWYQYFIGRIVSGMGVGGVAVLSPTLISEISPKHLRGTCIS 190

Query: 199 CYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEK 258
            YQLMIT G+FLGYCTNYGTK Y NSIQWRVPLGLCFAWA+ M+  M +VPESPR+LVEK
Sbjct: 191 FYQLMITLGIFLGYCTNYGTKKYSNSIQWRVPLGLCFAWAIFMVVGMVMVPESPRFLVEK 250

Query: 259 GQIEEAKRSVAKSNKVTID 277
           G+ EEA    +++ ++  D
Sbjct: 251 GRYEEAYFQRSRNGRLFRD 269

>Suva_14.21 Chr14 complement(34919..36544) [1626 bp, 541 aa] {ON}
           YNL318C (REAL)
          Length = 541

 Score =  338 bits (866), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/502 (38%), Positives = 299/502 (59%), Gaps = 32/502 (6%)

Query: 45  EIPKKPASAYLSVCIM-CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSH--SDG--- 98
           ++ K   +A L V I+ CL++A GGFI GWD GTIGG  +   +  RFG+     DG   
Sbjct: 47  QVTKGSHNASLHVPILLCLIIALGGFIFGWDIGTIGGMTNMISFQQRFGTIDIVDDGETV 106

Query: 99  ---SKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIAS 155
              +K L+ ++ GL++SIFN+ C +G++ L ++GD  GR+ GI  A+ +Y +GI +QI S
Sbjct: 107 FISTKRLNDLQIGLIISIFNISCGVGALTLSKMGDWTGRKAGIWFALVVYCIGITVQILS 166

Query: 156 IDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTN 215
             +WY   +GR + G+G G   VL PM +SE SP  +RG++VS YQL++TFG+ +G   N
Sbjct: 167 CGRWYFLTLGRAVTGVGVGITTVLVPMFLSENSPLKIRGSMVSMYQLVVTFGILMGNVLN 226

Query: 216 Y-GTKTYDN---SIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVE-KGQIEEAKRSVAK 270
           +   + Y +   +I W++PL L + WA+++  ++  VPES +YL + K  +  AK S AK
Sbjct: 227 FICVRCYKDPFQNISWQLPLFLGYIWAIIIGMSLVYVPESAQYLAKIKNDVPSAKSSFAK 286

Query: 271 SNKVTIDDPATIQEIELVQIAVEAEQAAGSASWS----------ELFQTKTKVLQRTLMG 320
            N V+  D    + I+ +     AE+ +   S            E    K K+  R ++G
Sbjct: 287 MNGVSETDSIVTEFIDDLMENNYAEEESNEESKKKKNFVKKQSFEFVLGKPKLWLRLVIG 346

Query: 321 VIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRT 380
           ++++A QQL+G NYFFYYGT +FK VG++D + TS+I   VNF ST + +Y V+K+GR+T
Sbjct: 347 MMIMAFQQLSGINYFFYYGTSVFKGVGIKDPYITSIILSSVNFLSTILGMYYVEKWGRKT 406

Query: 381 CLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIP 440
           CLL+G+  ++  M+ +A+VG       G++   S      +I+ +C FIF FA T  P+ 
Sbjct: 407 CLLYGSTNLLFYMMTYATVGTF-----GRETDFSN---IVLIIVTCCFIFWFAITLGPVT 458

Query: 441 FVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCY 500
           FV++SE FPLR +A  MA+ T  N M+NF I F TP I   I+F  GY+F  CL+    +
Sbjct: 459 FVLVSELFPLRTRAISMAICTFINWMFNFLISFLTPMIVSKIDFKLGYIFATCLLALIVF 518

Query: 501 VFAFVPETKGLQLEDVNLMWEE 522
            +  VPET+    ++VN ++E 
Sbjct: 519 SWILVPETRNKNEQEVNKIFES 540

>KNAG0C05230 Chr3 (1021075..1022211) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score =  324 bits (830), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 202/249 (81%), Gaps = 2/249 (0%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
           E   +S A +  +     ++K D  D N  D+QI +I KKPASAY++V IMC+M+AFGGF
Sbjct: 14  ESASNSLASTTSNKAERDDLKNDYNDEN-TDNQI-DIVKKPASAYVTVSIMCIMIAFGGF 71

Query: 70  ISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
           + GWDTGTI GF++ +D+I R G   ++G+ YLSKVRTGL+VSIFN+GCAIG ++L + G
Sbjct: 72  VFGWDTGTISGFVAQTDFIRRLGQRRANGTHYLSKVRTGLVVSIFNIGCAIGGIILSKSG 131

Query: 130 DTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISP 189
           D  GR+KG++I V IYIVGIVIQIA+I+KWYQYFIGRII+GLG G I+VLSPMLISE+SP
Sbjct: 132 DMYGRKKGLIIVVVIYIVGIVIQIATINKWYQYFIGRIISGLGVGGISVLSPMLISEVSP 191

Query: 190 KHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVP 249
           KHLRGTLVSC+QLMIT G+FLGYCTNYGTK Y NS QWRVPLGLCFAWAL MIG M  VP
Sbjct: 192 KHLRGTLVSCFQLMITLGIFLGYCTNYGTKKYSNSTQWRVPLGLCFAWALFMIGGMTFVP 251

Query: 250 ESPRYLVEK 258
           ESPRYL+EK
Sbjct: 252 ESPRYLLEK 260

 Score =  156 bits (395), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (80%)

Query: 452 VKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGL 511
           VK+K MA+    N +W F I FFTPFITGAINFYYGYVF+GCL FS+ YVF FVPETKGL
Sbjct: 268 VKSKCMAIAQGCNWLWGFLISFFTPFITGAINFYYGYVFMGCLCFSFFYVFFFVPETKGL 327

Query: 512 QLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMFSK 561
            LE+VN MWEEG LPWKS +WVPPSQR  DY+ +A+  DDKP+YKRMFS+
Sbjct: 328 SLEEVNTMWEEGTLPWKSPNWVPPSQRNADYDIDAMNHDDKPMYKRMFSR 377

>CAGL0M04103g Chr13 (452677..454272) [1596 bp, 531 aa] {ON} similar
           to uniprot|P42833 Saccharomyces cerevisiae YNL318c HXT1
           hexose transport protein
          Length = 531

 Score =  326 bits (835), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/532 (35%), Positives = 294/532 (55%), Gaps = 27/532 (5%)

Query: 5   QSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIE-IPKKPASAYLSVCIMCLM 63
            SPT     + T  +  + QSFQ   K   + N I  +  E +  K    +    ++C +
Sbjct: 13  SSPT----ENYTLNTAETRQSFQLSGKS--EVNTIPGEKYEELKMKYIRQHTKAVVLCCL 66

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHS--DGSKYLSKVRTGLLVSIFNVGCAIG 121
           ++FGG I GWD GT+GG      + N FG   +    +K LS ++ GL +SIFN+GCA+G
Sbjct: 67  ISFGGMILGWDIGTVGGVSIMPSFNNAFGDQTTIVSSAKELSNMKRGLYISIFNIGCALG 126

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
            ++  RL +TVGRR GI+ A+  Y + + +Q+ S   +      R + G+  G I+VL P
Sbjct: 127 GIMFSRLSNTVGRRVGILTAIAKYTLVLTVQLFSNGNFILLLASRFVLGVTVGAISVLVP 186

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTY------DNSIQWRVPLGLCF 235
           M +SE +P  +RG LV  YQL IT G+  G   NY T  +       N++ W++P+   +
Sbjct: 187 MFVSESAPIKIRGALVVVYQLAITLGILFGNILNYMTNKHLSMVDPMNNMAWKIPMLFGY 246

Query: 236 AWALVMIGAMFIVPESPRYLVE-KGQIEEAKRSVAKSNKVTIDDPATIQEIE--LVQIAV 292
            WA ++     I PES  +L + +   E AK S +  N +++ D  TI  +   LV+  V
Sbjct: 247 LWAAIVAVGACITPESVHFLAKIRNDYESAKISYSIMNNISVFDHETIDYVNNLLVKQDV 306

Query: 293 EAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSF 352
             E    +  + E    K K  +R L+G++V+A QQL+G NYFFYYGT +FK+VG++D++
Sbjct: 307 YNENDLRNHKF-EFLYGKPKYGKRLLIGIMVMAFQQLSGINYFFYYGTSLFKSVGIKDTY 365

Query: 353 QTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQP 412
            T++I   VNF STF  +Y+V+  GRR+ L++G+ GM  CM+ +AS G   L    +D  
Sbjct: 366 ATAIILSSVNFISTFAGIYLVESLGRRSTLIYGSFGMFICMIFYASFGTLSLR---KDLL 422

Query: 413 SSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIG 472
           S       +I+ +C FI  FA T  P+ FV+++E FP R ++  M++ +  N + NF I 
Sbjct: 423 SF-----VLIIVTCLFISIFAITIGPVSFVVVAELFPTRTRSVSMSICSSFNWLVNFAIA 477

Query: 473 FFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGV 524
             TP I   I F YG+ F GCL+ +  +   FVPETK    E+++ M++  +
Sbjct: 478 LATPVIINRIGFLYGFFFAGCLLLATGFEAFFVPETKNKTEEEIDYMFQNNL 529

>TBLA0H00240 Chr8 complement(35421..37022) [1602 bp, 533 aa] {ON}
           Anc_3.23 YNL318C
          Length = 533

 Score =  323 bits (828), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/537 (34%), Positives = 298/537 (55%), Gaps = 25/537 (4%)

Query: 1   MDYSQSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKP----ASAYLS 56
           M   +       +S    +++ S +F E +    +F   +  +  + K P      + L 
Sbjct: 1   MSTREDAVTSSFYSEGTTNINESYNFDE-EVGPNEFQLENIPVDTLDKSPIVQEPPSLLK 59

Query: 57  VCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS--SHSDGSKYLSKVRTGLLVSIF 114
             I+CL+++F GFI GWD GTIGG ++   +   FG+  +     +Y     +GL++ I+
Sbjct: 60  PVILCLIISFTGFIFGWDIGTIGGIINMQIFKKSFGNKINPETSERYFDPTLSGLIIGIY 119

Query: 115 NVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSG 174
           N+G  IG + LG+LGD  GR+  + IA+ I+++G+  ++     W Q+FIGR++ G+  G
Sbjct: 120 NIGAGIGGLTLGKLGDYRGRKMALGIAMCIHLLGLFTELVEDYSWIQFFIGRLLTGIAIG 179

Query: 175 TIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLG-----YCTNYGTKTYDNSIQWRV 229
           T AV+ PM + E SP  +RG +V  YQLMIT G+  G      C N    + DN   W+V
Sbjct: 180 TTAVIVPMYLCENSPLKIRGAMVVLYQLMITLGILTGNISNFICHNIYNDSEDNR-AWQV 238

Query: 230 PLGLCFAWALVMIGAMFIVPESPRYLVEKG-QIEEAKRSVAKSNKVTIDDPATIQEIELV 288
           P+ L   W  ++   +F +PES  YL +    ++ A++S AK N V   D  +++ I  +
Sbjct: 239 PILLNVFWDSIVFIGLFFIPESAIYLGKLCFDMDGAQKSFAKMNGVAETDRLSMEFINDI 298

Query: 289 QIAVEAEQAAGSASWSELFQ---TKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKA 345
           +++ E E+   + +    F+    K K+  R L+G++++  QQL+G NYFFYYGT IFK 
Sbjct: 299 KLSAEIEKEENNETPKLKFEFIFGKPKLGYRLLIGILIMTFQQLSGINYFFYYGTTIFKN 358

Query: 346 VGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLW 405
           VG EDS+ T++I  +VNF STF  +Y+V++ GRRTC L G   +   M++FAS+G     
Sbjct: 359 VGFEDSYLTAIILSLVNFVSTFGGIYLVEQIGRRTCYLLGCLSLNIFMILFASIG----- 413

Query: 406 PNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQ 465
            N        G G   IV  C +IF FA T  P+ FV++SE FP RVKA+ +A+ +  N 
Sbjct: 414 -NFAINEPYVGVGLIFIV--CLYIFFFAITLGPVSFVLVSELFPSRVKAESIAICSFFNW 470

Query: 466 MWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEE 522
           + NF +    P I   + F  GY+F G L   + + +  VPETKGL  ++++ ++++
Sbjct: 471 IMNFLVSLVMPLILSRVGFLCGYIFSGFLTIGFIFSWQCVPETKGLTEKEIDDIYQD 527

>TDEL0A00420 Chr1 complement(75025..76554) [1530 bp, 509 aa] {ON}
           Anc_3.23 YNL318C
          Length = 509

 Score =  319 bits (818), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/477 (37%), Positives = 279/477 (58%), Gaps = 18/477 (3%)

Query: 55  LSVCIM-CLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS--SHSDGSKYLSKVRTGLLV 111
           L+V IM C  V+FGGF++GWD GTIGG  +   +   FG+  +   G + L  +  GL++
Sbjct: 40  LAVPIMLCTSVSFGGFLAGWDVGTIGGITNMESFSQNFGTLVNTWTGERRLPAISVGLII 99

Query: 112 SIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGL 171
           S+F+V  A+G + L +LGD  GR+ GI +A+ +Y VG+ I + +   W Q+ IGRI+ GL
Sbjct: 100 SVFSVSSAVGGLTLAKLGDYQGRKFGIYVALVVYCVGLWITLMNDTNWIQFLIGRIVTGL 159

Query: 172 GSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNY-GTKTYDNSIQ---W 227
             G+  VL P+ +SEI+P  +  T++  YQ+  T G+ +G   NY   +  DN ++   W
Sbjct: 160 AVGSTGVLVPIYLSEIAPVTIGSTMIGSYQVQTTLGILMGNIVNYFCHQVLDNDVRNMSW 219

Query: 228 RVPLGLCFAWALVMIGAMFIVPES-PRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIE 286
           ++PL L + W L++   +   PES P  +V K  I +AK S AK N ++  DP T++ I+
Sbjct: 220 QLPLILGYLWVLIITIGLIFTPESAPFLVVHKNAIPDAKASFAKMNAISRADPKTLEFID 279

Query: 287 L-VQIAVEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKA 345
             ++   ++ +   S    +  +++ ++  R L+G+ V++ QQL+G NYFFYYGT IF+A
Sbjct: 280 RSLREKHKSRKEDKSQDILDWARSRPRLGLRLLVGICVMSFQQLSGINYFFYYGTTIFEA 339

Query: 346 VGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLW 405
             + DS+  ++I  +VNF STF  LYVV   GRR  LL G+ GM CCM+V+ASV      
Sbjct: 340 RQM-DSYVVTIILSLVNFLSTFGGLYVVQASGRRPSLLIGSIGMFCCMLVYASV------ 392

Query: 406 PNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQ 465
             G   P    +   +I+ +C ++  FATT  P+  ++++E FP+R KA  MA+ T    
Sbjct: 393 --GSFAPRGTASYVVVIIATCVYLIFFATTLGPVTVILVAELFPMRTKATSMAVCTSFYW 450

Query: 466 MWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEE 522
           M NF + F TP I   I F YGY F G L+ S  + +  VPETK +   D++  +++
Sbjct: 451 MCNFLVSFLTPIIADQIGFLYGYFFAGFLLVSAVFAWFMVPETKYMTQADIDAFYDK 507

>Kwal_27.9678 s27 complement(14940..16481) [1542 bp, 513 aa] {ON}
           YDL138W (RGT2) - glucose permease [contig 336] FULL
          Length = 513

 Score =  319 bits (818), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/480 (37%), Positives = 273/480 (56%), Gaps = 18/480 (3%)

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           L VAFGG + G+DTGTI G L+  DY+ +    H     + +   T L+ +I + G   G
Sbjct: 26  LFVAFGGILFGYDTGTISGVLAM-DYVKQ----HFTSRGHFTADETSLITAILSAGTFCG 80

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
           +++     DT+GRR G++++  I+ VG+V+Q+A+  +      GR+IAG G G ++ + P
Sbjct: 81  AILAPLASDTIGRRLGLILSTIIFTVGVVLQVAATGQ-DLLIAGRVIAGAGVGVLSAIVP 139

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           +  SE SPK +RG +VSCYQ  IT G+ L  C N GT    +S  +R+PL L   WAL++
Sbjct: 140 LYQSEASPKWIRGAVVSCYQWAITIGLLLAACVNQGTHARQDSGSYRIPLALQLLWALIL 199

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
              M I+PESPR+ + K ++ EA+R+++K   +  +  A   E+E +    + E + GS 
Sbjct: 200 FIGMVILPESPRFYIMKEKVPEARRALSKLRGLPEEHCAVEAELEEIVANYKFESSFGSN 259

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           S  + F+     L+R L+G+ V  LQQLTG N+ FYYGT  F+  G++D F   LI  +V
Sbjct: 260 SVWDCFKPANHQLKRILIGIAVQGLQQLTGINFIFYYGTQFFQNSGIKDPFIIQLIMNVV 319

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           N   T   + +V+  GRR  LLWGA GM    ++ A+VG           P S  A  T+
Sbjct: 320 NVIMTIPGIALVEIAGRRNLLLWGAVGMCVSELIVAAVGTA--------LPDSFSANKTL 371

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           I FSC FI  FA TW P+ +V++ E FPLRV+AK +A+   SN ++NF I + TP++  +
Sbjct: 372 IAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAVCAASNWLFNFAIAYATPYLVDS 431

Query: 482 --INFYYGYVFL--GCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQ 537
              N      F+  GC    + +V+ F+ ETKGL LE ++ ++E      +S  ++P  +
Sbjct: 432 EHANLQSKVFFIWGGCTFLCFLFVYFFIYETKGLTLEQIDQLFETCPSARQSKGFIPTER 491

>Skud_96.1 Chr96 (1..624) [624 bp, 208 aa] {ON} YOL156W (REAL)
          Length = 208

 Score =  308 bits (789), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 170/208 (81%)

Query: 66  FGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVL 125
           FGGFI GWDTGTI GF++ SD++ RFG  +  G  YLSKVR GL+VSIFN+GCAIG +VL
Sbjct: 1   FGGFIFGWDTGTISGFVNLSDFVKRFGQKNGKGDYYLSKVRMGLIVSIFNIGCAIGGIVL 60

Query: 126 GRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLIS 185
            ++GD  GRR G++    IY+VGI+IQI SIDKWYQYFIGRII+GLG G IAVLSPMLIS
Sbjct: 61  SKVGDVYGRRIGLITVTAIYVVGILIQITSIDKWYQYFIGRIISGLGVGGIAVLSPMLIS 120

Query: 186 EISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAM 245
           E+SPKH+RGTLV  YQLM T G+FLGYCTNYGTK Y +S QWRV LGLCFAWAL M+  M
Sbjct: 121 EVSPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHDSTQWRVGLGLCFAWALFMVSGM 180

Query: 246 FIVPESPRYLVEKGQIEEAKRSVAKSNK 273
             VPESPRYL+E G+ EEAKRS++KSNK
Sbjct: 181 MFVPESPRYLIEVGKDEEAKRSLSKSNK 208

>Kwal_56.24841 s56 complement(1167890..1169425) [1536 bp, 511 aa]
           {ON} YDL138W (RGT2) - glucose permease [contig 160] FULL
          Length = 511

 Score =  318 bits (816), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/485 (36%), Positives = 273/485 (56%), Gaps = 18/485 (3%)

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           L VAFGG + G+DTGTI G L+    ++   ++ +D   + +   T L+ SI + G   G
Sbjct: 27  LFVAFGGILFGYDTGTISGILA----MDHVKTTFTDRGHFTAG-ETSLITSILSAGTFFG 81

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
           S+    + D +GRR G++++  I+ +G+++Q+A+  +     +GR+IAG+G G ++ + P
Sbjct: 82  SMSAPLVSDNLGRRYGLIVSTVIFTIGVILQVAATTQEL-LIVGRVIAGVGVGVLSAIVP 140

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           +  SE +PK +RG +VS YQ  IT G+ L  C N GT   ++S  +R+PL + F WA++M
Sbjct: 141 LYQSEAAPKWIRGAVVSAYQWAITIGLLLAACVNQGTHARNDSGSYRIPLAIQFLWAIIM 200

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
              M  +PESPR+ V+KG++ EA  ++++   +  DDPA   E+E +      E++ GS 
Sbjct: 201 FIGMCFLPESPRFYVKKGKVPEALSALSRLRGLPKDDPAVEAELEEILANYNYEKSFGST 260

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           +  + F+      +R  +G+ + ALQQLTG N+ FYYGT  F+  G+ + F   LI  IV
Sbjct: 261 TVWDCFRPANHQSKRMFIGIAIQALQQLTGINFIFYYGTQFFQHSGIRNPFVIQLIMNIV 320

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           N   T   + +++  GRR  LLWGA GM    ++ ASVG           P S  A  T+
Sbjct: 321 NVIFTIPGIALIELAGRRNLLLWGAIGMCVSEIIVASVGTA--------LPDSTAANKTL 372

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           I FSC FI  FA TW P+ +V+I E +PLRV+ K +A  T SN ++NF I + TP++   
Sbjct: 373 IAFSCTFIASFAATWGPLAWVVIGEIYPLRVRGKSVAFCTASNWLFNFAIAYATPYLVDE 432

Query: 482 --INFYYGYVFL--GCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQ 537
              N      F+  GC    + +V+  V ETKGL LE V+ +++ G     S  ++P   
Sbjct: 433 DRANLQSKVFFIWGGCTFLCFIFVYFCVYETKGLTLEQVDELFDSGASARTSKRFIPSEG 492

Query: 538 RGTDY 542
              DY
Sbjct: 493 YAHDY 497

>TBLA0A07710 Chr1 complement(1905062..1906672) [1611 bp, 536 aa]
           {ON} Anc_3.23 YNL318C
          Length = 536

 Score =  317 bits (813), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/496 (36%), Positives = 286/496 (57%), Gaps = 25/496 (5%)

Query: 32  DSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRF 91
           +S+  NEI SQ  E         +   ++C MV+FGGF+ GWD GTIGG ++   +   F
Sbjct: 50  NSKSDNEITSQCTE---SSNQNLVKPILLCAMVSFGGFLLGWDIGTIGGIVNMPSFQENF 106

Query: 92  GSSHS--DGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGI 149
           G++ S   G+ Y ++   GL+V+IFN+   +G + + R+    GR+ G+ I+   Y VGI
Sbjct: 107 GNTLSLETGTNYFTETTKGLIVAIFNLAALVGGITIPRVSSFWGRKIGMHISAVTYFVGI 166

Query: 150 VIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMF 209
           +IQI   + W Q+ +GRIIAG+  G+  VL PM +SE SP  +RG++++ YQL+IT  + 
Sbjct: 167 LIQIIPNNNWIQFLVGRIIAGIAVGSYTVLVPMYVSESSPVKIRGSMIALYQLIITLAIV 226

Query: 210 LGYCTNYGTKTY----DNSIQWRVPLGLCFAW-ALVMIGAMFIVPESPRYLVEKGQIEE- 263
           LG   NY  KTY     N+  WR+P+ L   W A V IG  F VPESP++L  K + +E 
Sbjct: 227 LGNLLNYFCKTYITDIHNNNTWRIPISLGLLWVAFVFIGVFF-VPESPQFLA-KVKYDEI 284

Query: 264 -AKRSVAKSNKVTIDDPATIQEIELVQIAVEA-EQAAGSASWSELFQTKTKVLQRTLMGV 321
            AK+S++  N V  D+   + +I L  +  E+ E+   +    E    + K+  R  +GV
Sbjct: 285 GAKKSLSIMNGVPEDN--ILIKILLDDMFNESIERPNKTKKRFEFITGEPKLGLRLFIGV 342

Query: 322 IVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTC 381
            V+ +QQL+G NYFFYYGT IF  VG+++ + T++I   VNF  T  ++Y ++ +GRR C
Sbjct: 343 FVMGIQQLSGINYFFYYGTSIFNKVGIQNPYLTAIILSSVNFFGTCWSIYFIEFFGRRGC 402

Query: 382 LLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPF 441
           L+ GA GM+  + +F+S+    +          K  G  MI+ +C ++  FATT  P  F
Sbjct: 403 LIIGATGMMLSLTIFSSIASFGM--------HLKSTGVIMIISTCVYVLFFATTLGPASF 454

Query: 442 VIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYV 501
           V+ISE +P++ +   +++ +  N + NF + F TP IT  I + +GY+F+G LV    + 
Sbjct: 455 VLISELYPIKTRVTSISICSGFNWLMNFLVSFLTPIITKHIGYKFGYIFVGSLVVGIIFD 514

Query: 502 FAFVPETKGLQLEDVN 517
              +PETKG    ++N
Sbjct: 515 IFMLPETKGRSENEIN 530

>TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON} 
          Length = 526

 Score =  316 bits (809), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/480 (36%), Positives = 277/480 (57%), Gaps = 18/480 (3%)

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           + VAFGG + G+DTGTI G L+  D++ +   + +D  ++ +   T L+ SI + G  +G
Sbjct: 26  MFVAFGGVLFGYDTGTISGILTM-DFVKK---TFTDSGEFTAS-ETSLITSILSAGTFVG 80

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
           +++     DT+GRR G+ I+  I+ VG+++Q  + ++     +GR++AG G G ++ + P
Sbjct: 81  AMLAPLATDTLGRRLGLFISCIIFCVGVILQTIATEQAL-LIVGRVVAGFGVGVLSSIVP 139

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           +  SE +PK +RG +VSCYQ  IT G+ L  C N GT   ++S  +R+P+ L   WAL++
Sbjct: 140 LYQSEAAPKWIRGAVVSCYQWAITIGLLLAACVNEGTHKRNDSGSYRIPIALQLLWALIL 199

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
           I  M  +P++PR+ V KG +++A+ S+     +  +D    +E+E +    E E+  G +
Sbjct: 200 IVGMVFLPDTPRFHVMKGDLKKARSSLCTLRGLRPEDKFVEEELEEIVANYEYEKTFGKS 259

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           +  + F+T    L+R   G+++ ALQQLTG N+ FYYGT  FK+ G+ + F   LI  IV
Sbjct: 260 TILDCFKTGNHQLKRITTGIVIQALQQLTGINFIFYYGTQFFKSSGINNPFTIQLITNIV 319

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           N   T   + +V+  GRR  LLWGA GM     + A +G           P+S  A  T+
Sbjct: 320 NVICTLPGIALVELAGRRRLLLWGAVGMCVSEFLVAIIGTA--------VPNSTAANKTL 371

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           I FSC FI  FA TW P+ +V++ E FPLRV+AK +A+   SN ++NF I F TP++   
Sbjct: 372 IAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAICAGSNWLFNFVIAFITPYLVDE 431

Query: 482 --INFYYGYVFL--GCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQ 537
              N      F+  GC      +V+ FV ETKGL LE+++ +++      KS S+VP ++
Sbjct: 432 DRANLRSKVFFIWGGCTFLCILFVYLFVYETKGLTLEEIDELYDTVTDARKSRSFVPTNK 491

>KLTH0D00484g Chr4 complement(44278..45819) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12300 Saccharomyces cerevisiae
           YDL138W RGT2 Plasma membrane glucose receptor
          Length = 513

 Score =  314 bits (804), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/501 (36%), Positives = 282/501 (56%), Gaps = 20/501 (3%)

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           L VAFGG + G+DTGTI G L+  DY+      H     + +   T L+ +I + G   G
Sbjct: 26  LFVAFGGILFGYDTGTISGVLAM-DYVKE----HFTSRGHFTANETSLITAILSAGTFCG 80

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
           +++     DT+GRR G++I+  I+ VG+V+QIA+  +     +GR+IAG G G ++ + P
Sbjct: 81  AMLAPLASDTIGRRLGLIISTLIFAVGVVLQIAATGQ-NLLIVGRVIAGAGVGVLSAIVP 139

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           +  SE SPK +RG +VSCYQ  IT G+ L  C N GT   ++S  +R+P+ L   WA++M
Sbjct: 140 LYQSEASPKWIRGAVVSCYQWAITIGLLLAACVNQGTHARNDSGSYRIPIALQLLWAIIM 199

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
              M I+PESPR+ + K ++ EA+++++K   +  +      E+E +      E++ GS 
Sbjct: 200 FIGMVILPESPRFYIMKEKVPEARKALSKLRGLPEEHEVIQNELEEISANYNYERSFGST 259

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           S  + F+     L+R  +G+ + ALQQLTG N+ FYYGT  F+  G++D F   LI  +V
Sbjct: 260 SIWDCFKPANHQLKRIFIGIAIQALQQLTGINFIFYYGTQFFQNSGIKDPFIIQLIMNVV 319

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           N   T   + +V+  GRR  LLWGA GM    ++ A+VG           P S  A  T+
Sbjct: 320 NVVMTVPGIALVEIAGRRNLLLWGAIGMCVSELIVAAVGTA--------LPDSFSANKTL 371

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           I FSC FI  FA TW P+ +V++ E FPLRV+AK +A+   SN ++NF I + TP++  +
Sbjct: 372 IAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAVCAASNWLFNFAIAYATPYLVDS 431

Query: 482 --INFYYGYVFL--GCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQ 537
              N      F+  GC    + +V+ F+ ETKGL LE ++ ++E       S ++VP S 
Sbjct: 432 EHANLQSKVFFIWGGCTFLCFLFVYFFIYETKGLTLEQIDELFEVCPSARYSKNFVPSS- 490

Query: 538 RGTDYNAEALATDDKPIYKRM 558
            G   +   ++  DK + + +
Sbjct: 491 -GPAVDVSNISDSDKAVVEVL 510

>KLTH0G19404g Chr7 (1672150..1673691) [1542 bp, 513 aa] {ON} weakly
           similar to uniprot|Q12300 Saccharomyces cerevisiae
           YDL138W RGT2 Plasma membrane glucose receptor
          Length = 513

 Score =  313 bits (801), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 179/499 (35%), Positives = 281/499 (56%), Gaps = 20/499 (4%)

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           L VAFGG + G+DTGTI G L+  DY+      H     + +   T L+ +I + G   G
Sbjct: 26  LFVAFGGILFGYDTGTISGVLAM-DYVKE----HFTSRGHFTANETSLITAILSAGTFCG 80

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
           +++     DT+GRR G++I+  I+ VG+++Q+A+  +     +GR++AG G G ++ + P
Sbjct: 81  AMLAPLASDTLGRRLGLIISTLIFAVGVILQVAATGQ-DLLIVGRVVAGAGVGVLSAIVP 139

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           +  SE SPK +RG +VSCYQ  IT G+ L  C N GT   ++S  +R+P+ L   WA++M
Sbjct: 140 LYQSEASPKWIRGAVVSCYQWAITIGLLLAACVNQGTHARNDSGSYRIPIALQLLWAIIM 199

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
              M I+PESPR+ + K ++ EA++++++   +  +      E+E +      E++ GS 
Sbjct: 200 FIGMVILPESPRFYIMKEKVPEARKALSRLRGLPEEHEVIQNELEEISANYNYEKSFGST 259

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           S  + F+     L+R  +G+ + ALQQLTG N+ FYYGT  F+  G++D F   LI  +V
Sbjct: 260 SIWDCFKPANHQLKRIFIGIAIQALQQLTGINFIFYYGTQFFQNSGIKDPFIIQLIMNVV 319

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           N   T   + +V+  GRR  LLWGA GM    ++ A+VG           P S  A  T+
Sbjct: 320 NVVMTVPGIALVEIAGRRNLLLWGAIGMCVSELIVAAVGTA--------LPDSFSANKTL 371

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
           I FSC FI  FA TW P+ +V++ E FPLRV+AK +A+   SN ++NF I + TP++  +
Sbjct: 372 IAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAVCAASNWLFNFAIAYATPYLVDS 431

Query: 482 --INFYYGYVFL--GCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQ 537
              N      F+  GC    + +V+ F+ ETKGL LE ++ ++E       S S+VP S 
Sbjct: 432 EHANLQSKVFFIWGGCTFLCFLFVYFFIYETKGLTLEQIDELFETCPSARYSKSFVPSS- 490

Query: 538 RGTDYNAEALATDDKPIYK 556
            G   +A   +  DK + +
Sbjct: 491 -GPAVDASNTSDSDKAVVE 508

>KLTH0H00308g Chr8 (28695..30227) [1533 bp, 510 aa] {ON} weakly
           similar to uniprot|Q12300 Saccharomyces cerevisiae
           YDL138W RGT2 Plasma membrane glucose receptor
          Length = 510

 Score =  310 bits (793), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 170/479 (35%), Positives = 276/479 (57%), Gaps = 18/479 (3%)

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           L VAFGG + G+DTGTI G L+      ++   H       +   T L+ SI + G  +G
Sbjct: 26  LFVAFGGVLFGYDTGTISGILAM-----KYVKEHFTHRGSFTAGETSLITSILSAGTFVG 80

Query: 122 SVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
           ++    + DT+GRR G++ +  ++ +G+++Q+A+  +     +GR+IAGLG G ++ + P
Sbjct: 81  AISAPLVSDTMGRRFGLIASTIVFSIGVILQVAATGQ-DLLIVGRVIAGLGVGILSAIVP 139

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           +  SE +PK +RG +VSCYQ  IT G+ L  C N GT    +S  +R+P+ + FAWAL++
Sbjct: 140 LYQSEAAPKWIRGAVVSCYQGAITVGLLLAACVNQGTHARTDSGSYRIPIAIQFAWALIL 199

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
              M ++PESPR+ V++G+IE+A  ++++   +  D P    E+E +      E++ GS 
Sbjct: 200 FVGMIVLPESPRFYVKQGKIEKAGNALSRLRGLPADHPIVEGELEEILANFNYEKSLGST 259

Query: 302 SWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIV 361
           +  + F+     L+R L+G+ + ALQQLTG N+ FYYGT  F+  G+++ F   +I  +V
Sbjct: 260 TVWDCFKRGNHQLKRMLIGLAIQALQQLTGINFIFYYGTQFFQNSGIKNPFIIQVIMNVV 319

Query: 362 NFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
           N   T+  + +V+  GRR  LLWGA GM    ++ ASVG           P S  A  T+
Sbjct: 320 NVVMTWPGVLLVELAGRRNLLLWGAVGMCVSELIVASVGTA--------LPDSTAANKTL 371

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFIT-- 479
           I FSC FI  FA TW P+ +V++ E +PLRV+ K +AL   SN ++NF I + TP++   
Sbjct: 372 IAFSCTFIASFAATWGPLAWVVVGEIYPLRVRGKSVALCAASNWLFNFAIAYATPYLVDQ 431

Query: 480 --GAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPS 536
               +     +++ GC    + +V+ F+ ETKGL LE ++ ++E       S +++P S
Sbjct: 432 EHANLQSKVFFIWGGCTFLCFLFVYFFIYETKGLTLEQIDELFETCTSAPDSKNFIPSS 490

>SAKL0B00264g Chr2 (22039..23598) [1560 bp, 519 aa] {ON} similar to
           uniprot|Q12300 Saccharomyces cerevisiae YDL138W RGT2
           Plasma membrane glucose receptor, highly similar to
           Snf3p; both Rgt2p and Snf3p serve as transmembrane
           glucose sensors generating an intracellular signal that
           induces expression of glucose transporter (HXT) genes
          Length = 519

 Score =  304 bits (778), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 173/481 (35%), Positives = 264/481 (54%), Gaps = 28/481 (5%)

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VAFGG + G+DTGTI G ++  DY  +  +S      + S   T L+ SI + G   G++
Sbjct: 28  VAFGGILFGYDTGTISGVMAM-DYTKKTFTSEG----HFSASETSLITSILSAGTFCGAI 82

Query: 124 VLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPML 183
           +     DT+GRR G+++A  I+  G ++Q A+  +      GR+IAG G G ++ + P+ 
Sbjct: 83  LAPLASDTIGRRLGLLVACAIFSAGAILQTAATTQAL-LIAGRVIAGAGVGVLSAIVPLY 141

Query: 184 ISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIG 243
            SE +PK +RG +VSCYQ  IT G+ L  C N GT   ++S  +R+P GL   WAL+M+ 
Sbjct: 142 QSETTPKWIRGAVVSCYQWAITIGLLLAACVNQGTHNRNDSGSYRIPFGLQLLWALIMVI 201

Query: 244 AMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASW 303
            + I+PE+PR+ V K    +A  S++K   +  + P   QE+  +      E++ GS + 
Sbjct: 202 GLLILPETPRFYVMKDNFPKAVASLSKLRGLPKEHPVVEQELREIVANYNYEKSFGSTTI 261

Query: 304 SELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNF 363
            + F+     L+R  +G+++  LQQLTG N+ FYYG   F+  G+++ F   LI  IVN 
Sbjct: 262 IDCFKPANHQLKRIFIGIVIQGLQQLTGINFIFYYGVQFFQNSGIDNPFIIQLIMNIVNV 321

Query: 364 ASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIV 423
             T   + +V+  GRR  LLWGA GM     + ASVG           P S  A  T+I 
Sbjct: 322 IMTIPGIALVEIAGRRNLLLWGAIGMSVSEFIVASVGTA--------LPDSFAANKTLIA 373

Query: 424 FSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA-- 481
           FSC FI  FA TW P+ +V++ E +PLRV+AK +A+   SN ++NF I F TP++  +  
Sbjct: 374 FSCSFIASFAATWGPLAWVVVGEIYPLRVRAKSVAICAASNWLFNFAIAFATPYLVDSGP 433

Query: 482 --------INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWV 533
                   + F +G     CLVF Y +++    ETKGL LE ++ +++       S  +V
Sbjct: 434 GNADLKSKVFFIWGSCTFLCLVFVYFFIY----ETKGLTLEQIDELFDTVPSARHSKKFV 489

Query: 534 P 534
           P
Sbjct: 490 P 490

>Kwal_55.20064 s55 (235602..236315) [714 bp, 238 aa] {ON} YHR094C
           (HXT1) - High-affinity hexose (glucose) transporter
           [contig 156] PARTIAL
          Length = 238

 Score =  289 bits (740), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 170/227 (74%), Gaps = 6/227 (2%)

Query: 5   QSPTGEDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMV 64
           Q   G +V ++ A  +H  +S  E+    +D  E      ++  K +  ++ V + C+MV
Sbjct: 18  QGSHGSNVMNAPAAKLHREESHDEIDALKKDAEE------QLANKKSGDFVFVSLCCIMV 71

Query: 65  AFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVV 124
           AFGGF+ GWDTGTI GF++ +D+  RFG ++S G  YLS VRTGL+VSIFN+GCAIG +V
Sbjct: 72  AFGGFVFGWDTGTISGFVAQTDFKRRFGQTNSKGEHYLSNVRTGLMVSIFNIGCAIGGIV 131

Query: 125 LGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLI 184
           LG+LG+  GRR G+ I V IY VGI+IQIASIDKWYQYFIGRII+GLG G I VLSPMLI
Sbjct: 132 LGKLGEVYGRRLGLTIVVVIYAVGIIIQIASIDKWYQYFIGRIISGLGVGAITVLSPMLI 191

Query: 185 SEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPL 231
           SE+SPKHLRGTLVSCYQ M+T G+FLGYC NYGTKTY NS+QWRVPL
Sbjct: 192 SEVSPKHLRGTLVSCYQFMVTGGIFLGYCANYGTKTYSNSVQWRVPL 238

>NDAI0D05050 Chr4 (1208468..1209109) [642 bp, 213 aa] {ON} 
          Length = 213

 Score =  281 bits (720), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 132/213 (61%), Positives = 165/213 (77%)

Query: 319 MGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGR 378
           MG +V +LQQLTGCNYFFYYGT IF+AVG+EDS+ TS++ G+VNFASTF AL+ V+++  
Sbjct: 1   MGAVVQSLQQLTGCNYFFYYGTTIFQAVGMEDSYLTSIVLGVVNFASTFAALWTVERFEH 60

Query: 379 RTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAP 438
           R CLL+G+A M  C VVFAS GVT+L+PNG DQ +SK A N MIVF+  FIF FATTWAP
Sbjct: 61  RRCLLFGSAAMAVCFVVFASTGVTELYPNGHDQATSKVADNIMIVFTYLFIFFFATTWAP 120

Query: 439 IPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSY 498
           IPFV+++ES+PL +K + MA+   +N MW F IGF TPF+T  INFYYG++F G L+FS 
Sbjct: 121 IPFVVVAESYPLLIKNRAMAIAVGANWMWGFAIGFCTPFVTSTINFYYGFIFFGYLIFSI 180

Query: 499 CYVFAFVPETKGLQLEDVNLMWEEGVLPWKSAS 531
            YVF FV ETKGL LE V  M+EEG +PW S +
Sbjct: 181 LYVFFFVCETKGLLLEKVTEMYEEGAVPWTSTT 213

>Suva_9.198 Chr9 (327714..328337) [624 bp, 207 aa] {ON} YFL011W
           (REAL)
          Length = 207

 Score =  273 bits (697), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 131/191 (68%), Positives = 161/191 (84%)

Query: 348 LEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPN 407
           +EDSF+TS++ G+VNFASTFVALY+VDK+GRR CLLWG+A M  C V+FASVGVT+LWP+
Sbjct: 1   MEDSFETSIVLGVVNFASTFVALYIVDKFGRRKCLLWGSASMAICFVIFASVGVTRLWPH 60

Query: 408 GQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMW 467
           G+DQPSS+ AGN MIVF+CFFIFCFA TWAPI +VI++ES+PLRVK + MA+   +N MW
Sbjct: 61  GKDQPSSQSAGNVMIVFTCFFIFCFAITWAPIAYVIVAESYPLRVKNRAMAIAVGANWMW 120

Query: 468 NFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPW 527
            F IGFFTPFIT AI+F YGYVF+GCL+FSY YVF FV ETKGL LE+VN M+EE + PW
Sbjct: 121 GFLIGFFTPFITRAISFSYGYVFMGCLIFSYFYVFFFVCETKGLTLEEVNEMYEERIKPW 180

Query: 528 KSASWVPPSQR 538
           KS  W+P ++R
Sbjct: 181 KSGGWIPSAKR 191

>Smik_113.1 Chr113 complement(3..554) [552 bp, 184 aa] {ON} YOL156W
           (REAL)
          Length = 184

 Score =  260 bits (664), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 147/178 (82%)

Query: 44  IEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLS 103
           I++P+KP SAY +V I+CLM+AFGGFI GWDTGTI GF++ SD++ RFG  +  G  YLS
Sbjct: 7   IDLPQKPLSAYTTVAILCLMIAFGGFIFGWDTGTISGFVNLSDFVRRFGQKNGKGGYYLS 66

Query: 104 KVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYF 163
           KVR GL+VSIFN+GCAIG +VL ++GD  GRR G++    IY+VGI+IQI SIDKWYQYF
Sbjct: 67  KVRMGLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSIDKWYQYF 126

Query: 164 IGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTY 221
           IGRII+GLG G IAVLSPMLISE+SPKH+RGTLV  YQLM T G+FLGYCTNYGTK Y
Sbjct: 127 IGRIISGLGVGGIAVLSPMLISEVSPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNY 184

>Skud_122.1 Chr122 complement(3..512) [510 bp, 170 aa] {ON} YJL219W
           (REAL)
          Length = 170

 Score =  242 bits (618), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 141/169 (83%), Gaps = 2/169 (1%)

Query: 292 VEAEQAAGSASWSELFQTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDS 351
           +E E+ AG+ASW+EL  TKTKV QR LMGV++ +LQQLTG NYFFYYGT IFK+VGL+DS
Sbjct: 2   IEVEKLAGNASWAELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDS 61

Query: 352 FQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQ 411
           FQTS+I G+VNF S+F+A+Y ++++GRRTCLLWGAA MVCC  VFASVGVTKLWP G   
Sbjct: 62  FQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMVCCFTVFASVGVTKLWPQGSSH 121

Query: 412 P--SSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMA 458
              +S+GAGN MIVF+ FFIF FATTWA   +VI++E+FPLRVK++GMA
Sbjct: 122 QDITSQGAGNCMIVFTMFFIFSFATTWAGGCYVIVAETFPLRVKSRGMA 170

>ZYRO0F05786g Chr6 complement(476413..478560) [2148 bp, 715 aa] {ON}
           similar to uniprot|P10870 Saccharomyces cerevisiae
           YDL194W SNF3 glucose sensor
          Length = 715

 Score =  244 bits (623), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 151/511 (29%), Positives = 266/511 (52%), Gaps = 35/511 (6%)

Query: 37  NEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHS 96
           +E+ S +   P +P S ++S+ ++ + VA GGF+ G+DTG I   L     ++    +HS
Sbjct: 81  DEVCSTLFISPPQPQSKFMSI-LVGVFVAVGGFLFGYDTGLINSLLDMKYVVHHLSPNHS 139

Query: 97  DGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVF-IYIVGIVIQIAS 155
               Y +     ++VS  ++G  +G++    L D+ GR+  I+++V  ++ VG  +QIA+
Sbjct: 140 ----YFTTKEQSIIVSFLSLGTVVGALAAPLLSDSCGRKMTIILSVVSVFFVGNSLQIAA 195

Query: 156 IDKWYQYFI-GRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCT 214
            +   Q  + GR+I+G+G G I+ + P+  SE + K+LRG ++S YQ  IT+G+ +    
Sbjct: 196 TN--MQLLVAGRVISGVGLGLISAVVPLYQSEAAHKYLRGAIISTYQWAITWGLLVSSAV 253

Query: 215 NYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKV 274
           + GT   D    +RVP+GL + W  ++   M   PESPR+ V K ++++A +S++    V
Sbjct: 254 SQGTNQIDAPASYRVPIGLQYVWTSILATGMIFFPESPRFYVLKDKLDKAAKSLSFLRGV 313

Query: 275 TIDDPATIQEIELVQIAVEAEQAAGSASWSELF---QTKTKVLQRTLMGVIVLALQQLTG 331
              D   ++E+  ++   + E++ G+++  + F   +T+ K   R L G+ + A QQ +G
Sbjct: 314 PQTDSGLLEELVEIKATYDYEKSFGTSTLLDCFKSSKTRPKQTLRMLSGISLQASQQFSG 373

Query: 332 CNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVC 391
            N+ FYYG   F   G+  ++  S I   VN A     L++V+ YGRR  L++G   M  
Sbjct: 374 INFLFYYGVNFFNKTGVHRAYLVSFITYAVNVAFNIPGLFLVEYYGRRKVLIFGGIMMTM 433

Query: 392 CMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLR 451
           C  + A VG +          +S      MI F C FI  F+ TW    +VI +E +PL 
Sbjct: 434 CNFIIAIVGTST---------NSIIGNKVMIAFICLFIASFSATWGGCVWVISAELYPLG 484

Query: 452 VKAKGMALGTVSNQMWNFCIGFFTPFITGAIN----------FYYGYVFLGCLVFSYCYV 501
           +++K  A+   SN + NF     TP+I    N          F +G +    ++  +  +
Sbjct: 485 IRSKCTAICAASNWLVNFICSLITPYIVDTGNHTSSMGPKIFFIWGSLNALAVILVHFAI 544

Query: 502 FAFVPETKGLQLEDVNLMWEEGVLPWKSASW 532
           +    ETKGL LE+++ ++ +    ++S  W
Sbjct: 545 Y----ETKGLTLEEIDELYAKSPSSFQSTKW 571

>CAGL0I03872g Chr9 (337985..340273) [2289 bp, 762 aa] {ON} some
           similarities with uniprot|Q12300 Saccharomyces
           cerevisiae YDL138w RGT2 or uniprot|P10870 Saccharomyces
           cerevisiae YDL194w SNF3
          Length = 762

 Score =  243 bits (619), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 154/520 (29%), Positives = 269/520 (51%), Gaps = 42/520 (8%)

Query: 62  LMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIG 121
           L VA GGF+ G+DTG I               +HS    + +  +  +LVS  ++G  +G
Sbjct: 121 LFVAVGGFLYGYDTGLINSITDMKYVKEHIAPNHS----FFTTTQISMLVSFLSLGTFVG 176

Query: 122 SVVLGRLGDTVGRRKGIVIA-VFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLS 180
           +++   + D  GR+  I+ + + I+ +G  +Q+A+        +GR+I+G+G G I+ + 
Sbjct: 177 ALIAPWISDIYGRKSTIIFSTMIIFSIGNSLQVAA-GGLALLIVGRVISGIGIGIISAVV 235

Query: 181 PMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALV 240
           P+  +E + KH+RG +++ YQL IT G+ +    + GT++ +    +RVP+GL + W++V
Sbjct: 236 PLYQAEAAQKHMRGAIITTYQLAITLGLLVSSAVSQGTESINAPSSYRVPIGLQYVWSVV 295

Query: 241 MIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGS 300
           +   M  +PESPRY + K +IEEA RS++    ++++DP  ++E+  ++   + E + G 
Sbjct: 296 LGVGMVFLPESPRYYIMKDEIEEAARSLSFLRGISLEDPRLLEELVEIKANYDYESSFGP 355

Query: 301 ASWSELFQT---KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLI 357
            S  + F++   + K + R   G+ + A QQ +G N+ FYYG   F   G++ S+  S +
Sbjct: 356 VSIWDCFRSSEQRPKQVLRMFTGISIQAFQQFSGINFIFYYGVYFFNKTGIKSSYLVSFV 415

Query: 358 FGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGA 417
              VN A     ++++D  GRR  L++G   M  C  + A VGV+           S  +
Sbjct: 416 TYAVNVAFNIPGMFLIDYLGRRKVLIFGGIAMTACNFIIAIVGVSA---------KSIVS 466

Query: 418 GNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPF 477
            N MI F C FI  F++TW  + +VI +E FPL V++K  A+   +N + NF     TP+
Sbjct: 467 NNVMIAFICVFIAAFSSTWGGVVWVISAELFPLGVRSKCTAICAAANWLVNFVCALMTPY 526

Query: 478 I--TGA---------INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLP 526
           I  TG+         I F +G +     + +Y  V+    ET+GL LE++N ++     P
Sbjct: 527 IVDTGSNYTSSMGTKIYFIWGSLNALGTIVAYLTVY----ETRGLTLEEINELYVNSPTP 582

Query: 527 WKSASW---------VPPSQRGTDYNAEALATDDKPIYKR 557
           + S  W         +PP     + +   + T D  ++ R
Sbjct: 583 FASNEWNRKIRTESTIPPMVHDHELDNHIVPTMDNILHSR 622

>Kwal_56.24469 s56 complement(1008164..1010293) [2130 bp, 709 aa]
           {ON} YDL194W (SNF3) - glucose sensor [contig 161] FULL
          Length = 709

 Score =  240 bits (613), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 163/534 (30%), Positives = 275/534 (51%), Gaps = 29/534 (5%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQ-DFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGG 68
           ++V  S  G V S+    E + D     + ++S +   P +P S+ +S+ ++ + VA GG
Sbjct: 46  KNVQESNIGEVGSNV---ESEDDRHIGLSNLESTLFLRPSRPQSSLMSI-LVGVFVAVGG 101

Query: 69  FISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRL 128
           F+ G+DTG I   ++   Y+    +  ++  +  +     +LVS  ++G   G++V   +
Sbjct: 102 FLYGYDTGLINN-ITEMKYVK---THFAENKQQFTAKEMSILVSFLSLGTFFGALVAPFM 157

Query: 129 GDTVGRRKGIVIAVF-IYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEI 187
            DT GR+  I+ + F +++VG  +Q+A+ +      IGR+ +G+G G I+ + P+  SE 
Sbjct: 158 SDTWGRKTTIIFSTFFVFMVGNSLQVAA-NGTTLLVIGRVFSGVGVGFISAVVPLYQSEA 216

Query: 188 SPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFI 247
           + K +RG ++S YQ  IT+G+ +    + GT    +   +R+P+GL F W+ ++   M  
Sbjct: 217 AQKRVRGAIISTYQWAITWGLLVSSAVSQGTHNRMDPSSYRIPIGLQFVWSCILGFGMIF 276

Query: 248 VPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELF 307
           +PESPRY V K Q++ A +S+A    V  DD   ++E+  ++   + E + GS S+ + F
Sbjct: 277 LPESPRYYVLKDQLDRAAKSLAFLRGVPEDDSGLLEELVEIKANYDYEMSFGSFSYLDCF 336

Query: 308 ---QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFA 364
              +++TK   R L G+ + A QQL+G N+ FYYG   F   G+ DS+  S +   VN  
Sbjct: 337 RSSKSRTKQRLRMLTGIAIQAFQQLSGINFIFYYGVNFFSKSGVGDSYLVSFVTYAVNVG 396

Query: 365 STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVF 424
                L++V+  GRR  L++G   M     V A VG  +          S  A   MI F
Sbjct: 397 FNIPGLFLVEYMGRRKVLIFGGVLMTAANFVIAIVGCVE---------RSVIADKIMIAF 447

Query: 425 SCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI--TGAI 482
            C FI  F+ TW    + I +E +PL V++K  A+   SN + NF     TP+   TGA 
Sbjct: 448 VCVFIASFSATWGGCVWAISAELYPLGVRSKCTAICAASNWLVNFICAMITPYFIHTGAH 507

Query: 483 NFYYG----YVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASW 532
               G    +++ G        V+  V ET+GL LE+++L++      + S SW
Sbjct: 508 TSSLGTKVFFIWGGLNAIGVVVVYLTVYETRGLTLEEIDLLYRLSPNCFTSDSW 561

>Ecym_8060 Chr8 complement(129041..131173) [2133 bp, 710 aa] {ON}
           similar to Ashbya gossypii ADR091W
          Length = 710

 Score =  240 bits (613), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 164/528 (31%), Positives = 270/528 (51%), Gaps = 43/528 (8%)

Query: 30  KKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYIN 89
             D +D + +D+  +        ++    ++ + VA GGF+ G+DTG I   ++  DY+ 
Sbjct: 83  HNDVEDLHSVDNPNVLTVHSNRMSF----VVGIFVATGGFLYGYDTGLINS-ITEMDYVK 137

Query: 90  RFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVF-IYIVG 148
              S+H+      +     +LVS  ++G   G++    L DT GR+  I+ + F ++ VG
Sbjct: 138 THFSTHAG---QFTAREMSILVSFLSLGTFFGALGAPLLADTYGRKSTIIFSTFFVFTVG 194

Query: 149 IVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGM 208
             +Q+A+  +     IGR+ +G+  G I+   P+   E   K LRG ++  YQ  IT+G+
Sbjct: 195 TALQVAA-HELKLLVIGRVCSGVAVGLISAAVPLYQGETVCKWLRGGIICTYQWAITWGL 253

Query: 209 FLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSV 268
            L    + GT   ++S  +R+P+ L F W   +   M ++PESPRY V K Q+++A +S+
Sbjct: 254 LLSSAVSQGTHFRNDSSSYRIPIALQFVWCFFLGTGMLLLPESPRYYVLKDQLDKAAKSL 313

Query: 269 AKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQT---KTKVLQRTLMGVIVLA 325
           A    V  DDP  ++E+  ++   + E + GS S+ + F+T   ++K   R L G+++ A
Sbjct: 314 AFLRSVPEDDPGLLEELVEIKANYDYEMSLGSFSYLDCFKTSKSRSKQQLRMLTGILIQA 373

Query: 326 LQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWG 385
            QQL+G N+ FYYG   F   G+  S+  S +   VN A     L++V+  GRR  LL+G
Sbjct: 374 FQQLSGINFIFYYGVNFFSRTGIGKSYLVSFVTYAVNVAFNVPGLFLVEYVGRRKLLLFG 433

Query: 386 AAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIIS 445
              M     + A VG +          +S  A   M+VF CFFI  F+ TW  + +VI +
Sbjct: 434 GVSMAISNFIIAIVGCST---------NSVVANKVMVVFVCFFIASFSATWGGVVWVISA 484

Query: 446 ESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI--TGA--------INFYYGYV-FLGCL 494
           E +PL V++K  A+   SN + NF     TP++  TG+        I F +G +  +G L
Sbjct: 485 EMYPLGVRSKCAAICAASNWLVNFVCALITPYLIDTGSHTSTLGTKIFFIWGSLNAIGVL 544

Query: 495 VFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASW-----VPPSQ 537
           V     V+  V ET GL LE+++ ++      + S +W     V PSQ
Sbjct: 545 V-----VYLTVYETSGLTLEEIDDLYRLCPNSFSSYTWNSEIKVSPSQ 587

>Kpol_1019.31 s1019 (61016..63517) [2502 bp, 833 aa] {ON}
           (61016..63517) [2502 nt, 834 aa]
          Length = 833

 Score =  241 bits (616), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 159/515 (30%), Positives = 260/515 (50%), Gaps = 35/515 (6%)

Query: 34  QDFNEIDSQIIEIPKKPASAYLSVCIMC-LMVAFGGFISGWDTGTIGGFLSHSDYINRFG 92
            D +  D+  I     P      V I+    VA GGF+ G+DTG I   +        F 
Sbjct: 110 DDCSSYDNTSILFGDPPQRQSNRVTILVGFFVAVGGFLYGYDTGLINSIVDMQYVREHFS 169

Query: 93  SSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIA-VFIYIVGIVI 151
           S+H +     +  +  ++VS  ++G   G++    + D  GR+  I+++ + I++ G  I
Sbjct: 170 SNHDN----FTAEQLAIIVSFLSLGTFFGALTAPVISDRCGRKTVIILSTLIIFLTGNTI 225

Query: 152 QIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLG 211
           QI+S +      IGR+I+G   G I+ + P+  SE + K+LRG ++S +Q  IT+G+ + 
Sbjct: 226 QISS-NGVVLLVIGRVISGFSVGLISAVVPLYQSEAAIKYLRGAIISTFQWAITWGLLVS 284

Query: 212 YCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKS 271
              +  T T D +  +R+P+GL + WA  +   MF +PESPRY V K ++++A  S++  
Sbjct: 285 SAVSQATYTIDKAASYRIPIGLQYIWACFLGIGMFFLPESPRYYVLKDKLDKAASSLSFL 344

Query: 272 NKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELF---QTKTKVLQRTLMGVIVLALQQ 328
            +V + D   ++E+  ++   + E + GS++  + F   +T+ K   R   G+++   QQ
Sbjct: 345 RRVPVHDSGLLEELVEIKATYDYEMSFGSSTLLDCFRSSKTRPKQTLRMFTGILLQVFQQ 404

Query: 329 LTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAG 388
            +G N+ FYYG   F   G+E+S++ SLI   VN A T   L++VD+ GRR  LL+G  G
Sbjct: 405 FSGINFIFYYGVNFFSRTGIENSYRISLITYAVNVAFTIPGLFLVDRVGRRNLLLYGGIG 464

Query: 389 M-----VCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVI 443
           M     +  +V FA   V                   MI F C FI CF ++W  I +V+
Sbjct: 465 MAISNFIIAIVSFADEHVIN--------------NRVMIAFICIFIVCFTSSWGIIVWVL 510

Query: 444 ISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYG-----YVFLGCLVFSY 498
            +E +PL V++K +A+   SN + NF   F TP+I    +  Y      +   G L    
Sbjct: 511 SAELYPLGVRSKCVAICAASNWLVNFICAFITPYIVNITSHTYTIGPRIFFLWGALNAVG 570

Query: 499 CYVFAF-VPETKGLQLEDVNLMWEEGVLPWKSASW 532
             V  F V ETKGL LE+++ ++ E      S  W
Sbjct: 571 VVVVYFTVYETKGLTLEEIDELFSECPNSISSPKW 605

>KAFR0L01310 Chr12 complement(241337..243691) [2355 bp, 784 aa] {ON}
           Anc_7.309 YDL194W
          Length = 784

 Score =  238 bits (608), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 154/540 (28%), Positives = 270/540 (50%), Gaps = 29/540 (5%)

Query: 7   PTGED--VHSS--TAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCL 62
           P  E+  +HSS  T  + + S  + ++  D   FN+  S +   P  P S  +S+ +   
Sbjct: 42  PANEEDILHSSDKTVRNNYHSDEYSQINDDVSTFNDSVSYLFSEPPLPQSNTMSIVVGVF 101

Query: 63  MVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGS 122
           +   G    G+DTG I   +           +H+    + + V+  +LVS  ++G  +G+
Sbjct: 102 VAVGGFLF-GYDTGLINSLIDMQYVREHLAPNHT----FFTNVQMSILVSFLSLGTFVGA 156

Query: 123 VVLGRLGDTVGRRKGIVIAV-FIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSP 181
           +    + D++GR+  I+I+  F++ +G  +Q+ +        IGR+I+G+G G I+ + P
Sbjct: 157 LSAPIISDSLGRKLTIIISTAFVFSLGNSLQVGATSMQL-LVIGRVISGIGIGFISAVVP 215

Query: 182 MLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVM 241
           +  +E   K+LRG ++S YQ  IT+G+ +      GT   DN+  +R+P+GL + W+  +
Sbjct: 216 LYQAETVKKNLRGAIISTYQWAITWGLLVSSAVAQGTHHMDNASSYRIPIGLQYIWSSTL 275

Query: 242 IGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSA 301
              M  +PESPRY V K  +++A RS++    V + D   ++E+  ++   + E + G++
Sbjct: 276 ALGMIFLPESPRYHVLKDNLDKAARSLSFLRSVPLHDSGLLEELVEIKATYDYEASVGTS 335

Query: 302 SWSELF---QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIF 358
           ++ + F   + + K   R   G+ + A QQ TG N+ FYYG   F   G+ +S+  SLI 
Sbjct: 336 TFMDCFVSSEKRPKQSLRMFTGMALQAFQQFTGINFIFYYGVYFFNNTGVNNSYIISLIT 395

Query: 359 GIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAG 418
             VN       +Y+V+ +GRR  L+ G   M     + A VG+           +S  A 
Sbjct: 396 YAVNVLFNVPGMYLVEYFGRRKVLIVGGILMTISNFIIAIVGIAT---------NSVIAN 446

Query: 419 NTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI 478
             MI F C FI  F+ TW  + +V+ +E +PL V+AK  A+   +N + NF   F TP+I
Sbjct: 447 KVMIAFICVFIATFSATWGGVVWVVSAELYPLGVRAKCTAICAATNWLVNFICAFITPYI 506

Query: 479 TGAINFYYG------YVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASW 532
              ++          +++ G        V+  V ETKGL LE+++ ++ +      SA W
Sbjct: 507 VDTVDHTSKIGSRIFFIWGGLNAIGVMIVYLTVYETKGLTLEEIDELYTKSSTSVSSAKW 566

>KLTH0H02156g Chr8 (195794..197944) [2151 bp, 716 aa] {ON} similar
           to uniprot|P10870 Saccharomyces cerevisiae YDL194W SNF3
           glucose sensor
          Length = 716

 Score =  236 bits (601), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 157/511 (30%), Positives = 264/511 (51%), Gaps = 31/511 (6%)

Query: 35  DFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSS 94
           +FN ++S +   P +P S+++S+ ++ + VA GGF+ G+DTG I   ++  DY+    +S
Sbjct: 73  NFNNLESTLFLQPSRPQSSFMSI-LVGVFVAVGGFLYGYDTGLINN-ITEMDYVKTHFAS 130

Query: 95  HSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVF-IYIVGIVIQI 153
           +    +  +     +LVS  ++G  +G++    + DT GR+  I+I+ F I++VG  +Q+
Sbjct: 131 NK---QQFTAKEMSILVSFLSLGTFVGALAAPFISDTWGRKSTIIISTFLIFMVGNSLQV 187

Query: 154 ASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYC 213
           A+ +      IGR+ +G+G G I+ + P+  SE + K +RG ++S YQ  IT+G+ +   
Sbjct: 188 AA-NGTTLLVIGRVFSGVGVGFISAVVPLYQSEAAQKWVRGAIISTYQWAITWGLLVSSA 246

Query: 214 TNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNK 273
            + GT    ++  +R+P+GL F W+ ++   M  +PESPRY V K Q++ A +S+A    
Sbjct: 247 VSQGTHNRQDASSYRIPIGLQFVWSCILGFGMLFLPESPRYYVLKDQLDLAAKSLAFLRG 306

Query: 274 VTIDDPATIQEIELVQIAVEAEQAAGSASWSELF---QTKTKVLQRTLMGVIVLALQQLT 330
           V  DD   ++E+  ++   + E + GS S+ + F   +++TK   R   G+ + A QQ +
Sbjct: 307 VPEDDSGLLEELVEIKANYDYEMSFGSFSYLDCFKSSKSRTKQKLRMFTGIAIQAFQQFS 366

Query: 331 GCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMV 390
           G N+ FYYG   F   G+  S+  S I   VN       L++V+  GRR  L++G   M 
Sbjct: 367 GINFIFYYGVNFFSKTGIGGSYLVSFITYAVNVGFNIPGLFLVEYMGRRKVLIFGGILMT 426

Query: 391 CCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPL 450
               V A VG  +          S  A   +I F C FI  F+ TW    + I +E +PL
Sbjct: 427 AANFVIAIVGCVE---------KSVIADKIVIAFVCLFIASFSATWGGCVWAISAELYPL 477

Query: 451 RVKAKGMALGTVSNQMWNFCIGFFTPFITGAINFYYGYVFLGCLVF---------SYCYV 501
            V++K  A+   SN + NF     TP++    N       LG  +F             V
Sbjct: 478 GVRSKCTAICAASNWLVNFICALITPYLIDTGNHTSS---LGTKIFFIWGSLNAVGVVIV 534

Query: 502 FAFVPETKGLQLEDVNLMWEEGVLPWKSASW 532
           +  V ET+GL LE+++L++        S SW
Sbjct: 535 YVAVYETRGLTLEEIDLLYRLSPNSLASDSW 565

>NCAS0A13880 Chr1 complement(2723605..2726001) [2397 bp, 798 aa]
           {ON} Anc_7.309
          Length = 798

 Score =  237 bits (604), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 156/534 (29%), Positives = 264/534 (49%), Gaps = 28/534 (5%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
           +++ SS   + H  +    +    +  +E  SQI+  P    S  +S  +    VA GGF
Sbjct: 66  QNMMSSIDDATHDEEHTFRISNTMESLSEDVSQILMEPLPMRSNVMSFLVGAF-VAVGGF 124

Query: 70  ISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
           + G+DTG I      +   +    +H     + +  +  ++VS  ++G   G++    + 
Sbjct: 125 LFGYDTGLINSLTDMAYVKSHLAPNH----HFFTNEQMSIVVSFLSLGTFFGALTAPVIA 180

Query: 130 DTVGRRKGIVIAV-FIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEIS 188
           D+ GR+  I+ +   I+ +G  +Q+AS   W    IGR+++GLG G I+ + P+  +E +
Sbjct: 181 DSYGRKATIMFSTAVIFSIGNSLQVAS-SGWKLLIIGRVVSGLGIGLISAVVPLYQAEAA 239

Query: 189 PKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIV 248
            K+LRG ++S YQ  IT G+ +    + GT+  +N   +R+P+GL + W+  +   M  +
Sbjct: 240 KKNLRGAIISTYQCAITLGLLVSSAVSQGTQHINNPASYRIPIGLQYVWSSFLAIGMIFL 299

Query: 249 PESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQ 308
           PESPRY V K  I+ A +S++    V I DP  ++E+  ++   + E + G +S  + F+
Sbjct: 300 PESPRYYVMKDDIDRAAKSLSFLRGVPIQDPRLLEELVEIKATYDYEASFGPSSIWDCFK 359

Query: 309 T---KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAS 365
           +   + K + R   G+ +   QQ +G N+ FYYG   F   G+  S+  SLI   VN A 
Sbjct: 360 SSENRPKQVLRMFTGIAIQTFQQFSGINFIFYYGVTFFSKTGVNKSYMVSLITYAVNVAF 419

Query: 366 TFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFS 425
               +++V+  GRR  LL+G   +     V A VG          +  S  A   MI F 
Sbjct: 420 NIPGMFLVEYLGRRKILLFGGIVVTASNFVIAGVGC---------RMDSVVANKVMIAFI 470

Query: 426 CFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI------- 478
           C FI  F+ TW+   +VI +E +PL V++K  A+   +N + NF     TP+I       
Sbjct: 471 CLFIASFSATWSGAVWVISAELYPLGVRSKCTAICAAANWLVNFICALITPYIVNSGSES 530

Query: 479 TGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASW 532
           T   N ++ +  L  L      VF  V ET GL LE+++ ++ E    + S +W
Sbjct: 531 TMGANIFFIWGSLNAL--GVVCVFFTVYETSGLTLEEIDELYRESANCFGSIAW 582

>Smik_10.14 Chr10 (23347..23814) [468 bp, 155 aa] {ON} YJL214W
           (REAL)
          Length = 155

 Score =  218 bits (554), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 105/155 (67%), Positives = 130/155 (83%)

Query: 405 WPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSN 464
           +PNG++QPSSKGAGN MIVF+CF+IFCF+ TW P+ +VIISE+FPLRV++K M++ T +N
Sbjct: 1   YPNGKNQPSSKGAGNCMIVFTCFYIFCFSCTWGPVCYVIISETFPLRVRSKCMSVATAAN 60

Query: 465 QMWNFCIGFFTPFITGAINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGV 524
            +W F IGFFTPFIT AI+FYYGYVF+GCL FSY YVF FVPETKGL LE+V+ MW +GV
Sbjct: 61  LLWGFLIGFFTPFITSAIDFYYGYVFMGCLAFSYFYVFFFVPETKGLSLEEVDEMWIDGV 120

Query: 525 LPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMF 559
           LPWKS SWVP S+R  DY+ E L  D+KP+YKR+F
Sbjct: 121 LPWKSTSWVPASRRNADYDNEKLQHDEKPLYKRLF 155

>NDAI0A02150 Chr1 (486774..489143) [2370 bp, 789 aa] {ON} Anc_7.309
          Length = 789

 Score =  234 bits (597), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 157/564 (27%), Positives = 281/564 (49%), Gaps = 47/564 (8%)

Query: 28  EMKKDSQDFNEI---------DSQIIEIPKKPASAYLSVC--IMCLMVAFGGFISGWDTG 76
           E++  ++  N I         D++ +++  +P     ++    +   VA GGF+ G+DTG
Sbjct: 56  ELESQNEQLNHISSITDRISMDAETLQLLSQPLPMRSNIMSFFVGAFVAVGGFLFGYDTG 115

Query: 77  TIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRK 136
            I   +           +H    +Y + ++  ++VS  ++G   G++    + D+ GR+K
Sbjct: 116 LINSLIDMEYVKTHLAPNH----EYFTTIQMSMIVSFLSMGTFFGALSAPFIADSYGRKK 171

Query: 137 GIVIAV-FIYIVGI-VIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRG 194
            I+ +  FI+ +G   +Q+A+ D W     GRI++G+G G I+ + P   +E + K+LRG
Sbjct: 172 TIIFSTAFIFSIGKNSLQVAASD-WKLLLGGRIVSGIGVGLISAVVPSYQAESAQKNLRG 230

Query: 195 TLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRY 254
            ++S YQ  IT G+ +    + GT    NS  +R+P+GL + W+  +   M  +PESPRY
Sbjct: 231 AIISTYQWAITIGLLVSSAVSQGTLNMRNSGSYRIPIGLQYVWSCFLAIGMLFLPESPRY 290

Query: 255 LVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELFQT---KT 311
            V K ++++A +S++    +TI DP  ++E+  ++   + E + G +++ + F+T   + 
Sbjct: 291 YVMKDELDKAAKSLSFLRGITIQDPRLLEELVEIKATYDYEASFGPSTFWDCFKTSPNRP 350

Query: 312 KVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALY 371
           K   R   G+ +   QQ +G N+ FYYG   F   G+ +S+  S+    VN       ++
Sbjct: 351 KQSLRMFTGIAIQTFQQFSGINFIFYYGVNFFNNTGVAESYLVSITTYAVNVVFNIPGMF 410

Query: 372 VVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFC 431
           +V+  GRR  LL+G   +     + ASVG +           S  A   MI F C FI  
Sbjct: 411 LVEMVGRRKILLFGGLIVTISNFIIASVGCST---------DSIIANKVMIAFICVFIAA 461

Query: 432 FATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI--TGAINFYYG-- 487
           F+ +W  + +VI +E +PL V++K  A+   +N + NF   F TPF+  TG+     G  
Sbjct: 462 FSASWGGVVWVISAELYPLGVRSKCTAICAATNWLINFICAFITPFLVDTGSHTSTMGAK 521

Query: 488 --YVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVP---------PS 536
             +++ G        V+  V ET GL LE+++ ++ +    ++SA W           P 
Sbjct: 522 IFFIWGGLNALGVIVVYFTVYETGGLTLEEIDELYTKSPNSFESAKWNKIIRERPLGNPI 581

Query: 537 QRGTDY--NAEALATDDKPIYKRM 558
            R T    N + +  DD+ I K++
Sbjct: 582 NRVTSLKINNKVINKDDENITKKI 605

>KNAG0B02810 Chr2 (541349..543745) [2397 bp, 798 aa] {ON} Anc_7.309
           YDL194W
          Length = 798

 Score =  233 bits (594), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 153/504 (30%), Positives = 265/504 (52%), Gaps = 37/504 (7%)

Query: 45  EIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSK 104
           E P+K ++  +   ++ + VA GGF+ G+DTG I   ++  +Y+    + + +     + 
Sbjct: 109 EPPRKQSN--MMSLLVGIFVAVGGFLFGYDTGLINS-IAEMNYVKEHLTPNRNA---FTT 162

Query: 105 VRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIA-VFIYIVGIVIQIASIDKWYQYF 163
               ++VS  ++G  +G+++   L D+ GR+K I+ + V I+ VG  +Q+ +        
Sbjct: 163 KEMAIVVSFLSMGTFVGALMAPFLSDSWGRKKTIIASTVVIFSVGNSLQVGAASMTL-LV 221

Query: 164 IGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDN 223
           +GR+++GL  G I+ + P+  +E + K LRG ++S YQ  IT+G+ +    + GT   ++
Sbjct: 222 VGRVVSGLAIGVISAVVPLYQAEAAKKELRGAIISTYQWAITWGLLVSSAISQGTYKRND 281

Query: 224 SIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQ 283
              +R+P+GL + W+ ++   M  +PESPRY V K  ++ A +S+A    V + D   ++
Sbjct: 282 PSSYRIPIGLQYVWSTILAVGMCFLPESPRYFVLKDDLDCAAKSLAFLRGVPVHDSGLLE 341

Query: 284 EIELVQIAVEAEQAAGSASWSELFQTKTKVLQRTL---MGVIVLALQQLTGCNYFFYYGT 340
           E+  ++   + E++ GS+S+ + F +  K  ++TL    G+ + A QQ +G N+ FYYG 
Sbjct: 342 ELVEIKATFDYERSIGSSSFLDCFISSKKRPKQTLRMFTGIAIQAFQQFSGINFIFYYGI 401

Query: 341 IIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVG 400
             F+  G+++S+  S I   VN A +   L++VD  GRR  L++G  GM     + A VG
Sbjct: 402 NFFRKSGIQNSYIISFITYAVNVAFSIPGLFLVDHLGRRKVLIYGGIGMTVSNFIVAIVG 461

Query: 401 VTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALG 460
           V+          +S  + N  I F C FI  F+ TW    +VI +E + L V+AK  A+ 
Sbjct: 462 VST---------NSVVSSNVTIAFICVFIASFSATWGGAVWVISAELYSLGVRAKCTAIC 512

Query: 461 TVSNQMWNFCIGFFTPFIT-----------GAINFYYGYV-FLGCLVFSYCYVFAFVPET 508
             SN + NF   F TP+I              I F +G +  LG LV     V+  V ET
Sbjct: 513 AASNWLVNFACAFMTPYIVNRRTKDSSSMGAKIYFIWGSLNALGLLV-----VYLTVYET 567

Query: 509 KGLQLEDVNLMWEEGVLPWKSASW 532
           KGL+LE ++ +++       S  W
Sbjct: 568 KGLRLEQIDELYKNSPNSRASTKW 591

>YDL194W Chr4 (111580..114234) [2655 bp, 884 aa] {ON}  SNF3Plasma
           membrane low glucose sensor that regulates glucose
           transport; contains 12 predicted transmembrane segments
           and a long C-terminal tail required for induction of
           hexose transporters; also senses fructose and mannose;
           similar to Rgt2p
          Length = 884

 Score =  233 bits (595), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 166/573 (28%), Positives = 285/573 (49%), Gaps = 52/573 (9%)

Query: 16  TAGSVHSSQSFQEMKKDSQ---------DFNEIDSQII---EIPKKPASAYLSVCIMCLM 63
           T GS+ +  S Q    D Q         D + ID   I   E P+K  S  +S+C+  + 
Sbjct: 46  TTGSIRTPTSLQRQNSDRQSNMTSVFTDDISTIDDNSILFSEPPQK-QSMMMSICV-GVF 103

Query: 64  VAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSV 123
           VA GGF+ G+DTG I    S  +Y+    + + D     +  +  +LVS  ++G   G++
Sbjct: 104 VAVGGFLFGYDTGLINSITSM-NYVKSHVAPNHDS---FTAQQMSILVSFLSLGTFFGAL 159

Query: 124 VLGRLGDTVGRRKGIVIA-VFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPM 182
               + D+ GR+  I+ + +FI+ +G  +Q+ +        +GR+I+G+G G I+ + P+
Sbjct: 160 TAPFISDSYGRKPTIIFSTIFIFSIGNSLQVGA-GGITLLIVGRVISGIGIGAISAVVPL 218

Query: 183 LISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMI 242
             +E + K LRG ++S YQ  IT+G+ +    + GT   +++  +R+P+GL + W+  + 
Sbjct: 219 YQAEATHKSLRGAIISTYQWAITWGLLVSSAVSQGTHARNDASSYRIPIGLQYVWSSFLA 278

Query: 243 GAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS 302
             MF +PESPRY V K +++EA +S++    V + D   ++E+  ++   + E + GS++
Sbjct: 279 IGMFFLPESPRYYVLKDKLDEAAKSLSFLRGVPVHDSGLLEELVEIKATYDYEASFGSSN 338

Query: 303 WSELF---QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFG 359
           + + F   +++ K   R   G+ + A QQ +G N+ FYYG   F   G+ +S+  S I  
Sbjct: 339 FIDCFISSKSRPKQTLRMFTGIALQAFQQFSGINFIFYYGVNFFNKTGVSNSYLVSFITY 398

Query: 360 IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGN 419
            VN       L+ V+ +GRR  L+ G   M     + A VG +           +  A  
Sbjct: 399 AVNVVFNVPGLFFVEFFGRRKVLVVGGVIMTIANFIVAIVGCSL---------KTVAAAK 449

Query: 420 TMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI- 478
            MI F C FI  F+ TW  + +VI +E +PL V++K  A+   +N + NF     TP+I 
Sbjct: 450 VMIAFICLFIAAFSATWGGVVWVISAELYPLGVRSKCTAICAAANWLVNFICALITPYIV 509

Query: 479 -TGA--------INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKS 529
            TG+        I F +G +    ++  Y  V+    ETKGL LE+++ ++       KS
Sbjct: 510 DTGSHTSSLGAKIFFIWGSLNAMGVIVVYLTVY----ETKGLTLEEIDELY------IKS 559

Query: 530 ASWVPPSQRGTDYNAEALATDDKPIYKRMFSKN 562
           ++ V   +   D    AL     P+ +    KN
Sbjct: 560 STGVVSPKFNKDIRERALKFQYDPLQRLEDGKN 592

>TDEL0C02370 Chr3 (416622..418817) [2196 bp, 731 aa] {ON} Anc_7.309
           YDL194W
          Length = 731

 Score =  231 bits (588), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 156/533 (29%), Positives = 269/533 (50%), Gaps = 29/533 (5%)

Query: 14  SSTAGSVHSSQSFQ--EMKKDSQDFNEID--SQIIEIPKKPASAYLSVCIMCLMVAFGGF 69
           +S      S+  FQ   +   S + +E+D  S +   P +P S  +++ +   +   G  
Sbjct: 52  TSMVSEAQSAGDFQMNRLSNMSDEMSEVDDASLLFSQPPQPQSNLMTIVVGVFVAVGGFL 111

Query: 70  ISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLG 129
             G+DTG I   +  +         H    +  S     ++VS  ++G  IG++    L 
Sbjct: 112 F-GYDTGLINSIIDMNYVRTNLAPDH----EGFSAREMAIIVSFLSLGTFIGALSAPLLS 166

Query: 130 DTVGRRKGIVIA-VFIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEIS 188
           D+ GR+  I+ + V ++++G  +Q+A+         GR+I+GLG G I+ + P+   E +
Sbjct: 167 DSYGRKATIIFSTVVVFLIGNSLQVAA-HSVKLLIAGRVISGLGIGLISAVVPLYQGEAA 225

Query: 189 PKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIV 248
            K LRG ++S YQ  IT+G+ +    + GT + +++  +R+P+GL + WALV+   M  +
Sbjct: 226 NKFLRGAIISTYQWAITWGLLVSSAVSQGTHSRNDASSYRIPIGLQYVWALVLAVGMLFL 285

Query: 249 PESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELF- 307
           PESPR+ V K ++++A +S++    V I D   ++E+  ++   + E + GS+S  + F 
Sbjct: 286 PESPRFYVLKDELDKAAKSLSFLRSVPITDAGLLEELVEIKATYDYEASFGSSSVLDCFR 345

Query: 308 --QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFAS 365
             +++ K   R L G+ + A QQ +G N+ FYYG   F   G+ +S+  S I   VN A 
Sbjct: 346 SSRSRPKQTLRMLSGIAIQACQQFSGINFIFYYGVNFFNKTGITNSYLVSFITYAVNVAF 405

Query: 366 TFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFS 425
               L++VD+ GRR  LL+G   M     + A VG +          +S  A   MI F 
Sbjct: 406 NIPGLFLVDRVGRRKILLFGGVFMTASNFIIAIVGCST---------NSVVANKVMIAFI 456

Query: 426 CFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI--TGAIN 483
           C FI  F+ TW    +VI +E +PL V++K  A+   SN + NF   F TP+I  TG+  
Sbjct: 457 CVFIASFSATWGGGVWVISAELYPLGVRSKCTAICAASNWLVNFICAFITPYIVDTGSHT 516

Query: 484 FYYG----YVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASW 532
              G    +++          V+  + ET+GL LE+++ ++ +     +SA W
Sbjct: 517 SSMGPKIFFIWGSLNALGVVVVYFTIYETRGLTLEEIDELYSKSPNSIQSAKW 569

>CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highly
           similar to uniprot|P10870 Saccharomyces cerevisiae
           YDL194w SNF3 or uniprot|Q12300 Saccharomyces cerevisiae
           YDL138w RGT2
          Length = 856

 Score =  231 bits (590), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 151/497 (30%), Positives = 257/497 (51%), Gaps = 27/497 (5%)

Query: 47  PKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVR 106
           P +  S  +S+ +    VA GGF+ G+DTG I   +           +H       +  +
Sbjct: 110 PPQKQSHMMSIVVGAF-VAVGGFLFGYDTGLINSIVDMRYVRENIAPNHVG----FTAQQ 164

Query: 107 TGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAV-FIYIVGIVIQIASIDKWYQYFI- 164
             +LVS  ++G  +G++    + D  GR+K I+ +   ++ +G  +Q+ + +   Q  I 
Sbjct: 165 LAILVSFLSLGTFVGALSAPVISDKYGRKKTIMFSTAVVFSLGNSLQVGAHN--IQLLIA 222

Query: 165 GRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNS 224
           GR+I+GLG G ++ + P+  +E + K LRG ++S YQ  IT+G+ +    + GT   +++
Sbjct: 223 GRVISGLGVGLVSAVVPLYQAEAAHKSLRGAIISTYQWAITWGLLVSSAVSQGTHNRNDA 282

Query: 225 IQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQE 284
             +R+P+GL + WA ++   M  +PESPRY V + Q+++A +S++    V I D   ++E
Sbjct: 283 SSYRIPIGLQYVWAYILAAGMLWLPESPRYYVLRDQLDKAAQSLSFLRGVPIHDSGLLEE 342

Query: 285 IELVQIAVEAEQAAGSASWSELFQTKTKVLQRTL---MGVIVLALQQLTGCNYFFYYGTI 341
           +  ++   + E + G  ++ + F++     ++TL    G+ + A QQ +G N+ FYYG  
Sbjct: 343 LVEIKATFDYESSFGKTTFWDCFKSNKSRPKQTLRMFTGIAIQAFQQFSGINFIFYYGVS 402

Query: 342 IFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGV 401
            F   G+E+S+  SLI   VN   +   +++V+ +GRR+ LL+G A M     + A VG 
Sbjct: 403 FFNRSGVENSYIVSLITYAVNVGFSVPGMFLVEYFGRRSVLLYGGAIMTLSNFIIAIVGS 462

Query: 402 TKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGT 461
           +           S  A   MI F C FI  FA TW  + +VI +E +PL V+AK  A+  
Sbjct: 463 ST---------QSVVANKVMIAFICLFIASFAATWGGVVWVISAELYPLGVRAKCTAICA 513

Query: 462 VSNQMWNFCIGFFTPFI--TGAINFYYG---YVFLGCL-VFSYCYVFAFVPETKGLQLED 515
            +N + NF   F TP+I  TG      G   Y   G L       V+  V ET+GL LE+
Sbjct: 514 AANWLINFVCAFITPYIVDTGERRALIGPKIYFIWGSLNALGILVVYFTVYETRGLTLEE 573

Query: 516 VNLMWEEGVLPWKSASW 532
           ++ ++ +      SA W
Sbjct: 574 IDELYTKSPNGIVSAKW 590

>ADR091W Chr4 (872923..874917) [1995 bp, 664 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL194W (SNF3) and
           YDL138W (RGT2)
          Length = 664

 Score =  228 bits (580), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 154/548 (28%), Positives = 273/548 (49%), Gaps = 42/548 (7%)

Query: 6   SPTGEDVHSSTAGSVHSSQSFQE------MKKDSQDFNEIDSQIIEIPKKPASAYLSVCI 59
           S T ++ HS       ++  +++      ++ DS+ F+ I    +E P    S  +S+ +
Sbjct: 38  SETSDEKHSKGCNDQKNASHYEQPVMVTDLRDDSEGFS-IQETELERPAMRQSNKMSI-L 95

Query: 60  MCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCA 119
           + + VA GGF+ G+DTG I      S     F  +H +     + +   +LVS  ++G  
Sbjct: 96  VGIFVAVGGFLYGYDTGLINSITEMSFVKKHFAPNHVN----FTSMEMSILVSFLSLGTF 151

Query: 120 IGSVVLGRLGDTVGRRKGIVIAVFI-YIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAV 178
           IG++    L D+ GR+  ++ + FI ++ G ++Q+++         GR+ +G+  G I+V
Sbjct: 152 IGALAAPLLADSYGRKSTVIFSTFIMFLEGTLLQVSATSMAL-LVAGRVASGVAVGLISV 210

Query: 179 LSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWA 238
           + P+   E + K  RG ++  YQ  IT+G+ +    + GT   +++  +R+P+ L + W 
Sbjct: 211 VVPLYQGEAAQKWCRGAIICTYQWAITWGLLVSSAVSQGTYLRNDASSYRIPIALQYVWC 270

Query: 239 LVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAA 298
           +++   M ++PESPRY V + Q+++A  S++    V  DD   ++E+  ++   + E + 
Sbjct: 271 IILGSGMLLLPESPRYYVLRDQLDKAALSLSFLRGVPHDDAGLLEELVEIKANYDYEMSL 330

Query: 299 GSASWSELFQT---KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTS 355
            S+S+ + F+T   + K   R L G+++ A QQ +G N+ FYYG   F + G+  S+  S
Sbjct: 331 KSSSYLDCFRTSEHRPKQQIRMLSGILLQAFQQFSGINFIFYYGVNFFSSTGISKSYLVS 390

Query: 356 LIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSK 415
            +   VN       L++V+  GRR  LL G   M     + A VGV+           S 
Sbjct: 391 FVTYAVNVVFNIPGLFLVEYAGRRKLLLVGGVLMTISNFIIAIVGVST---------DSV 441

Query: 416 GAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFT 475
            A   MIVF C FI  F+ TW  + +V+ +E +PL V++K  A+   SN + NF     T
Sbjct: 442 IAKKVMIVFICMFIAAFSATWGGVVWVMSAEMYPLGVRSKCAAICAASNWLVNFVCAMIT 501

Query: 476 PFIT----------GAINFYYGYV-FLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGV 524
           P++             I F +G +  +G +V     V+  V ET GL LE++N ++    
Sbjct: 502 PYLIDISSYTSRLGSTIFFVWGSLNAIGVMV-----VYLTVYETSGLTLEEINELYRRCP 556

Query: 525 LPWKSASW 532
               S +W
Sbjct: 557 SSLASCAW 564

>KAFR0B01080 Chr2 (204541..206721) [2181 bp, 726 aa] {ON} Anc_7.309
           YDL194W
          Length = 726

 Score =  228 bits (582), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 153/569 (26%), Positives = 272/569 (47%), Gaps = 50/569 (8%)

Query: 10  EDVHSSTAGSVHSSQSFQEMKKDSQDFNEIDS-----------QIIEIPKKPASAYLSVC 58
           +D+   +  S+ S   F   +K ++  N++++            ++  P  P  + +   
Sbjct: 3   KDIPKLSKRSIMSKLRFVRREKSTEQTNQVNNSDGDEELFDNLNLLSQPL-PLRSNIMSS 61

Query: 59  IMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGC 118
           ++ L VA GGF+ G+DTG I         +     +HS      S  +  +LVS  ++G 
Sbjct: 62  LVGLFVAVGGFLYGYDTGLINSITGMPYVLQHLTPNHSS----FSNTQLSILVSFLSLGT 117

Query: 119 AIGSVVLGRLGDTVGRRKGIVIAV-FIYIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIA 177
             G++    + D  GR+  I+++   I+ +G  +Q+A+        +GR+++G G G I+
Sbjct: 118 FFGALTAPWISDIYGRKPAIIVSTAVIFSIGNSLQVAA-KSLTLLIVGRVVSGFGIGIIS 176

Query: 178 VLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAW 237
            + P+  +E + K+LRG ++S YQ  IT G+ +    + GT   D++  +R+P+GL + W
Sbjct: 177 AVVPLYQAEAAQKNLRGAIISSYQWAITIGLLVSSAVSQGTYRMDSAASYRIPIGLQYVW 236

Query: 238 ALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQA 297
           + V+   M  +PESPRY V K  I  A  +++    + I DP  ++E+  ++   + E +
Sbjct: 237 SSVLAVGMIFLPESPRYYVLKDDINNAAIALSFLRGIPIQDPRLLEELVEIKATYDYEAS 296

Query: 298 AGSASWSELFQT---KTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQT 354
            G AS  + F++   + K + R   G+ +   QQ +G N+FFYYG   F   G+ +++  
Sbjct: 297 FGPASLLDCFRSSENRPKQVLRMFTGIALQIFQQFSGINFFFYYGVSFFSETGIHNNYLV 356

Query: 355 SLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSS 414
           S I   VN       +++V+ +GRR  LL+G   M     +   +  T         P+ 
Sbjct: 357 SFITYSVNMLFNIPGMFLVEFFGRRKVLLYGGVLMTISNFIIPIIDATV--------PTY 408

Query: 415 KGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFF 474
            G+   MI F+C FI  FA TW  + +VI +E +PL V++K  A+   +N   NF   F 
Sbjct: 409 DGS-KIMIAFACLFIASFAATWGGVVWVISAELYPLGVRSKCAAICASANWFANFICAFI 467

Query: 475 TPFITG----------AINFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMWEEGV 524
           TP+I             I F +G +     + +Y  V+    ETKGL LE+++ ++    
Sbjct: 468 TPYIVNLGDEASETKSKIFFLWGSLNAVGFIIAYLTVY----ETKGLTLEEIDELYR--- 520

Query: 525 LPWKSASWVPPSQRGTDYNAEALATDDKP 553
              KS S    ++         +  D +P
Sbjct: 521 ---KSPSCFASTKYNEKIRERPVTQDTRP 546

>TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {ON}
           Anc_7.309 YDL194W
          Length = 880

 Score =  230 bits (587), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 249/503 (49%), Gaps = 32/503 (6%)

Query: 47  PKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVR 106
           P +  S  +++ +    V  GGF+ G+DTG I   L     ++    +++    Y +   
Sbjct: 118 PPQKQSLIMTIAVGAF-VTVGGFLFGYDTGLINSVLEMKYVLDNIAPNNT----YFTAKE 172

Query: 107 TGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIA-VFIYIVGIVIQIASIDKWYQYFIG 165
             ++VS  ++G  +G+++   + D  GR+  I+++   I+ +G  +Q+ S      +  G
Sbjct: 173 QSIMVSFLSLGTFLGALIAPFIADRYGRKITIILSSTLIFFLGNSLQVGS-HGIGLFVAG 231

Query: 166 RIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSI 225
           R I+G+  G ++ + P+  +E +PK LRGT++S YQ  IT+G+ +    + GTK  +N  
Sbjct: 232 RFISGVAIGMVSAVVPLYQAEAAPKQLRGTIISMYQWAITWGLLVSSAVSQGTKNINNPS 291

Query: 226 QWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEI 285
            +R+P+GL + WA  +   M  +PESPR+ V +  ++EA RS++    V + D A ++E+
Sbjct: 292 SYRIPIGLQYVWAAFLAAGMLFLPESPRFYVLRDNLDEAARSLSFLRGVPVHDSALLEEL 351

Query: 286 ELVQIAVEAEQAAGSASWSELF---QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTII 342
             ++   + E A GS S+ + F   +T+ K   R   G+ + A QQ  G N+ FYYG   
Sbjct: 352 VEIKANYDYEAAVGSTSFWDCFISTETRPKETLRMFTGLGIQAFQQFAGINFVFYYGVNF 411

Query: 343 FKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVT 402
           F+   +E S+  S I   VN       L +V+  GRR  L+ G   M  C  + A  G  
Sbjct: 412 FEKTAVESSYIISFITYAVNVFFNVPGLLLVEYIGRRDLLISGGILMTTCNFIIAGAGCL 471

Query: 403 KLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTV 462
                  +  SSK     MI F C F+  F+ TW    +VI +E FPL V++K  A+   
Sbjct: 472 -----SDNVISSK----VMIAFICCFVASFSATWGGTVWVICAELFPLGVRSKASAMCAA 522

Query: 463 SNQMWNFCIGFFTPFIT-------------GAINFYYGYVFLGCLVFSYCYVFAFVPETK 509
           SN + NF   F TP+I              G       +++ GC   +    +  + ET 
Sbjct: 523 SNWLANFVCAFITPYIVSTGKNKNNPDSDGGGFGSKIFFIWGGCTALATFLAYFTIYETS 582

Query: 510 GLQLEDVNLMWEEGVLPWKSASW 532
           GL LE+VN ++++    ++S  W
Sbjct: 583 GLTLEEVNELYKKCPTSFQSKKW 605

>TPHA0A03110 Chr1 (684324..686762) [2439 bp, 812 aa] {ON} Anc_7.309
           YDL194W
          Length = 812

 Score =  229 bits (584), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 156/510 (30%), Positives = 261/510 (51%), Gaps = 38/510 (7%)

Query: 47  PKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVR 106
           P +  S  +S+ +M + VA GGF+ G+DTG I   +  +     F +   DG  + +  +
Sbjct: 152 PAQEQSNQVSI-LMGIFVAVGGFLYGYDTGLINSIVDMNYVKENFTN---DG--FFTAKQ 205

Query: 107 TGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVI-AVFIYIVGIVIQIASIDKWYQYFIG 165
             ++VS  ++G   G++    L D VGR+  +++ A FI++VG  +Q+A+        +G
Sbjct: 206 LSIIVSFLSLGTFGGALFAPFLADVVGRKPPVIMSAAFIFLVGNTLQVAATGITL-LTVG 264

Query: 166 RIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSI 225
           R+I+G+  G I+V+ P+   E S K LRG ++S YQ  IT+G+ +    + GT   +N+ 
Sbjct: 265 RVISGVAVGIISVVVPLYQGEASKKSLRGAIISTYQWAITWGLLVSSAVSQGTYRRNNAS 324

Query: 226 QWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEI 285
            +R+P+ L + W+  +   M  +PESPR+ V + ++++A  S++    V + D   ++E+
Sbjct: 325 SYRIPIALQYIWSCTLALGMIFLPESPRFFVLQDKLDKAASSLSFLRGVPVQDSGLLEEL 384

Query: 286 ELVQIAVEAEQAAGSASWSELF---QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTII 342
             ++   + E + G+A++ + F   +++ K   R   G+ + A QQ +G N+ FYYG   
Sbjct: 385 VEIKATYDYELSFGTATFWDCFKSNKSRPKQTLRMFTGIAINAFQQFSGINFIFYYGVNF 444

Query: 343 FKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVT 402
           F   G+ +S++ S I   VN A     +++VD  GRRT L++G   M     V A VG  
Sbjct: 445 FSRSGIPNSYRISFITYAVNVAFNVPGMFLVDYSGRRTLLIYGGIVMAVSNFVIAGVGTA 504

Query: 403 KLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTV 462
                      +  A   M+ F C FI  FA TW    +VI +E +PL V++K M++   
Sbjct: 505 ---------VDTIVADKVMVAFICLFIASFACTWGSTVWVISAELYPLGVRSKCMSICAA 555

Query: 463 SNQMWNFCIGFFTPFIT---GAINFYYGYVFL---GCLVFSYCYVFAFVPETKGLQLEDV 516
           SN + NF   F TP+I    G  +F    +F    G         +  V ETKGL LE++
Sbjct: 556 SNWLVNFICAFITPYIVDIDGHTSFVGPKIFFLWGGLNTIGLLIAYFTVYETKGLTLEEI 615

Query: 517 NLMWEEGVLPWKSASWVPPSQR-GTDYNAE 545
           N ++E           V PS R   +YNA 
Sbjct: 616 NELFE-----------VCPSPRMSKEYNAN 634

>KLLA0F05181g Chr6 (510384..512747) [2364 bp, 787 aa] {ON}
           uniprot|O13477 Kluyveromyces lactis RAG4 Putative
           glucose sensor
          Length = 787

 Score =  228 bits (581), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 156/548 (28%), Positives = 280/548 (51%), Gaps = 37/548 (6%)

Query: 4   SQSPTGEDVHSSTAGSV------HSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASAYLSV 57
           S+ PTG   ++++A S       +S ++F+     S   +E++S+I   P    S  +S+
Sbjct: 33  SEVPTGGKSNNASATSSPEEALENSGENFELTNFAS--LSEMESEIFLAPPAKQSKKISI 90

Query: 58  CIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIFNVG 117
            +  + VA GGF+ G+DTG I   +S   Y+N+     +    + +  +  +LVS  ++G
Sbjct: 91  LV-GMFVAVGGFLFGYDTGLINN-ISEMPYVNQ---KFAPNKNHFTTPQISILVSFLSLG 145

Query: 118 CAIGSVVLGRLGDTVGRRKGIVIAVFI-YIVGIVIQIASIDKWYQYFIGRIIAGLGSGTI 176
             IG+++   + D+ GR+  ++ + F+ +++G  +Q+A+        +GR+++G+  G I
Sbjct: 146 TFIGALLAPLISDSYGRKTTMIFSTFVVFMIGNSLQVAA-GSMTILVVGRVLSGMSVGLI 204

Query: 177 AVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFA 236
           +   P+  SE + K +RG ++SCYQ  IT+G+ +    + GT    ++  +++P+GL + 
Sbjct: 205 SAAVPLYQSEAAQKSVRGAIISCYQWAITWGLLVASAVSQGTYKRMDASSYQIPIGLQYI 264

Query: 237 WALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQ 296
           W+ ++   +  +PESPRY V K ++++A +S++    V  DD   ++E+  ++   + E 
Sbjct: 265 WSFLLGVGILFLPESPRYYVFKDRLDKAAKSLSFLRGVPEDDSGLLEELVEIKATYDYEM 324

Query: 297 AAGSASWSELF---QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQ 353
           + G  S+ + F   +++TK   R L G+ + A QQ++G N+ FYYG   F   G+ +S+ 
Sbjct: 325 SFGKISYLDCFRSTRSRTKQRLRMLTGIALQAFQQVSGINFIFYYGVDFFNKSGVSESYL 384

Query: 354 TSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPS 413
            S +   VN A     L++V+  GRR  LL G   M     + A VG+            
Sbjct: 385 VSFVTYAVNVAFNIPGLFLVEYIGRRKLLLMGGILMTISNFIIAIVGLAT---------D 435

Query: 414 SKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGF 473
           S  A   MI F C FI  F+ TW    +VI +E +PL V+AK  A+   SN + NF    
Sbjct: 436 SMVANKVMIAFICLFIASFSATWGGGVWVISAELYPLGVRAKCTAICAASNWLINFICAL 495

Query: 474 FTPFITGAINFYYGYVFLGCLVF---------SYCYVFAFVPETKGLQLEDVNLMWEEGV 524
            TP+I   I+       +G  +F             V+  V ET GL LE+++ ++++  
Sbjct: 496 ITPYIM-HIDSSVRQTSIGTKIFFVWGSLNAVGVLVVYFTVYETNGLSLEEIDELYKKSS 554

Query: 525 LPWKSASW 532
               S  W
Sbjct: 555 SGINSIEW 562

>Skud_4.116 Chr4 (208941..211250) [2310 bp, 769 aa] {ON} YDL138W
           (REAL)
          Length = 769

 Score =  224 bits (572), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 154/506 (30%), Positives = 271/506 (53%), Gaps = 26/506 (5%)

Query: 38  EIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRF-GSSHS 96
           E  S ++  P    S  +SV ++ + VA GGF+ G+DTG I   ++   Y+  +   +HS
Sbjct: 81  ETTSILLSQPLPLRSNVMSV-LVGIFVAVGGFLFGYDTGLINS-ITDMPYVKTYIAPNHS 138

Query: 97  DGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAV-FIYIVGIVIQIAS 155
           +     +  +  +LVS  ++G   G+++   + D+ GR+  I+ +   I+ +G  +Q+AS
Sbjct: 139 N----FTTNQIAILVSFLSLGTFFGALIAPYISDSYGRKPTIMFSTAIIFSIGNSLQVAS 194

Query: 156 IDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTN 215
                   +GR+I+G+G G I+ + P+  +E + K+LRG ++S YQ  IT G+ +    +
Sbjct: 195 -GGLVLLIVGRVISGIGIGIISAVVPLYQAEAAQKNLRGAIISSYQWAITIGLLVSSAVS 253

Query: 216 YGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVT 275
            GT + +    +R+P+GL + W+ V+   M  +PESPRY V K ++ +A +S++    + 
Sbjct: 254 QGTHSKNGPSSYRIPIGLQYVWSSVLAVGMIFLPESPRYYVLKDELNKAAKSLSFLRGLP 313

Query: 276 IDDPATIQEIELVQIAVEAEQAAGSASWSELFQT---KTKVLQRTLMGVIVLALQQLTGC 332
           I+DP  ++E+  ++   + E + G ++  + F+T   + K + R   G+ + A QQ +G 
Sbjct: 314 IEDPRLLEELVEIKATYDYEASFGPSTLLDCFKTSENRPKQVLRIFTGIAIQAFQQASGI 373

Query: 333 NYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCC 392
           N+ FYYG   F   G++ S+  S I   VN A +   +Y+VD+ GRR  LL G   M   
Sbjct: 374 NFIFYYGVNFFNNTGVDSSYLVSFISYAVNVAFSIPGMYLVDRIGRRPVLLAGGCIMAVA 433

Query: 393 MVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRV 452
            +V A VGV++    G+   +SK     MI F C FI  F+ TW  + +V+ +E +PL V
Sbjct: 434 NLVIAIVGVSE----GKTVVASK----VMIAFICLFIAAFSATWGGVVWVVSAELYPLGV 485

Query: 453 KAKGMALGTVSNQMWNFCIGFFTPFI------TGAINFYYGYVFLGCLVFSYCYVFAFVP 506
           ++K  A+   SN + NF     TP+I      T +I     +++ G  V +   V+  V 
Sbjct: 486 RSKCAAICAASNWLVNFICALITPYIVDVGSHTSSIGPKIFFIWGGLNVVAVIVVYFAVY 545

Query: 507 ETKGLQLEDVNLMWEEGVLPWKSASW 532
           ET+GL LE+++ ++ +      S+ W
Sbjct: 546 ETRGLTLEEIDELFRKAPNSVTSSKW 571

>YDL138W Chr4 (213351..215642) [2292 bp, 763 aa] {ON}  RGT2Plasma
           membrane high glucose sensor that regulates glucose
           transport; contains 12 predicted transmembrane segments
           and a long C-terminal tail required for induction of
           hexose transporters; highly similar to Snf3p
          Length = 763

 Score =  224 bits (572), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 152/506 (30%), Positives = 272/506 (53%), Gaps = 26/506 (5%)

Query: 38  EIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRF-GSSHS 96
           E  S ++  P    S  +SV ++ + VA GGF+ G+DTG I   ++   Y+  +   +HS
Sbjct: 81  ETTSILLSQPLPLRSNVMSV-LVGIFVAVGGFLFGYDTGLINS-ITDMPYVKTYIAPNHS 138

Query: 97  DGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAV-FIYIVGIVIQIAS 155
               Y +  +  +LVS  ++G   G+++   + D+ GR+  I+ +   I+ +G  +Q+AS
Sbjct: 139 ----YFTTSQIAILVSFLSLGTFFGALIAPYISDSYGRKPTIMFSTAVIFSIGNSLQVAS 194

Query: 156 IDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTN 215
                   +GR+I+G+G G I+ + P+  +E + K+LRG ++S YQ  IT G+ +    +
Sbjct: 195 -GGLVLLIVGRVISGIGIGIISAVVPLYQAEAAQKNLRGAIISSYQWAITIGLLVSSAVS 253

Query: 216 YGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVT 275
            GT + +    +R+P+GL + W+ ++   M  +PESPRY V K ++ +A +S++    + 
Sbjct: 254 QGTHSKNGPSSYRIPIGLQYVWSSILAVGMIFLPESPRYYVLKDELNKAAKSLSFLRGLP 313

Query: 276 IDDPATIQEIELVQIAVEAEQAAGSASWSELFQT---KTKVLQRTLMGVIVLALQQLTGC 332
           I+DP  ++E+  ++   + E + G ++  + F+T   + K + R   G+ + A QQ +G 
Sbjct: 314 IEDPRLLEELVEIKATYDYEASFGPSTLLDCFKTSENRPKQILRIFTGIAIQAFQQASGI 373

Query: 333 NYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCC 392
           N+ FYYG   F   G+++S+  S I   VN A +   +Y+VD+ GRR  LL G   M   
Sbjct: 374 NFIFYYGVNFFNNTGVDNSYLVSFISYAVNVAFSIPGMYLVDRIGRRPVLLAGGVIMAIA 433

Query: 393 MVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRV 452
            +V A VGV++    G+   +SK     MI F C FI  F+ TW  + +V+ +E +PL V
Sbjct: 434 NLVIAIVGVSE----GKTVVASK----IMIAFICLFIAAFSATWGGVVWVVSAELYPLGV 485

Query: 453 KAKGMALGTVSNQMWNFCIGFFTPFI------TGAINFYYGYVFLGCLVFSYCYVFAFVP 506
           ++K  A+   +N + NF     TP+I      T ++     +++ G  V +   V+  V 
Sbjct: 486 RSKCTAICAAANWLVNFTCALITPYIVDVGSHTSSMGPKIFFIWGGLNVVAVIVVYFAVY 545

Query: 507 ETKGLQLEDVNLMWEEGVLPWKSASW 532
           ET+GL LE+++ ++ +      S+ W
Sbjct: 546 ETRGLTLEEIDELFRKAPNSVISSKW 571

>Smik_4.97 Chr4 (189933..192236) [2304 bp, 767 aa] {ON} YDL138W
           (REAL)
          Length = 767

 Score =  224 bits (572), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 154/510 (30%), Positives = 273/510 (53%), Gaps = 34/510 (6%)

Query: 38  EIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS-SHS 96
           E  S ++  P    S  +SV ++ + VA GGF+ G+DTG I   ++   Y+  + S +HS
Sbjct: 83  ETTSILLSQPLPLRSNIMSV-LVGIFVAVGGFLFGYDTGLINS-ITDMPYVKTYISPNHS 140

Query: 97  DGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAV-FIYIVGIVIQIAS 155
               Y +  +  +LVS  ++G   G+++   + D+ GR+  I+ +   I+ +G  +Q+AS
Sbjct: 141 ----YFTTNQIAMLVSFLSLGTFFGALIAPYISDSYGRKPTIMFSTAVIFSIGNSLQVAS 196

Query: 156 IDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTN 215
            +      +GR+I+G+G G I+ + P+  +E + K+LRG ++S YQ  IT G+ +    +
Sbjct: 197 -NGLVLLIVGRVISGIGIGIISAVVPLYQAEAAQKNLRGAIISSYQWAITIGLLVSSAVS 255

Query: 216 YGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVT 275
            GT + ++   +R+P+GL + W+ V+   M  +PESPRY V K ++ +A +S++    + 
Sbjct: 256 QGTHSKNSPSSYRIPIGLQYVWSSVLAVGMIFLPESPRYYVLKDELNKAAKSLSFLRGLP 315

Query: 276 IDDPATIQEIELVQIAVEAEQAAGSASWSELFQT---KTKVLQRTLMGVIVLALQQLTGC 332
           I+DP  ++E+  ++   + E + G ++  + F+T   + K + R   G+ + A QQ +G 
Sbjct: 316 IEDPRLLEELVEIKATYDYEASFGPSTLMDCFRTSENRPKQVLRIFTGIAIQAFQQASGI 375

Query: 333 NYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCC 392
           N+ FYYG   F   G++ S+  S I   VN A +   +Y+VD+ GRR  LL G   M   
Sbjct: 376 NFIFYYGVNFFNNTGVDSSYLVSFITYAVNVAFSIPGMYLVDRIGRRPVLLAGGIIMAIA 435

Query: 393 MVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRV 452
            +V A VGV++    G+   +SK     MI F C FI  F+ TW  + +V+ +E +PL V
Sbjct: 436 NLVIAIVGVSE----GKTVVASK----IMIAFICLFIAAFSATWGGVVWVVSAELYPLGV 487

Query: 453 KAKGMALGTVSNQMWNFCIGFFTPFITGA----------INFYYGYVFLGCLVFSYCYVF 502
           ++K  A+   +N + NF     TP+I             I F +G + +  ++  Y  V+
Sbjct: 488 RSKCAAICAAANWLVNFICALITPYIVDVGSHTSSMGPKIFFIWGSLNVAAVIVVYFAVY 547

Query: 503 AFVPETKGLQLEDVNLMWEEGVLPWKSASW 532
               ET+GL LE+++ ++ +      S+ W
Sbjct: 548 ----ETRGLTLEEIDELFRKAPNSIISSKW 573

>NDAI0A02890 Chr1 (648510..651236) [2727 bp, 908 aa] {ON} 
          Length = 908

 Score =  226 bits (576), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 150/515 (29%), Positives = 257/515 (49%), Gaps = 25/515 (4%)

Query: 28  EMKKDSQDFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDY 87
           E  ++S   ++ +S +   P +      S+ +  + VA GGF+ G+DTG I         
Sbjct: 82  EGNENSDSLSDDESFLFSTPPQKQRKIASILV-GVFVAVGGFLFGYDTGLINSITE---- 136

Query: 88  INRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIA-VFIYI 146
           +N   +  +   +Y +     +LVS  ++G  IG++    + D+ GR+  I+++ + I+ 
Sbjct: 137 MNYVKTHLTPNHEYFTSTEMSILVSFLSLGTFIGALSAPIISDSYGRKLTIMMSTIIIFS 196

Query: 147 VGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITF 206
           +G  +Q+ +        +GR+I+GLG G I+ + P+  +E + K LRG ++S YQ  IT+
Sbjct: 197 IGNSLQVGA-SGMVLLVVGRVISGLGIGLISAVVPLYQAEAAHKSLRGAIISTYQWAITW 255

Query: 207 GMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKR 266
           G+ +      GT    ++  +R+PLGL + W+ ++   M  +PESPRY V K ++++A  
Sbjct: 256 GLLVSSAVAQGTHNRTDATSYRLPLGLQYVWSFILAIGMIFLPESPRYYVLKDELDKAAE 315

Query: 267 SVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSAS-WSELFQTKTKVLQ--RTLMGVIV 323
           +++   +V I D   ++E+  ++   + E + GS + W     TKT+  Q  R   G+ +
Sbjct: 316 ALSFLRRVPIHDSGLLEELVEIKATYDYESSFGSTTFWDCFLTTKTRPKQTLRMFTGIAI 375

Query: 324 LALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLL 383
            A QQ +G N+ FYYG   F   G+ +S+  S I   VN       + +V+ +GRR  LL
Sbjct: 376 QAFQQFSGINFIFYYGVNFFNDTGVHNSYLVSFICYAVNVIFNVPGMILVEFFGRRKVLL 435

Query: 384 WGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVI 443
            G   M     + A VG +           S  A   MI F C FI  F+ TW  + +VI
Sbjct: 436 TGGVLMFMSNFIIAIVGSSV---------ESVVADKVMIAFICLFIAAFSATWGGVVWVI 486

Query: 444 ISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI--TGAINFYYG---YVFLGCL-VFS 497
            +E +PL +++K  A+   +N + NF     TP+I  TG+     G   Y   G L   +
Sbjct: 487 SAELYPLGIRSKCTAICAAANWLVNFICALITPYIVDTGSHTSTLGPKIYFIWGSLNALA 546

Query: 498 YCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASW 532
              V+  V ETKGL LE ++ ++ +     +S  W
Sbjct: 547 TVVVYFTVYETKGLTLEQIDELYSKSSNSLQSTRW 581

>SAKL0F10362g Chr6 complement(796504..798711) [2208 bp, 735 aa] {ON}
           similar to uniprot|P10870 Saccharomyces cerevisiae
           YDL194W SNF3 glucose sensor
          Length = 735

 Score =  223 bits (567), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 148/506 (29%), Positives = 258/506 (50%), Gaps = 28/506 (5%)

Query: 29  MKKDSQ---DFNEIDSQIIEIPKKPASAYLSVCIMCLMVAFGGFISGWDTGTIGGFLSHS 85
           ++ DSQ   + +++DS     P  P S  +S+ I+ + VA GGF+ G+DTG I   ++  
Sbjct: 60  LEADSQLYANMSDVDSAQFLNPPNPQSNKMSI-IVGVFVAVGGFLYGYDTGLINN-ITEM 117

Query: 86  DYINRFGSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVF-I 144
           +Y+ R     +   +  +     +LVS  ++G   G++    + D+ GR+  ++ + F +
Sbjct: 118 NYVKRH---FAPNKEQFTAREMSILVSFLSLGTFFGALTAPFISDSYGRKTTVIFSTFFV 174

Query: 145 YIVGIVIQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMI 204
           +++G  +Q+A+         GR ++G   G I+ + P+   E + K  RG ++S YQ  I
Sbjct: 175 FMIGNSLQVAATSIGL-LVAGRFLSGFSVGLISAVVPLYQGEAAQKWFRGAIISTYQWAI 233

Query: 205 TFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEA 264
           T+G+ +    + GT   ++   +R+P+GL + WA V+   M  +PESPRY V K Q++ A
Sbjct: 234 TWGLLVSSAVSQGTHMRNDPSSYRIPIGLQYVWAFVLGLGMIFLPESPRYYVLKDQLDRA 293

Query: 265 KRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELF---QTKTKVLQRTLMGV 321
            +S++    V  DD   ++E+  ++   + E + G  S+ + F   ++++K   R   G+
Sbjct: 294 AKSLSFLRGVPEDDSGLLEELVEIKATYDYEMSFGKFSYLDCFRSSKSRSKQKLRMFTGI 353

Query: 322 IVLALQQLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTC 381
            + A QQ +G N+ FYYG   F   G+ +S+  S I   VN A     L++++  GRR  
Sbjct: 354 AIQAFQQFSGINFIFYYGVNFFSRTGVGESYLVSFITYAVNVAFNVPGLFLIEYIGRRRI 413

Query: 382 LLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPF 441
           L++G   M     + A VG +           S  A   MI F C FI  F+ TW    +
Sbjct: 414 LIFGGIIMTVSNFIVAIVGCST---------DSLVANKVMIAFICLFIASFSATWGGAVW 464

Query: 442 VIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFI--TGAINFYYG---YVFLGCLVF 496
           VI +E +PL +++K  A+   SN + NF     TP++  TG+   Y G   +   G L  
Sbjct: 465 VISAELYPLGLRSKCTAICAASNWLVNFICALITPYLVDTGSHTSYMGTKIFFIWGSLNA 524

Query: 497 SYCYVFAF-VPETKGLQLEDVNLMWE 521
           +   V  F V ET GL LE+++ +++
Sbjct: 525 TAVVVVYFTVYETSGLTLEEIDQLYK 550

>Suva_4.54 Chr4 (99974..102646) [2673 bp, 890 aa] {ON} YDL194W
           (REAL)
          Length = 890

 Score =  224 bits (572), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 156/546 (28%), Positives = 275/546 (50%), Gaps = 41/546 (7%)

Query: 33  SQDFNEIDSQIIEIPKKPASAYLSVCI-MCLMVAFGGFISGWDTGTIGGFLSHSDYINRF 91
           + D + ID+  +   + P    + + I + + VA GGF+ G+DTG I    S +   +  
Sbjct: 72  TDDISTIDNNSLLFSEPPQRQSMMMSIYVGVFVAVGGFLFGYDTGLINSITSMNYVKSHL 131

Query: 92  GSSHSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIA-VFIYIVGIV 150
             +H       +  +  +LVS  ++G   G++    + DT GR+  I+ + + I+ +G  
Sbjct: 132 APNHDS----FTAKQMSILVSFLSLGTFFGALTAPFISDTYGRKPTIIFSTIVIFSIGNS 187

Query: 151 IQIASIDKWYQYFIGRIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFL 210
           +Q+ +        +GR+I+G+G G I+ + P+  +E + K LRG ++S YQ  IT+G+ +
Sbjct: 188 LQVGA-GGLTLLIVGRVISGIGIGAISAVVPLYQAEATHKSLRGAIISTYQWAITWGLLV 246

Query: 211 GYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAK 270
               + GT + +++  +R+P+GL + W+ ++   MF +PESPRY V K +++EA +S++ 
Sbjct: 247 SSAVSQGTHSRNDASSYRIPIGLQYVWSSILAVGMFFLPESPRYYVLKDKLDEAAKSLSF 306

Query: 271 SNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELF---QTKTKVLQRTLMGVIVLALQ 327
              V + D   ++E+  ++   + E + G++++ + F   +++ K   R   G+ + A Q
Sbjct: 307 LRGVPVHDSGLLEELVEIKATYDYEASFGTSNFVDCFISSKSRPKQTLRMFTGIALQAFQ 366

Query: 328 QLTGCNYFFYYGTIIFKAVGLEDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAA 387
           Q +G N+ FYYG   F   G+  S+  S I   VN       L+ V+ +GRR  L++G  
Sbjct: 367 QFSGINFIFYYGVNFFNKTGVSKSYLVSFITYAVNVIFNVPGLFFVEFFGRRKVLVFGGI 426

Query: 388 GMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISES 447
            M     + A VG +           +  A   MI F C FI  F+ TW  + +VI +E 
Sbjct: 427 IMTIANFIVAIVGCSL---------KTVAAAKVMIAFICLFIASFSATWGGVVWVISAEL 477

Query: 448 FPLRVKAKGMALGTVSNQMWNFCIGFFTPFI--TGA--------INFYYGYV-FLGCLVF 496
           +PL V++K  A+   +N + NF     TP+I  TG+        I F +G +  LG +V 
Sbjct: 478 YPLGVRSKCTAICAAANWLVNFICALITPYIVDTGSHTSSLGAKIFFIWGSLNALGVIV- 536

Query: 497 SYCYVFAFVPETKGLQLEDVNLMWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYK 556
               V+  V ETKGL LE+++ ++       KS+S V   +   D    AL     P+ +
Sbjct: 537 ----VYLTVYETKGLTLEEIDELY------CKSSSGVVSPKFNKDIRERALKFQYDPLQR 586

Query: 557 RMFSKN 562
               KN
Sbjct: 587 LENGKN 592

>Smik_4.46 Chr4 (89787..92432) [2646 bp, 881 aa] {ON} YDL194W (REAL)
          Length = 881

 Score =  221 bits (564), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 153/540 (28%), Positives = 270/540 (50%), Gaps = 40/540 (7%)

Query: 2   DYSQSPTGEDVHSSTAGSV-HSSQSFQEMKKDSQDFNEID------SQIIEIPKKPASAY 54
           D S+ P  +D  SS         Q F      S +F + +      S +   P +  S  
Sbjct: 36  DSSKDPKTDDAPSSIQTPTGFQPQDFDRRSNISSEFTDDNCTMDDNSILFSEPSQKQSMM 95

Query: 55  LSVCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVSIF 114
           +S+ +  + VA GGF+ G+DTG I    S  +Y+    + + D     +  +  +LVS  
Sbjct: 96  MSIYV-GVFVAVGGFLFGYDTGLINSITSM-NYVKSHVAPNHDS---FTAQQMSILVSFL 150

Query: 115 NVGCAIGSVVLGRLGDTVGRRKGIVIAVF-IYIVGIVIQIASIDKWYQYFIGRIIAGLGS 173
           ++G   G++    + D+ GR+  I+ +   I+ +G  +Q+ +        +GR+I+G+G 
Sbjct: 151 SLGTFFGALTAPFISDSYGRKPTIIFSTLVIFSIGNSLQVGA-GGITLLIVGRVISGIGI 209

Query: 174 GTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGL 233
           G I+ + P+  +E + K LRG ++S YQ  IT+G+ +    + GT + +++  +R+P+GL
Sbjct: 210 GAISAVVPLYQAEATHKSLRGAIISTYQWAITWGLLVSSAVSQGTHSRNDASSYRIPIGL 269

Query: 234 CFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVE 293
            + W+  +   MF +PESPRY V K  ++EA +S++    V + D   ++E+  ++   +
Sbjct: 270 QYVWSSFLAVGMFFLPESPRYYVLKDNLDEAAKSLSFLRGVPVHDSGLLEELVEIKATYD 329

Query: 294 AEQAAGSASWSELF---QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLED 350
            E + GS+++ + F   +++ K   R   G+ + A QQ +G N+ FYYG   F   G+ +
Sbjct: 330 YEASFGSSNFIDCFISSKSRPKQTLRMFTGIALQAFQQFSGINFIFYYGVNFFNKTGVSN 389

Query: 351 SFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQD 410
           S+  S I   VN       L+ V+ +GRR  L++G   M     + A VG +        
Sbjct: 390 SYLVSFITYAVNVVFNVPGLFFVEFFGRRKVLVFGGVIMTIANFIVAIVGCSL------- 442

Query: 411 QPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFC 470
              +  A   MI F C FI  F+ TW  + +VI +E +PL V++K  A+   +N + NF 
Sbjct: 443 --KTVAAAKVMIAFICLFIASFSATWGGVVWVISAELYPLGVRSKCTAICAAANWLVNFI 500

Query: 471 IGFFTPFI--TGA--------INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNLMW 520
               TP+I  TG+        I F +G +    ++  Y  V+    ETKGL LE+++ ++
Sbjct: 501 CALITPYIVDTGSHTSSLGAKIFFIWGSLNAMGVIVVYLTVY----ETKGLTLEEIDELY 556

>Skud_4.64 Chr4 (108965..111619) [2655 bp, 884 aa] {ON} YDL194W
           (REAL)
          Length = 884

 Score =  218 bits (556), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 161/584 (27%), Positives = 280/584 (47%), Gaps = 50/584 (8%)

Query: 2   DYSQSPTGEDVHSS--------TAGSVHSSQSFQEMKKDSQDFNEIDSQIIEIPKKPASA 53
           + S+ P  +D  SS        + G    S +F  +   + D   ID+  I   + P   
Sbjct: 35  NSSKDPKSDDAPSSIQTPTGLQSEGFDRQSNAFSVL---TDDICTIDNTSILFSEPPQKQ 91

Query: 54  YLSVCI-MCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGSSHSDGSKYLSKVRTGLLVS 112
            + + I + + VA GGF+ G+DTG I    S     +    +H       +     +LVS
Sbjct: 92  SMMMSIYVGVFVAVGGFLFGYDTGLINSITSMKYVKSHVAPNHDS----FTAKEMSILVS 147

Query: 113 IFNVGCAIGSVVLGRLGDTVGRRKGIVIAVF-IYIVGIVIQIASIDKWYQYFIGRIIAGL 171
             ++G   G++    + D+ GR+  I+ +   I+ +G  +Q+ +        +GR+I+G+
Sbjct: 148 FLSLGTFFGALTAPFISDSYGRKPTIIFSTLVIFSIGNSLQVGA-GGITLLIVGRVISGI 206

Query: 172 GSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPL 231
           G G I+ + P+  +E + K LRG ++S YQ  IT+G+ +    + GT   +++  +R+P+
Sbjct: 207 GIGAISAVVPLYQAEATHKSLRGAIISTYQWAITWGLLVSSAVSQGTHERNDASSYRIPI 266

Query: 232 GLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIA 291
           GL + W+  +   M  +PESPRY V K +++EA +S++    V   D   ++E+  ++  
Sbjct: 267 GLQYVWSSFLAIGMLFLPESPRYYVLKDKLDEAAKSLSFLRGVPAHDSGLLEELVEIKAT 326

Query: 292 VEAEQAAGSASWSELF---QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGL 348
            + E + GS+++ + F   +++ K   R   G+ + A QQ +G N+ FYYG   F   G+
Sbjct: 327 YDYEASFGSSNFIDCFISSKSRPKQTLRMFTGIALQAFQQFSGINFIFYYGVNFFNKTGV 386

Query: 349 EDSFQTSLIFGIVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNG 408
            +S+  S I   VN       L+ V+ +GRR  L++G   M     + A VG +      
Sbjct: 387 SNSYLVSFITYAVNVVFNVPGLFFVEFFGRRKVLVFGGVIMTIANFIVAIVGCSL----- 441

Query: 409 QDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWN 468
                +  A   MI F C FI  F+ TW  + +VI +E +PL V++K  A+   +N + N
Sbjct: 442 ----KTVAAAKVMIAFICLFIASFSATWGGVVWVISAELYPLGVRSKCTAICAAANWLVN 497

Query: 469 FCIGFFTPFI--TGA--------INFYYGYVFLGCLVFSYCYVFAFVPETKGLQLEDVNL 518
           F     TP+I  TG+        I F +G +    ++  Y  V+    ETKGL LE+++ 
Sbjct: 498 FICALITPYIVDTGSHTSSLGAKIFFIWGSLNAMGVIVVYLTVY----ETKGLTLEEIDE 553

Query: 519 MWEEGVLPWKSASWVPPSQRGTDYNAEALATDDKPIYKRMFSKN 562
           ++       KS+S V   +   D    AL     P+ +    KN
Sbjct: 554 LYS------KSSSGVVSPKFNKDIRERALKFQYDPLQRLEDDKN 591

>TDEL0B07220 Chr2 complement(1271585..1273306) [1722 bp, 573 aa]
           {ON}  YDR536W
          Length = 573

 Score =  213 bits (542), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 151/520 (29%), Positives = 259/520 (49%), Gaps = 32/520 (6%)

Query: 57  VCIMCLMVAFGGFISGWDTGTIGGFLSHSDYINRFGS--SHSDGSKYLSKVRTGLLVSIF 114
           V  +C M  F  F  G+D G +   ++ + +   F +  S SD   + S V+ G + S +
Sbjct: 28  VITLCAMTGFSLF--GYDQGLMASLITGTQFNYEFPATKSKSDNDTHASTVQ-GAVTSCY 84

Query: 115 NVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWY---QYFIGRIIAGL 171
            +GC  GS+ +   G+ +GR+  IVI   I IVG VI   +   ++   Q+ +GR+I G+
Sbjct: 85  EIGCFFGSLFVMFYGEKIGRKPLIVIGSVITIVGAVISTTAFRDYWALGQFVVGRVITGV 144

Query: 172 GSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPL 231
           G+G      P+  SE+S   +RG LV+     I  G  L Y  ++G    D+S+QWR P+
Sbjct: 145 GTGLNTSTIPVWQSEMSDPSIRGILVNLEGSTIAIGTMLAYWIDFGFSFIDSSVQWRFPV 204

Query: 232 GLCFAWALVMIGAMFIVPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIA 291
            +   +AL++   +  +PESPR+L+ + + EEA+  + + + V  +D   + E+ ++  A
Sbjct: 205 SMQILFALILCFMIVNLPESPRWLISQSRTEEARYLLGQLDDVDPNDDRIVAEVAMIHDA 264

Query: 292 VEAEQAAGSASWSELFQ-TKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIFKAVGLED 350
           V   +   + S S LF   K++ +QR L+       QQ TGCN   YY T++F    ++ 
Sbjct: 265 VNRSKQEKN-SMSVLFSGGKSQNMQRALVAASTQFFQQFTGCNAAIYYSTVLFHET-IQL 322

Query: 351 SFQTSLIFG----IVNFASTFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWP 406
           S + S+I G     V   ST  + +++++ GRR   L GA G      +  +  V     
Sbjct: 323 SPRLSMILGAVFSTVYALSTIPSFFLIERLGRRKLFLLGATGQAISFTITFACLVR---- 378

Query: 407 NGQDQPSSKGAGNTMIVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQM 466
             Q + ++KGA   + +F  F    F  +   +P++   E   ++V+A   A  T +N +
Sbjct: 379 --QTEENAKGAAVGLFLFIVF----FGCSMLSLPWIYPPEIASMKVRASTNAFSTCTNWL 432

Query: 467 WNFCIGFFTPFITGAINFYYGYVFLGCLVFSYC-YVFAFVPETKGLQLEDVNLMW----E 521
            NF +  FTP        +  Y+F  C+ + Y   +F F PET G  LE++++++    E
Sbjct: 433 CNFAVVMFTPIFINKSG-WGCYLFFACINYLYIPVIFFFYPETAGRSLEEIDIIYAKSHE 491

Query: 522 EGVLPWKSASWVPP-SQRGTDYNAEALATDDKPIYKRMFS 560
           EG   W+ A+ +P  S +  D +A AL   +  + K  F+
Sbjct: 492 EGTQAWRVAAHLPKLSLQEVDDHANALGLYEDDLEKEDFA 531

>Skud_4.809 Chr4 (1427842..1429548) [1707 bp, 568 aa] {ON} YDR536W
           (REAL)
          Length = 568

 Score =  212 bits (539), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 142/507 (28%), Positives = 255/507 (50%), Gaps = 30/507 (5%)

Query: 72  GWDTGTIGGFLSHSDYINRFGSSHSDGSK-YLSKVRTGLLVSIFNVGCAIGSVVLGRLGD 130
           G+D G +   ++   +   F ++  +G     + V  G   S + +GC  GS+ +   G+
Sbjct: 43  GYDQGLMASLITGKQFNYEFPATKENGEHDRHATVVQGATTSCYELGCFAGSLFVMFYGE 102

Query: 131 TVGRRKGIVIAVFIYIVGIVIQIASIDKWY---QYFIGRIIAGLGSGTIAVLSPMLISEI 187
            +GR+  I++   I I+G  I   +   ++   Q+ IGR++ G+G+G      P+  SE+
Sbjct: 103 KIGRKPLILMGSIITIIGATISTCAFRDYWALGQFIIGRVVTGVGTGLNTSTIPVWQSEM 162

Query: 188 SPKHLRGTLVSCYQLMITFGMFLGYCTNYGTKTYDNSIQWRVPLGLCFAWALVMIGAMFI 247
           S    RG LV+     I FG  + Y  ++G    D+S+QWR P+ +   +AL ++  M  
Sbjct: 163 SKAENRGLLVNLEGSTIAFGTMIAYWIDFGFSYIDSSVQWRFPVSMQIVFALFLLAFMIN 222

Query: 248 VPESPRYLVEKGQIEEAKRSVAKSNKVTIDDPATIQEIELVQIAVEAEQAAGSASWSELF 307
           +PESPR+L+ + + EEA+  V K + V   D   + E+ ++  AV   +   ++  S   
Sbjct: 223 LPESPRWLISQSRTEEARYLVGKLDDVDPTDEEVVTEVAMLHDAVNRTKHEKNSISSLFS 282

Query: 308 QTKTKVLQRTLMGVIVLALQQLTGCNYFFYYGTIIF-KAVGLEDSFQTSLIFGIVNFA-- 364
           + K++ LQR L+       QQ TGCN   YY T++F K + L+  ++ S+I G V FA  
Sbjct: 283 RGKSQNLQRALIAASTQFFQQFTGCNAAIYYSTVLFNKTIKLD--YRLSMIIGGV-FATI 339

Query: 365 ---STFVALYVVDKYGRRTCLLWGAAGMVCCMVVFASVGVTKLWPNGQDQPSSKGAGNTM 421
              ST  + ++++K GRR   L GA G      +  +  V       +++ +++GA   +
Sbjct: 340 YALSTIGSFFLIEKLGRRKLFLLGATGQAVSFTITFACLVN------ENKANARGAAVGL 393

Query: 422 IVFSCFFIFCFATTWAPIPFVIISESFPLRVKAKGMALGTVSNQMWNFCIGFFTPFITGA 481
            +F  F    F  +   +P++   E   ++V+A   A  T +N + NF +  FTP   G 
Sbjct: 394 FLFITF----FGLSLLSLPWIYPPEIASMKVRATTNAFSTCTNWLCNFAVVMFTPIFIGQ 449

Query: 482 INFYYGYVFLGCLVFSYC-YVFAFVPETKGLQLEDVNLM----WEEGVLPWKSASWVPP- 535
              +  Y+F   + + Y   +F F PET G  LE+++++    +E+G  PW+ A+ +P  
Sbjct: 450 SG-WGCYLFFAVMNYLYIPIIFFFYPETAGRSLEEIDIIFAKAYEDGTQPWRVANHLPKL 508

Query: 536 SQRGTDYNAEALATDDKPIYKRMFSKN 562
           S +  D +A AL + +  + K  F+++
Sbjct: 509 SLQEVDEHANALGSYNDDLQKEDFAED 535

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,395,974
Number of extensions: 2324485
Number of successful extensions: 9833
Number of sequences better than 10.0: 750
Number of HSP's gapped: 8710
Number of HSP's successfully gapped: 783
Length of query: 562
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 447
Effective length of database: 40,294,809
Effective search space: 18011779623
Effective search space used: 18011779623
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)