Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0D008106.21ON34934916550.0
NCAS0H008306.21ON33834510431e-141
Skud_15.1686.21ON3483509291e-124
YOR007C (SGT2)6.21ON3463429241e-123
Smik_15.1766.21ON3453499181e-122
Kpol_1037.266.21ON3423419161e-122
SAKL0E01210g6.21ON3233429131e-122
KNAG0M011706.21ON3393438921e-119
KAFR0L004106.21ON3313468911e-119
Suva_15.1826.21ON3463508751e-116
Kwal_56.224336.21ON3223418601e-114
TBLA0G010506.21ON3503428581e-113
TDEL0G044806.21ON3433418471e-112
TPHA0J003406.21ON3383418261e-109
CAGL0E02739g6.21ON3433418161e-107
ZYRO0C07788g6.21ON3343348081e-106
KLTH0C11220g6.21ON3273447801e-102
Ecym_30256.21ON3183397527e-98
KLLA0D01155g6.21ON3353417391e-95
ACR005W6.21ON3273477163e-92
Kpol_1032.86.21ON3433515556e-68
NCAS0D026706.21ON3512243736e-41
NDAI0I022406.21ON3503573659e-40
TPHA0M002706.21ON3773883624e-39
TBLA0A072706.21ON3733513545e-38
NDAI0F009105.617ON5831072562e-23
Kwal_55.199355.617ON5931382534e-23
AEL224W5.617ON5801402517e-23
CAGL0H08195g5.617ON5831232518e-23
ZYRO0A05676g5.617ON5721072445e-22
KAFR0C058905.617ON5752482445e-22
NCAS0G008105.617ON5842492437e-22
Smik_15.2055.617ON5891212439e-22
YOR027W (STI1)5.617ON5891202393e-21
SAKL0G07084g5.617ON5851402384e-21
TPHA0D028805.617ON5851072367e-21
KLTH0E02178g5.617ON5931392358e-21
KLLA0A07062g5.617ON5811072341e-20
Kpol_1018.695.617ON5901212332e-20
Ecym_55825.617ON5841072322e-20
Skud_15.1925.617ON5891202261e-19
TDEL0A048405.617ON5761402224e-19
TBLA0E033005.617ON5821062225e-19
Suva_8.805.617ON5861062215e-19
KNAG0B032005.617ON5792142172e-18
TBLA0C039503.481ON5121421969e-16
NCAS0A00490singletonON6201101852e-14
TDEL0D055003.481ON5121231781e-13
KAFR0B066103.481ON5111311782e-13
KNAG0A079003.481ON5121261772e-13
NCAS0F034903.481ON5121461772e-13
Skud_7.4323.481ON5131301683e-12
Ecym_44133.481ON5101351674e-12
CAGL0D05060g3.481ON5101171656e-12
NDAI0B057903.481ON5231141657e-12
Suva_7.4083.481ON513911658e-12
YGR123C (PPT1)3.481ON513911631e-11
Smik_6.2153.481ON513821622e-11
KLLA0F24046g2.152ON604941603e-11
SAKL0F03102g3.481ON513931585e-11
AAR083C3.481ON538921569e-11
Kpol_505.413.481ON5131111551e-10
TPHA0D032203.481ON5131461551e-10
KAFR0E029808.506ON3801081381e-08
ZYRO0B04224g3.481ON5131101372e-08
CAGL0H07425g8.506ON380951343e-08
KNAG0A039508.506ON3861071319e-08
KLLA0B10912g3.481ON5121141329e-08
KLTH0F14542g3.481ON5131341301e-07
Kwal_55.211753.481ON5111021302e-07
Smik_2.2958.506ON385921273e-07
ZYRO0F08624g8.506ON3791151256e-07
NCAS0B024008.506ON380951246e-07
NDAI0C052908.506ON3791091246e-07
Kwal_27.118908.506ON3341481238e-07
YBR155W (CNS1)8.506ON385921248e-07
Kwal_33.147672.152ON594891231e-06
NDAI0F028102.152ON609891222e-06
NCAS0G024802.152ON596891222e-06
KLTH0B05170g2.152ON5931421212e-06
CAGL0L12936g2.152ON6001041212e-06
Suva_4.4058.506ON385921193e-06
ABR131W2.152ON594891193e-06
YHR117W (TOM71)2.152ON6391411194e-06
NCAS0B070102.152ON6251201186e-06
TDEL0B013108.506ON3801551167e-06
TBLA0H033808.506ON3751451159e-06
CAGL0L04048g2.152ON5871101151e-05
Ecym_82042.152ON597871151e-05
SAKL0H10934g8.506ON3801101141e-05
TPHA0L014208.506ON3741401141e-05
Kpol_513.28.506ON3741161122e-05
TBLA0C055302.152ON6101051132e-05
Suva_15.3142.152ON6441041132e-05
AGL268C8.506ON3791131122e-05
SAKL0E10956g2.152ON600891123e-05
Skud_2.2828.506ON385921113e-05
Skud_8.1782.152ON638951113e-05
YNL121C (TOM70)2.152ON6171011096e-05
Smik_8.1952.152ON635951071e-04
NDAI0B043402.152ON6641011062e-04
Skud_14.2112.152ON6171011052e-04
KNAG0I025206.328ON11792982e-04
KAFR0F007202.152ON6081411042e-04
Smik_14.2072.152ON6171011042e-04
TDEL0B051402.152ON5991011033e-04
TPHA0I015102.152ON6031011033e-04
NDAI0C051308.470ON5901071033e-04
Suva_14.2192.152ON6171011033e-04
Ecym_25598.506ON3701001015e-04
NCAS0B025608.470ON5781261016e-04
ZYRO0G06512g2.152ON60499980.001
KNAG0A041208.470ON602114980.001
TPHA0D038606.328ON120102910.002
TPHA0E007407.412ON746103970.002
CAGL0C01903g7.412ON769103970.002
KLLA0B09966g8.506ON370153960.002
KLTH0H14872g5.352ON623119960.003
TBLA0B086803.32ON914108950.003
KAFR0C018505.352ON646183950.003
NCAS0A147707.458ON300137930.004
TBLA0I023106.328ON11665870.005
NCAS0E024907.412ON809129940.005
TBLA0H019705.352ON840149930.006
ADR230W5.689ON68570930.006
CAGL0K11209g8.470ON59089920.007
KNAG0H035302.152ON61476920.007
CAGL0K09240g6.328ON14269870.007
Kpol_1048.212.152ON59799920.007
KLTH0E11748g8.506ON378132910.008
KLLA0C08910g6.328ON11553850.010
Kpol_1028.516.328ON11786850.010
Smik_16.4537.546ON1417101900.016
Kpol_1018.1067.412ON75397890.019
KAFR0J025706.328ON12160820.024
Kpol_1031.648.470ON60796880.025
SAKL0H02244g5.72ON628126870.028
Suva_2.347.412ON763103870.029
CAGL0H07095g5.352ON661129870.034
Smik_2.367.412ON751103870.035
Suva_2.4108.470ON61184860.036
YBL084C (CDC27)7.412ON758103860.038
KLLA0C15455g8.470ON56692860.039
KLTH0F18150g5.689ON68997850.049
Kpol_1043.605.689ON70659850.050
Ecym_20906.328ON17262820.055
Smik_4.4918.470ON61284840.070
Ecym_40315.689ON688120840.071
Kwal_34.159775.352ON597150830.084
NDAI0E040407.412ON78398830.091
Skud_4.5068.470ON61184830.10
Ecym_13968.470ON57394830.10
NDAI0C043205.352ON706135830.10
NCAS0D045006.328ON12158770.11
YDR244W (PEX5)8.470ON61284820.12
Kwal_27.107407.412ON62897820.14
SAKL0A01672g6.328ON12863770.16
SAKL0E14542g5.689ON69053810.16
AFR453W8.470ON56991810.17
Kwal_27.117378.470ON57588800.21
NCAS0H035402.665ON76064800.21
TDEL0B016608.470ON54995800.24
TDEL0E027505.352ON564133790.26
KAFR0E028208.470ON56284790.27
SAKL0H11946g8.470ON57397790.29
Smik_3.1596.328ON11584740.33
TPHA0L012108.470ON58875780.33
TDEL0C027207.412ON700134780.44
CAGL0I02288g5.72ON639101770.45
ZYRO0B03828g7.412ON72791770.46
TDEL0A074306.328ON12463720.58
KAFR0E008508.555ON186646770.64
ZYRO0D10186g5.352ON635100760.73
Skud_2.247.412ON769103750.80
KLTH0C06204g7.412ON62797750.80
Skud_16.2018.555ON186746750.90
NCAS0G003505.689ON698122750.90
YCR060W (TAH1)6.328ON11162700.93
TBLA0D004607.412ON835104750.95
TBLA0A016908.470ON66298750.97
KLTH0E10934g8.470ON56888741.2
ABR206W5.72ON614104741.3
NDAI0F004005.689ON76457731.4
KLTH0A00638g7.546ON141196731.7
NDAI0I004406.328ON12867681.9
Suva_16.2308.555ON186747722.0
TBLA0H015203.367ON689107712.3
ZYRO0A02926g8.470ON57783712.6
AAR054C6.328ON13365673.0
CAGL0M08030g1.456ON387123703.1
KLLA0E20857g7.412ON71097703.2
KNAG0B022407.412ON739102703.7
NCAS0A112003.367ON907103703.7
NDAI0A051003.367ON1007111704.1
Ecym_81815.352ON66179694.5
AGL294W7.412ON656111694.7
Kpol_339.135.352ON686147686.0
Kwal_55.218395.689ON69035686.3
Skud_3.1356.328ON11859646.3
NDAI0G018403.220ON150258687.5
KAFR0D023405.689ON69797678.0
Ecym_71427.412ON675111678.1
KLLA0D09020g3.395ON53026678.3
TBLA0E019907.313ON3741596610.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0D00810
         (349 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   642   0.0  
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   406   e-141
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   362   e-124
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   360   e-123
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   358   e-122
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   357   e-122
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   356   e-122
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   348   e-119
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   347   e-119
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   341   e-116
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   335   e-114
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   335   e-113
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   330   e-112
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   322   e-109
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   318   e-107
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   315   e-106
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   305   e-102
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   294   7e-98
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   289   1e-95
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   280   3e-92
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   218   6e-68
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   148   6e-41
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   145   9e-40
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   144   4e-39
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   140   5e-38
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}    103   2e-23
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...   102   4e-23
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...   101   7e-23
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...   101   8e-23
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    99   5e-22
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    99   5e-22
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    98   7e-22
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    98   9e-22
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    97   3e-21
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    96   4e-21
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    96   7e-21
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    95   8e-21
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    95   1e-20
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    94   2e-20
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    94   2e-20
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    92   1e-19
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    90   4e-19
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    90   5e-19
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    90   5e-19
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    88   2e-18
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    80   9e-16
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       76   2e-14
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    73   1e-13
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    73   2e-13
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    73   2e-13
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    73   2e-13
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    69   3e-12
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    69   4e-12
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    68   6e-12
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    68   7e-12
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    68   8e-12
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    67   1e-11
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    67   2e-11
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    66   3e-11
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    65   5e-11
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    65   9e-11
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    64   1e-10
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    64   1e-10
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    58   1e-08
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    57   2e-08
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    56   3e-08
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    55   9e-08
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    55   9e-08
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    55   1e-07
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    55   2e-07
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    54   3e-07
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    53   6e-07
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    52   6e-07
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    52   6e-07
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    52   8e-07
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    52   8e-07
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    52   1e-06
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    52   2e-06
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    52   2e-06
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    51   2e-06
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    51   2e-06
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    50   3e-06
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    50   3e-06
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    50   4e-06
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    50   6e-06
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    49   7e-06
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    49   9e-06
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    49   1e-05
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    49   1e-05
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    49   1e-05
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    49   1e-05
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    48   2e-05
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    48   2e-05
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    48   2e-05
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    48   2e-05
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    48   3e-05
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    47   3e-05
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    47   3e-05
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    47   6e-05
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    46   1e-04
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    45   2e-04
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    45   2e-04
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    42   2e-04
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    45   2e-04
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    45   2e-04
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    44   3e-04
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    44   3e-04
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    44   3e-04
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    44   3e-04
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    44   5e-04
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    44   6e-04
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    42   0.001
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    42   0.001
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    40   0.002
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    42   0.002
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    42   0.002
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    42   0.002
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    42   0.003
TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3...    41   0.003
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    41   0.003
NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {...    40   0.004
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    38   0.005
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    41   0.005
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    40   0.006
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    40   0.006
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    40   0.007
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    40   0.007
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    38   0.007
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    40   0.007
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    40   0.008
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    37   0.010
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    37   0.010
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    39   0.016
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    39   0.019
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    36   0.024
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    39   0.025
SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} simila...    38   0.028
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    38   0.029
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    38   0.034
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    38   0.035
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    38   0.036
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    38   0.038
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    38   0.039
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    37   0.049
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    37   0.050
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    36   0.055
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    37   0.070
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    37   0.071
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...    37   0.084
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    37   0.091
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    37   0.10 
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    37   0.10 
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    37   0.10 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    34   0.11 
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    36   0.12 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    36   0.14 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    34   0.16 
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    36   0.16 
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    36   0.17 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    35   0.21 
NCAS0H03540 Chr8 (672730..675012) [2283 bp, 760 aa] {ON} Anc_2.6...    35   0.21 
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    35   0.24 
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    35   0.26 
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    35   0.27 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    35   0.29 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    33   0.33 
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    35   0.33 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    35   0.44 
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    34   0.45 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    34   0.46 
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    32   0.58 
KAFR0E00850 Chr5 complement(178580..184180) [5601 bp, 1866 aa] {...    34   0.64 
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...    34   0.73 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    33   0.80 
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    33   0.80 
Skud_16.201 Chr16 complement(369772..375375) [5604 bp, 1867 aa] ...    33   0.90 
NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}...    33   0.90 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    32   0.93 
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    33   0.95 
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    33   0.97 
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    33   1.2  
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    33   1.3  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    33   1.4  
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    33   1.7  
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    31   1.9  
Suva_16.230 Chr16 complement(408651..414254) [5604 bp, 1867 aa] ...    32   2.0  
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    32   2.3  
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    32   2.6  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    30   3.0  
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    32   3.1  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    32   3.2  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    32   3.7  
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    32   3.7  
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    32   4.1  
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...    31   4.5  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    31   4.7  
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    31   6.0  
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    31   6.3  
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    29   6.3  
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    31   7.5  
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    30   8.0  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    30   8.1  
KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} simila...    30   8.3  
TBLA0E01990 Chr5 (483675..484799) [1125 bp, 374 aa] {ON} Anc_7.3...    30   10.0 

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/349 (91%), Positives = 320/349 (91%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
           GKTLVDIL           IEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240
           GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240

Query: 241 ESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQSM 300
           ESAQGNAPNPFAGGMPDM                  NPDFMSTAQKLMSDPNAMQQVQSM
Sbjct: 241 ESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQSM 300

Query: 301 MSDPSMRDLANNFKNGNTDMNDIMNNPAIRNMASNLFKGNPSEENQDKQ 349
           MSDPSMRDLANNFKNGNTDMNDIMNNPAIRNMASNLFKGNPSEENQDKQ
Sbjct: 301 MSDPSMRDLANNFKNGNTDMNDIMNNPAIRNMASNLFKGNPSEENQDKQ 349

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  406 bits (1043), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 205/345 (59%), Positives = 260/345 (75%), Gaps = 16/345 (4%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           MSL+NK++G+LIVDFLST+I+  E+SED+ADSLNVA+DCI+E+ EF+R+ V +T+++KF+
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
           GKTL +IL            EKEESV+VNIPVEDAEIKA AE+FKLEGNKAMA KD+ LA
Sbjct: 61  GKTLKEILSSASATSTGS--EKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLA 118

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           +EKY+EAIK LPTN IYYANRAAA+SS+KE++ AIKDAE AI+IDP+YSKGYSRLAFAKY
Sbjct: 119 IEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKT----PEQGQGQ 236
            L K EEALE YKKVLD+EGD AT  MKRD+E AK RVE SMN+EKS T    P +  GQ
Sbjct: 179 ALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQ 238

Query: 237 QQTNESAQGNAPNPFAG-GMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQ 295
           Q           NPFAG GMPDM                  NP  M  AQ++MSDPN+MQ
Sbjct: 239 QPA---------NPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQ 289

Query: 296 QVQSMMSDPSMRDLANNFKNGNTDMNDIMNNPAIRNMASNLFKGN 340
           ++Q MM +P++R++A N  +G+ +++D+MNNP++++MA+NLF  N
Sbjct: 290 KMQEMMQNPNLREMAQNLASGDANLDDLMNNPSVKDMANNLFGPN 334

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  362 bits (929), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 188/350 (53%), Positives = 244/350 (69%), Gaps = 15/350 (4%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKN-KF 59
           MS +  +I +LIV++ S+I+EK E+SED+ADSLNVAMDCISEA  F+RE VP  ++N +F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 60  NGKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHL 119
            G+ L D+L            +  ++VEVNIP EDAEIKA AE  K++GNKAMA KD+ L
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 120 AVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAK 179
           A+ KYTEAIK+LPTNAIYYANRAAAHSSLK ++EA++DAESAI IDP+Y +GYSRL FAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 180 YGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQT 239
           Y  GK EEALE+YKKVLDIEGDNAT  MKRDYE+AKK+VE+S+N+EK+  PEQ +     
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKT-VPEQSRDADAN 239

Query: 240 NESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQS 299
            +++QG   +                           NP  M  AQK+MS+P AMQ +Q 
Sbjct: 240 ADASQGAGTS---------GLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQK 290

Query: 300 MMSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNMASNLF--KGNPSEEN 345
           MM DP+++ +A  F +G    +++D+MNNPA+R+MA NLF   G PS E+
Sbjct: 291 MMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPSTED 340

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  360 bits (924), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 237/342 (69%), Gaps = 15/342 (4%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETI-KNKF 59
           MS + ++I ALIV++ S+I+EK E+SED ADSLNVAMDCISEA  F+RE V   + K++F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 60  NGKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHL 119
            G+ L DIL            +  E+VE+NIP +DAE KA AE  K++GNKAMA KD+ L
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 120 AVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAK 179
           A+ KYTEAIK+LPTNAIYYANRAAAHSSLKE+++A+KDAESAI IDPSY +GYSRL FAK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 180 YGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQT 239
           Y  GK EEALE+YKKVLDIEGDNAT  MKRDYE+AKK+VE+S+N+EK+  PEQ +     
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKT-VPEQSR----- 234

Query: 240 NESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQS 299
                 +A    + G                      NP  M  AQK+MS+P AMQ +Q 
Sbjct: 235 ------DADVDASQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQK 288

Query: 300 MMSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNMASNLFKG 339
           MM DPS+R +A  F +G    +++D+MNNPA+RNMA NLF G
Sbjct: 289 MMQDPSIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGG 330

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  358 bits (918), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 190/349 (54%), Positives = 239/349 (68%), Gaps = 17/349 (4%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETI-KNKF 59
           M  + ++I ALIV++ S+I+EK E+SED ADSLNVAMDCISEA  F+R+     + K++F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 60  NGKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHL 119
            GK+L D+L            +  ++VEVNIP EDAE KA AE  K++GNKAMA KD+ L
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 120 AVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAK 179
           A+ KYTEAI++LPTNAIYYANRAAAHSSL+E++EA+KDAES+I IDPSY +GYSRL FAK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 180 YGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQT 239
           Y  GK EEALE+YKKVLDIEGDNAT  MKRDYE+AKK+VE+S+N+EK+  PEQ +     
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKA-VPEQSR----- 234

Query: 240 NESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQS 299
              A  NA      G                      NP  M  AQK+MS+P AMQ +Q 
Sbjct: 235 --DADANASQ----GAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQK 288

Query: 300 MMSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNMASNLFKG--NPSEE 344
           MM DPS+R +A  F +G    +++D+MNNPA+RNMA NLF G   PS E
Sbjct: 289 MMQDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSSE 337

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  357 bits (916), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 187/341 (54%), Positives = 242/341 (70%), Gaps = 14/341 (4%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           MS++NKDI ALI+DFLST+++KNEVSEDNADSLNVAMDCI+EA EF+R+ V   +K+ F 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
           G +L   L              +E+V+VN+  +D E    AEA KLEGNKAMA KD+ LA
Sbjct: 61  GNSLSSYLNGSTSASAATT-TADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELA 119

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           ++KYTEAI  LPTNA+Y+ANRAAA+SSLK+++EA++DA SAIKI+P+YSKGYSRL FAK+
Sbjct: 120 IKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKF 179

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240
             GK E+ALE+YKKVLDIEGD AT  MKRDYETAKK+VE+S+N+EKS           T 
Sbjct: 180 AQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNA-----TA 234

Query: 241 ESAQGNAPNPFA--GGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQ 298
           ES   +A +PFA  GGMPD                   NP  M  AQ++M DP AM+QV+
Sbjct: 235 ESDSASAADPFAGMGGMPDF----SSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVE 290

Query: 299 SMMSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNMASNLF 337
           SMM +PS++ +A+ F +GN   D + +MN+P+IR+MA N+F
Sbjct: 291 SMMQNPSVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMF 331

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  356 bits (913), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 241/342 (70%), Gaps = 21/342 (6%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           M+ +NK+I ALIVDFLS+ +EKN VSED ADSLNVA+DCISEA EF+R+ V E +KN F+
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
            + L ++L             + E V+VNIP EDA  KA AE  KL+GNKAMA KDF  A
Sbjct: 61  NRKLDELLKSAATALPT----QSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETA 116

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           ++KYTEAI++LP+NA+YYANRAAA+SSLK++EE+++DAESAIK++PSYSKGYSRL FAKY
Sbjct: 117 IKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKY 176

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240
            LGK EEALE+YK VLDIEGD AT  MKRDYETAK++VE+S+N+EKS  P Q   Q+ + 
Sbjct: 177 ALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKS-VPTQTDEQESST 235

Query: 241 ESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQSM 300
           ++  G      A G PDM                  NP  MS AQKLM +P AM +   M
Sbjct: 236 DAGAG------ASGFPDM-----ASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDE---M 281

Query: 301 MSDPSMRDLANNFKN--GNTDMNDIMNNPAIRNMASNLFKGN 340
           M +P++R +A NF +  G  ++ D+M+NPAI++MA NLF  N
Sbjct: 282 MKNPAVRQMAENFSSGGGTPNLGDLMSNPAIKDMAKNLFGPN 323

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  348 bits (892), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 245/343 (71%), Gaps = 22/343 (6%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           M+ +NK++ +LI+D+L+ ++ K EVS D+ DSLNVA+DC++E    +++ +  TI++KFN
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
           GK+L ++L             K E+V++NIP EDAE KA AEA KLEGNKA+A KD+ LA
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLA 120

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           VEKYTEAIKILPTNA+Y+ANRAAA+++ + ++EA+KDAE AIK+DP+YSKGYSRLA+AKY
Sbjct: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240
                EE+LE+YKKVL+IEGD+AT   KR YETAKKRVEES+N+EKS   E   G  QTN
Sbjct: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGG--QTN 238

Query: 241 ESAQGNAPN---PFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQV 297
            +A G  P+     +GG+  +                  NP  M  AQ +MS+P AM+++
Sbjct: 239 PAAGGGFPDFSSLMSGGLEGL----------------MNNPQMMQAAQSMMSNPGAMEKI 282

Query: 298 QSMMSDPSMRDLANNFKNGNT-DMNDIMNNPAIRNMASNLFKG 339
           QSMM +P+++ +A  FK GNT D +++MNNPA+RNMAS+LF G
Sbjct: 283 QSMMQNPAIQQMAEQFKGGNTPDFSEMMNNPAVRNMASSLFSG 325

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  347 bits (891), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 238/346 (68%), Gaps = 25/346 (7%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           M L+NK+I  LIVD+L  + EKN+VSED  DSLNVA+DCI+++ EF+R+     IK+KF 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVE----DAEIKANAEAFKLEGNKAMAMKD 116
             +L ++L              +E+V VN+P +    D E K  AE  KLEGNKAMAMKD
Sbjct: 61  NLSLPELLEVAMENSA------KENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKD 114

Query: 117 FHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLA 176
           F LA+ KY+EAI I P NAIYYANRAAA+SSLK+FE+A +DAESAI++DP+YSKGYSRL 
Sbjct: 115 FDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLG 174

Query: 177 FAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSK-TPEQGQG 235
           FAKY L K EEALE+YKKVLD+EGD AT  MKRDYETAKKRVE+S+N+EK + TP++   
Sbjct: 175 FAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKE--- 231

Query: 236 QQQTNESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQ 295
                ES   +A N  AGG PDM                   P  M  AQ++MSDPNAM 
Sbjct: 232 -----ESVTESAANAAAGGFPDMSSMLGGGLNGLLNN-----PQLMQAAQQMMSDPNAMS 281

Query: 296 QVQSMMSDPSMRDLANNFKNGNT-DMNDIMNNPAIRNMASNLFKGN 340
           ++QSMM +PS+R +A NF+NGNT D + +MN+P I++MA N F GN
Sbjct: 282 KIQSMMQNPSIRQMAENFQNGNTPDFSQLMNDPNIKDMAKNFFGGN 327

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  341 bits (875), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/350 (53%), Positives = 239/350 (68%), Gaps = 17/350 (4%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETI-KNKF 59
           MS + ++I +LIV++ S+I+EK EVSED+ADSLNVAMDCISEA  F+R+ V   + K+ F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 60  NGKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHL 119
            G++L ++L            +  ++VEVNIP EDAE KA AE  K++GNKAMA K++ L
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 120 AVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAK 179
           A++KYTEAI +LPTNAIYYANRAAAHSSLKE++EAIKDAESAI +DPSY +GYSRL FAK
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 180 YGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQT 239
           Y  GK EEALE+YKKVLDIEGDNAT  MKRDYE+AKKRVE+S+N+EK+  PEQ +     
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKT-APEQPRDAGAN 239

Query: 240 NESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQS 299
                G                               NP  M  AQK+MS+P AMQ +Q+
Sbjct: 240 AGQGAGAG-----------GLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQN 288

Query: 300 MMSDPSMRDLANNFKN--GNTDMNDIMNNPAIRNMASNLFKG--NPSEEN 345
           MM DPS+R +A  F +  G  +++D+M NPA+RNMA +LF G   PS E+
Sbjct: 289 MMQDPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPSTED 338

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  335 bits (860), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 181/341 (53%), Positives = 233/341 (68%), Gaps = 24/341 (7%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           MS +NKD+  LIVDFLS  +E  EVSED  DSLNVA+DCI+EA EFDRE V  T++  F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
           G++L  ++              +ESV+VNIPVEDAE KA AE+ KLEGNKAMA KDF  A
Sbjct: 61  GRSLKQVVEAASVGSSS----PQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQA 116

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           V KY+EAI++LPTNA+YYANRAAAHSSLK++EEA+KDAE AIK++PSYSKGYSRL FA+Y
Sbjct: 117 VLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQY 176

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240
            LGK EEAL++YKKVLDIEG+ AT  MKRDY+TA K+V +S+NVEKS  P   +    + 
Sbjct: 177 ALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKS-APAATRDGAGSA 235

Query: 241 ESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQSM 300
             +          G+PD+                  NP  M  AQ++M +PNAMQ+V   
Sbjct: 236 TGSG---------GLPDI-----SSMLGGGLGGLLNNPQLMQAAQQMMQNPNAMQEV--- 278

Query: 301 MSDPSMRDLANNFKN--GNTDMNDIMNNPAIRNMASNLFKG 339
           M++P+++ +A  F++  G   M D+MNNPA+ +MA N+F G
Sbjct: 279 MNNPAVKQMAEKFQSGGGTPSMADLMNNPALMDMAKNMFGG 319

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  335 bits (858), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 183/342 (53%), Positives = 236/342 (69%), Gaps = 24/342 (7%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           MS +NKDI  L+VDFLST IEK  VS DNADSLNVA+DCI+EA EF+++ V  T+ +KF 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIP----VEDAEIKANAEAFKLEGNKAMAMKD 116
           GK+L ++L               E ++V+I      ED E+ A AEA KLEGNKAMA KD
Sbjct: 61  GKSLTELLDAATNAKGRSS--SPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKD 118

Query: 117 FHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLA 176
           ++LAVEKY  AIK++PT A+YYANRAAA+SS ++++EAIKDAESAIK++P++SKGYSRL 
Sbjct: 119 YNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLG 178

Query: 177 FAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQ 236
           FAK+  GK +EALE+YKK L+++GD AT  MKRDYETAKK+VE+S+NVEKS TP      
Sbjct: 179 FAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASA 238

Query: 237 QQTNESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQ 296
             +            AGGMPDM                  NP  M  AQ++MS+P AM+Q
Sbjct: 239 SAS------------AGGMPDM-----ASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQ 281

Query: 297 VQSMMSDPSMRDLANNFKNGNTD-MNDIMNNPAIRNMASNLF 337
           ++SMM +PS+R +A N  +G+++ M D MNNPAIR MASNLF
Sbjct: 282 MESMMQNPSIRQMAENLSSGSSEGMGDFMNNPAIREMASNLF 323

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  330 bits (847), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 177/341 (51%), Positives = 229/341 (67%), Gaps = 18/341 (5%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           MS +NK++ +LIVD+LS ++EK  VSE+  DSLNVA+DCI E+ E  +       K  F 
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKG----DSKAVFG 56

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
           GK LV++L             + ES++VNIP EDAE KA AE  KLEGNKAMA KDF LA
Sbjct: 57  GKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLA 116

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           ++KY++AI++LPTNA+YYANRAAAHSS+K +EEAIKDAESAIK DP+YSKGYSRL +AK+
Sbjct: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240
            LG+ E+ALE+YKKVLDIEGD A+  MKRDYETAKK+VE+S+++EK K   Q +G     
Sbjct: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEK-KPETQARGADAGA 235

Query: 241 ESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQSM 300
             A G+        M                     NP  M  AQ++M +P AM Q++SM
Sbjct: 236 GGAGGSGGFGDFASM-----------LGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESM 284

Query: 301 MSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNMASNLFKG 339
           M +P +R +A NF  GN   +M D+MNNPA+R+MA +LF G
Sbjct: 285 MQNPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGG 325

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  322 bits (826), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 235/341 (68%), Gaps = 17/341 (4%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           M+ +NK+I ALIVD+L+ +++K EVS DNADSLNVAMDCI+EA EF+R+ V +T+K+ FN
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIP--VEDAEIKANAEAFKLEGNKAMAMKDFH 118
           G  L   L                 ++VNI     D E KA AE  KLEGNKAMA KD+ 
Sbjct: 61  GNGLTSFLSGSAT----------NDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYE 110

Query: 119 LAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFA 178
            A++KY+EAI++LPTNA+YYANRAAA+SSLK++++A+ DAESAIK++P+YSKGYSRL FA
Sbjct: 111 SAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFA 170

Query: 179 KYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQ 238
           K+  GK E+AL++YKKVLDIEGD AT  MKRDYETAKK+VE+S+N+EK  TP++ + +  
Sbjct: 171 KFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKV-TPKEAETESN 229

Query: 239 TNESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQ 298
            +            GG PD+                  NP  M  AQ++M +PNAMQQ++
Sbjct: 230 ADAGTGAAGMGG-MGGFPDL-SSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQME 287

Query: 299 SMMSDPSMRDLANNFKN--GNTDMNDIMNNPAIRNMASNLF 337
           SMM +P++R +A NF +  G  D++ +MNNP +++MA N+F
Sbjct: 288 SMMQNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMF 328

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  318 bits (816), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 225/341 (65%), Gaps = 31/341 (9%)

Query: 5   NKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFNGKTL 64
           +K++ A+I+ +L  ++ +  V ED  DS+NVA+DCI+E+ E +R  V   +K     K L
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 65  VDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKY 124
            + L             K E V+VNIP EDAE KA AEA KLEGNKAMA KDF LA+ KY
Sbjct: 62  EECLECMKGGAV-----KSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKY 116

Query: 125 TEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGK 184
           +EAI++LPTNAIYYANRAAAHSSLK+++EA+ DAE AI+IDP+YSKGYSRL FAKY   K
Sbjct: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176

Query: 185 HEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTNESAQ 244
            EEALE+YKKV+D+EGD AT  MKRDYETAKK+VE+S+N+E  KTP+           A 
Sbjct: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLE--KTPDARGADSGAGAGAG 234

Query: 245 GNAPNPF------AGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQ 298
                 F      +GG+  +                  NP  M  AQ++MS+P A+QQ+Q
Sbjct: 235 AGGAGGFDFSSMLSGGLSGL----------------MNNPQIMQAAQQMMSNPQALQQMQ 278

Query: 299 SMMSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNMASNLF 337
           SMM DPS+R +A  F +GN   +M+D+M+NPA+RNMAS++F
Sbjct: 279 SMMQDPSIRQMAEQFTSGNGTPNMDDLMSNPALRNMASSMF 319

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  315 bits (808), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 169/334 (50%), Positives = 229/334 (68%), Gaps = 22/334 (6%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           M+ +NKDI +LIVD+L+ +++K  VSED+ DSLNVA++CI+EA   ++     +    F 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKG----SSSAAFG 56

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
           GK L ++L             + E+V+VNIP EDAE+K+ AE+ KLEGNKAMA KD+ LA
Sbjct: 57  GKNLAELLSAGAGAPSS----QGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELA 112

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           ++KY+EAI ++PTNA+YYANRAAAHSSLK ++EAIKDAESA+K+D SYSKGYSRL +AK+
Sbjct: 113 IKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKF 172

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240
             GK EEALE+YKKVLDIEGD+AT  MKRDYETAK++VE+++  E +KT E     + T 
Sbjct: 173 AQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQAL--ELNKTDETETSDRGTG 230

Query: 241 ESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQSM 300
           E A  N      GG  D+                  NP  M  AQ++M +P AM Q+++M
Sbjct: 231 EPAGAN-----PGGGFDL-----SSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETM 280

Query: 301 MSDPSMRDLANNFKNGNT--DMNDIMNNPAIRNM 332
           M +P++R +A  F  GN   ++NDIMNNPA+R+M
Sbjct: 281 MQNPNVRQMAEKFAGGNGTPNLNDIMNNPALRDM 314

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  305 bits (780), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 169/344 (49%), Positives = 229/344 (66%), Gaps = 25/344 (7%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           M+   K++ +LI+D+L    E  E+ ED  DSLNVA+DC++EA E ++E     I+  F 
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
           G++L  I+             ++E V+VNIPVEDAEIKA AEA KLEGNKAMA KDF  A
Sbjct: 61  GQSLEQIVGASSKGPTAT---QQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHA 117

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           + KY+EAI+ LP+NA+Y+ANRAAA+SSLK++ EA++DAE+AIK++PSYSKGYSRL FA+Y
Sbjct: 118 ISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQY 177

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240
            LG+ EEAL++YKKVLDIEG NAT  MKRDY+TA K+VE+S+NVE+S             
Sbjct: 178 ALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAP----------- 226

Query: 241 ESAQGNAPNPFAG---GMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQV 297
             A  NA +P A    G PD+                  NP  M  AQ++M +PNAMQ+ 
Sbjct: 227 --AASNAESPDAAGGSGFPDI-ASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAMQE- 282

Query: 298 QSMMSDPSMRDLANNFKN--GNTDMNDIMNNPAIRNMASNLFKG 339
             MMS+P+++ +A+ F++  G   M D+MNNPA+ +MA N+F G
Sbjct: 283 --MMSNPAIKQMADKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  294 bits (752), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 162/339 (47%), Positives = 218/339 (64%), Gaps = 26/339 (7%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           M  +NK+I ALIV FLST  +  +V E+  DSLNVA+DCI+EA E +RE   E +   +N
Sbjct: 1   MPGSNKEIAALIVQFLSTSTK--DVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
           G+ LVD++           +   E    N      E+   AE  KLEGNKA A KDF  A
Sbjct: 59  GRGLVDLVKSGASEPT---LSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGA 115

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           V+KYTEAI+++P NA++Y NRAAA+SS K+FEEA++DAESA++I+PSYS+GYSRL  AKY
Sbjct: 116 VKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKY 175

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240
            LGK EEA+E+YKKVLDIEGDNAT  MKRDYE+AKK+VEES+N+E     E    +QQT+
Sbjct: 176 ALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGE----EQQTS 231

Query: 241 ESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQSM 300
           E +        AGG PD+                  NP  M  AQK+M +P+AMQ+   M
Sbjct: 232 EGSS-------AGGFPDL-----SSMLGGGLGGLLNNPQVMQAAQKMMQNPSAMQE---M 276

Query: 301 MSDPSMRDLANNFKNGN--TDMNDIMNNPAIRNMASNLF 337
           M++P+++ +A NF +G    ++ D+M +P I++MA   F
Sbjct: 277 MNNPAIKQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFF 315

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  289 bits (739), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 173/341 (50%), Positives = 229/341 (67%), Gaps = 14/341 (4%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           MSL+NK+I ALIVDFLS+    + V+ED  DSLNVA+DCI+EA +F+R+     I   FN
Sbjct: 1   MSLSNKEIAALIVDFLSS--SSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
           GK L ++L               E V+V+IPVEDA  KA AE  KL+GNKAMA K F  A
Sbjct: 59  GKKLPELLASAPSSGGVSG----EPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEA 114

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           +EKYT AI++ P+NA+YY+NRAAA+SSLK++E+A+KDAE AI++DP+YSKG+SRL FAKY
Sbjct: 115 IEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKY 174

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240
            L K EEAL++YKKVLDIEG+ AT  MKRDYETAKK+VE SMN+EKS T       +  +
Sbjct: 175 ALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSST---SASSEDVS 231

Query: 241 ESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQSM 300
           + +    P   AGG+PD+                  NP  M  A+K+M +P  MQ    M
Sbjct: 232 DKSATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQD---M 288

Query: 301 MSDPSMRDLANNFKNGN--TDMNDIMNNPAIRNMASNLFKG 339
           MS+P+M+ +AN F +G    D++ +MN+P+IR+MA N+F G
Sbjct: 289 MSNPAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGG 329

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  280 bits (716), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 156/347 (44%), Positives = 218/347 (62%), Gaps = 33/347 (9%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           MS +NKDI ALIVDFL+T      V ED  DSL VA+DCI+EA E         +  K  
Sbjct: 1   MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
           G++L  +L               ++ E  +  E  E+K  AEA KLEGN+AMA KD+  A
Sbjct: 59  GRSLSQLLTTGMA-------HTSDAGEPKVAAE--ELKKEAEALKLEGNRAMAAKDYETA 109

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           ++KYT AI++LPT+A+YYANRAAA+SSL+++E+A++DAE A K+D SYSKG+SRL +AKY
Sbjct: 110 IQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKY 169

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240
            LG+HEEALE+YK+VLDIEGDNAT  M+RDYE+AK++VEES+N++++          +  
Sbjct: 170 ALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRN---------AEVT 220

Query: 241 ESAQGNAPNPFAGGMPDMXX--------XXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPN 292
           ES    A +    G+PD+                          NP  M  AQK+M +P+
Sbjct: 221 ESGDSAAGSAGGSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPS 280

Query: 293 AMQQVQSMMSDPSMRDLANNFK--NGNTDMNDIMNNPAIRNMASNLF 337
           A+Q+   MMS+P+++ +A NF   NG++ + D+M +PA+RNMAS  F
Sbjct: 281 AIQE---MMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFF 324

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  218 bits (555), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 192/351 (54%), Gaps = 40/351 (11%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           MSLNNKD GALIV++L  II+  EVSEDNA+SLNVA+DCIS+  E D     + I + FN
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEI----KANAEAFKLEGNKAMAMKD 116
              L  I            +       V + V++ EI    K  AEA KLEGNK M++K+
Sbjct: 61  KSDLKTITLKGLGLQNVSDV-------VELEVKNEEISEDKKKEAEALKLEGNKQMSLKN 113

Query: 117 FHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLA 176
           +  A++KY++AI+I P+N  YY+NRAAA+  +++F  A+ DA +AIK+DP+YSK YSRL 
Sbjct: 114 YKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLG 173

Query: 177 FAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQ 236
            AK   G +E+A+ ++KKVL++EGD +T  MK DYE AKK V+  + + K          
Sbjct: 174 AAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNK---------- 223

Query: 237 QQTNESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXX------XXNPDFMSTAQKLMSD 290
                    N P+P   G P +                             +       +
Sbjct: 224 ---------NVPDP--SGPPPLNTTDVLTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQN 272

Query: 291 PNAMQQVQSMMSDPSMRDLANNFKNGN--TDMNDIMNNPAIRNMASNLFKG 339
           P  MQQV+ +M +P +R  A N  NGN    ++D++NNP+++ +A+ L  G
Sbjct: 273 PEMMQQVEGLMQNPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLMNG 323

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  148 bits (373), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 134/224 (59%), Gaps = 22/224 (9%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           MSL+NK+I + IV +LS++I   +V+ED A+S++VA++CI ++ +   EV  ++      
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADS------ 54

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
              L  +L           + ++E   VN           A   KLEGNKA+  +++  A
Sbjct: 55  --DLATVLLANLNLEPEPKLSEKERELVN---------EQAIKLKLEGNKAVERENYKDA 103

Query: 121 VEKYTEAIKILPTNAI-----YYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           ++KYT AI +L  N +     Y +N++ A +    +EEA  DA + IKIDP++SKGYSRL
Sbjct: 104 IDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRL 163

Query: 176 AFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVE 219
           A AK G  K+E+A+ +YK+VLD+EG+ AT  MKRD+E  K++ E
Sbjct: 164 AEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE 207

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  145 bits (365), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 109/357 (30%), Positives = 166/357 (46%), Gaps = 61/357 (17%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           MSL  +   +LI+ +LS +   N + ED  +SL VA+ CI E+   D +++P ++K +  
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKER-- 58

Query: 61  GKTLVDILXXXXXXXXXXXIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120
             TL  IL            E   ++E    + + E    AEA K EGN+AM    +  A
Sbjct: 59  --TLKTILQ-----------ENLNTLEATQKIHNEE----AEALKKEGNEAMIEGQYEEA 101

Query: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180
           ++KYTEAI+    N  YY+NR+ A+S L  +E+A+ DA  AI IDPS+SK YSRL +AK 
Sbjct: 102 IKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKC 160

Query: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMN------------VEKSK 228
              K E+ + +YK+ +D+EG NA+  +  DYE A+ + E+               V   +
Sbjct: 161 CQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKEVTSEE 220

Query: 229 TPE----QGQGQQQTNESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXXXNPDFMSTA 284
            PE    Q +G    N  AQ N                                D  + A
Sbjct: 221 CPEKNNNQDEGFTAVNHYAQNN---------------DNKSKEETKEENRSQAADLSNIA 265

Query: 285 QKLMSDPNAMQQVQSMMSDPSMRDLANNFKNGNTD----MNDIMNNPAIRNMASNLF 337
           + L S       V  +M++P ++ +     N N D    + D++NNP +R   S L 
Sbjct: 266 RLLGSG------VGGLMNNPQLKQMVFQAINDNPDASRQVKDVLNNPLLRTTLSELM 316

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  144 bits (362), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 108/388 (27%), Positives = 188/388 (48%), Gaps = 59/388 (15%)

Query: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60
           M+  +++I ++IVD+ +  I   ++++DN DSLNVA+DCI++  + D++++   +K  + 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  GKTLVDIL---------XXXXXXXXXXXIEKEESV-----------EVNIPV-------E 93
              L+  L                    ++ ++ +           ++N+PV       E
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 94  DAEIKAN------AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSS 147
             E K +      AE  K +GN+ M  K +  A+  Y++AIK+ PTN  YY NRA A+  
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 148 LKEFEEAIKDAESAIKID----PSYSKGYSRLAFAKYGLGKHEEALESYKKVLDI----- 198
              F+ AI DA  +I+ID    P+  K Y RL  AKY +G +E +L ++K++++I     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 199 EGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTNESAQGNAPNPFAGGMPDM 258
           +GD  T  M  DYE AK++V+E   ++ +K+         T +   GN+ N   G    +
Sbjct: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKS---------TGKEGSGNSVND--GPKRKV 289

Query: 259 XXXXXXXXXXXXXXXXXXNPDFMSTAQKLM-SDPNAMQQVQSMMSDPSMRDLANNFKNGN 317
                             NP F    ++L+ S+P A QQ  ++M+DP +R +  N    N
Sbjct: 290 TLNDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENV---N 346

Query: 318 TDMNDIMNNPAIRNMASNLFKGNPSEEN 345
           +D   + N P ++++  +L      EEN
Sbjct: 347 SD--SMSNIPILKDLFYSLLNTTVYEEN 372

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  140 bits (354), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/351 (26%), Positives = 167/351 (47%), Gaps = 53/351 (15%)

Query: 3   LNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFNGK 62
           +N+KD+  LIV+FL  +I K E+S+DN DSLNVA+DCI +    +   +  ++  KF+  
Sbjct: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKS 65

Query: 63  TLVDILXXXXXXXXXXXIEKEESV--------------------------EVNIPVEDA- 95
            L  IL              +E+                           +++I + D  
Sbjct: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125

Query: 96  ------EIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLK 149
                 + K  A+ FK EGN+ M  +D+  A+E YT AI   P + IYY+NR+ A+  + 
Sbjct: 126 KNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185

Query: 150 EFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKR 209
           ++E AI DA   I ID ++SK Y RLA  K    ++ +AL+ YKK +++  D+    + R
Sbjct: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245

Query: 210 DYETAKKRVEESMNVEKSKTPEQGQGQQQTNESAQGNAPN---PFAGGMPDMXXXXXXXX 266
           ++E  K +V+  +++ +           + + ++  N+P+       G   +        
Sbjct: 246 EFEDLKLKVQTDISLREISNDHSNNNYNENSYNSTKNSPDIGSILGDGFAAL-------- 297

Query: 267 XXXXXXXXXXNPDFMSTAQKLM-SDPNAMQQVQSMMSDPSMRDLANNFKNG 316
                     NP       K++ ++P+A + +  ++++P+M++L  NFKNG
Sbjct: 298 --------LSNPMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNG 340

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score =  103 bits (256), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/107 (45%), Positives = 79/107 (73%), Gaps = 1/107 (0%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDAE 159
           A+ +K +GN A   KDF+ A+E +T+AI++ PT N + Y+NR+AA++S K+F+EA+ DA 
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 160 SAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAG 206
             +KI+P++SKGY+RL  A++GLG  EEA ++YK+ L ++ +N  A 
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNNNKAA 111

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 57/91 (62%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +LEG +     D+  AV+ Y+E IK  P +A  Y+NRAAA S L  F EAIKD ++
Sbjct: 389 AEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDN 448

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           AIK DP++ + Y R A A+  + ++  AL++
Sbjct: 449 AIKKDPNFVRAYIRKATAQIAIKEYANALDT 479

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 8/106 (7%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           K  A+  K+EGNK      F  A+E+Y +A   L  +  Y  NR+AA     +FE AI  
Sbjct: 252 KLEADEAKVEGNKLYKAHKFDEAIEQYNKAW-ALNKDITYLNNRSAAEFEKGDFETAIAT 310

Query: 158 AESAI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
              A+    ++   Y   +K ++R+  A +  G  +++++ Y+K L
Sbjct: 311 LNEAVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSL 356

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score =  102 bits (253), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 92/138 (66%), Gaps = 8/138 (5%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDA 158
           +AE FK +GN A   KDF  A E +++AI+   T N + Y+NR+A ++SLK+F+EA++DA
Sbjct: 2   SAEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDA 61

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRV 218
           E  +KI+P++SKGY+R+  A+YGLG  ++A + YKK L+I+  N  A      +   ++V
Sbjct: 62  EECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSNKAA------QEGLEQV 115

Query: 219 EESMNVEKSKTPEQGQGQ 236
           +++ N  + + P+ G GQ
Sbjct: 116 QKTQNA-RQQQPDLGFGQ 132

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 52/91 (57%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +L+G +     D+  AV  YTE IK  P +A  Y+NRAA  + L  F +AIKD + 
Sbjct: 401 AEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDV 460

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           AI  DP++ + Y R A A+  + +   A+E+
Sbjct: 461 AISKDPNFVRAYIRKASAQIAVREFAPAMET 491

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 62/118 (52%), Gaps = 8/118 (6%)

Query: 86  VEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAH 145
           +EV+ P  + + KA A+A K EGNK    + F  A+E Y +A   L  +  Y  NR+AA 
Sbjct: 252 MEVDEPEPEQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWD-LHRDVTYLNNRSAAE 310

Query: 146 SSLKEFEEAIKDAESAI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
               ++E+AIK    A+    ++   Y   SK ++R+  A   +   ++A+E Y++ L
Sbjct: 311 YEKGDYEQAIKTLTEAVDQGREMRADYKLISKSFARIGNAYLKMDDLKKAIEFYQRSL 368

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score =  101 bits (251), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 88/140 (62%), Gaps = 12/140 (8%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDA 158
            AE +K EGN A A KDF  A+E + +AI++    N + Y+NR+A ++S+++F EA+ DA
Sbjct: 3   TAEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADA 62

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA--GMKRDYETAKK 216
           +  ++I P +SKG++RL  A YGLG  +EA ESYKK L+++  N  A  G+ +   T ++
Sbjct: 63  QECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQ 122

Query: 217 RVEESMNVEKSKTPEQGQGQ 236
           R+E+         P+ G GQ
Sbjct: 123 RMEQ---------PDLGFGQ 133

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 56/91 (61%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +L+G +     D+  AV+ YTE IK  P +A  Y+NRAAA + L  F +AIKD + 
Sbjct: 388 AEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDM 447

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           AI+ DP++ + Y R A A+  + ++  A+E+
Sbjct: 448 AIQKDPNFVRAYIRKATAQIAVQEYAAAIET 478

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 8/106 (7%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           ++ AE  K +GN+    + F  A+  Y +A   L  +  Y  NRAAA     ++E AIK 
Sbjct: 251 RSKAEEAKAKGNELYKKRQFDEAIANYEKAWD-LHKDITYLNNRAAAEYEKGDYESAIKT 309

Query: 158 AESAIK----IDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
            E A++    +   Y   +K ++RL  A Y L   ++A+E Y+K L
Sbjct: 310 LEKAVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score =  101 bits (251), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 83/123 (67%), Gaps = 4/123 (3%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDA 158
            A+ +K +GN A   KD+  A++ +++AI++  T N ++Y+NR+A ++SLK+F EA+ DA
Sbjct: 3   TADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDA 62

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRV 218
           E  +KI+P++SKGY+RL  A  GLG  +EA  SYKK L+++G N  A   +D     KR 
Sbjct: 63  EECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSNQAA---KDGLDQVKRT 119

Query: 219 EES 221
           +ES
Sbjct: 120 QES 122

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 69/134 (51%), Gaps = 2/134 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +LEG       D+  AV+ YTE IK  P +A  Y+NRAAA S L  F EAI+D   
Sbjct: 390 AEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNK 449

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESY--KKVLDIEGDNATAGMKRDYETAKKRV 218
           AI+ DP++ + Y R A A+  + +   A+E+    +  D E +N+    + D    K   
Sbjct: 450 AIEKDPNFIRAYIRKATAQIAVKEFAAAIETLDAARTKDAEVNNSANVREIDQLYVKASQ 509

Query: 219 EESMNVEKSKTPEQ 232
           +       ++TPEQ
Sbjct: 510 QRFQPASSNETPEQ 523

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 51/103 (49%), Gaps = 22/103 (21%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK-IDP 166
           GNKA   + F  A+  Y  A   L  +  Y  NR+AA     EFE+   DAE+A+K +D 
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWN-LHQDITYLNNRSAA-----EFEKG--DAETALKTLDE 314

Query: 167 SYSKG------YSRLA--FAKYGLGKH-----EEALESYKKVL 196
           +  KG      Y  +A  FA+ G   H     ++A+E Y+K L
Sbjct: 315 AVEKGREMRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSL 357

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 98.6 bits (244), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 78/107 (72%), Gaps = 1/107 (0%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDA 158
           +A+ FK +GN A   KD+  A++ +T+AI++  T N + Y+NR+A ++S K+FEEA+KDA
Sbjct: 2   SADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDA 61

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
           E  +KI PS+SKGY+R+  A++GL + +EA +SYK+ L+++  N  A
Sbjct: 62  EECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSNKAA 108

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +L+G +     D+  AV+ YTE +K  P +A  ++NRAAA + L  F EAI+D   
Sbjct: 380 AEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNK 439

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           A+ IDP++ + Y R A A+  + +   A+E+
Sbjct: 440 AVSIDPNFVRAYIRKATAQIAVKEFAAAIET 470

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 61/120 (50%), Gaps = 11/120 (9%)

Query: 84  ESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAA 143
           E++EV+   E+   +  AEA K EGNK    + F  A+E Y +A + L  +  Y  NR+A
Sbjct: 232 EAMEVD---EEPNSRVAAEAEKAEGNKLYKARQFEEAIEHYNKAWE-LHKDITYLNNRSA 287

Query: 144 AHSSLKEFEEAIKDAESAI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
           A     +++ AIK    A+    ++   Y   +K ++R+  A Y L    +A+E Y + L
Sbjct: 288 AEFEKGDYDTAIKTLNDAVEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 98.6 bits (244), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 122/248 (49%), Gaps = 49/248 (19%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDA 158
            A+ +K EGN A   KD+  A++ +T+AI++  T N + Y+NR+AA++S K++E+A+ DA
Sbjct: 4   TADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDA 63

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRV 218
           +  IKI+PS++KGY+R   A  GL K+EEA + Y + L I+ +NA          AK  +
Sbjct: 64  DECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA---------IAKDSL 114

Query: 219 EESMNVEKSKTPEQGQGQQQTNESAQGNAPNPFAGGMP-DMXXXXXXXXXXXXXXXXXXN 277
            + +                   SAQ +A   F GG P DM                  +
Sbjct: 115 AQIV-------------------SAQQSASRGFPGGFPGDM-----------GLGELFKD 144

Query: 278 PDFMSTAQKLMSDPNAMQQVQSMMSDPSMRDLANNFKNGNTDM-NDIMNNPAIRNMASNL 336
           P+ M   +KL  DP    +V  +M+D       N++ N    + ND+M +P I  +   L
Sbjct: 145 PNLM---EKLRRDP----KVAELMNDQDFVAKINSYGNNPQALTNDMMTDPRIMQLFGAL 197

Query: 337 FKGNPSEE 344
              N  EE
Sbjct: 198 LGLNQPEE 205

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 71/134 (52%), Gaps = 6/134 (4%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +LEG +     D+  AV+ YTE IK  P +A  Y+NRAAA + L  F +AI D   
Sbjct: 385 AEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNK 444

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDI--EGDNATAGMKRDYETAKKRV 218
           AI+ DPS+ + Y R A  +  + +   A+E+    LD+  E D+   G + +   AK   
Sbjct: 445 AIEKDPSFIRAYLRKATCQIAVKEFAGAIET----LDLARERDDGKNGNEINQLYAKASA 500

Query: 219 EESMNVEKSKTPEQ 232
           +     E ++TPE+
Sbjct: 501 QRFQPAEGNETPEE 514

 Score = 36.6 bits (83), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 51/103 (49%), Gaps = 8/103 (7%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD--- 157
           A+  K EGNKA   + F  A+  Y +A +    +  Y  NR+AA     ++E  IK    
Sbjct: 251 ADKAKAEGNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTE 309

Query: 158 -AESAIKIDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
             E+A ++   Y   +K ++R+  A   L   ++A+E Y+K L
Sbjct: 310 AVENARELRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL 352

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 98.2 bits (243), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 125/249 (50%), Gaps = 69/249 (27%)

Query: 99  ANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKD 157
           + A+  K +GN A A KDF  A+E +TEAI    T N + Y+NR+A ++SLK+F+EA+ D
Sbjct: 2   STADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALND 61

Query: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDN--ATAGMKRDYETAK 215
           A+  +KI+P +SKGY+R+  A  GLG  ++A  +YKK L+++ +N  A+ G+++ +    
Sbjct: 62  AQQCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNNKAASEGLEQVH---- 117

Query: 216 KRVEESMNVEKSKTPEQGQGQQQTNESAQGNAPNPFAGGMPDMXXXXXXXXXXXXXXXXX 275
            RV+ES    KS+                                               
Sbjct: 118 -RVQES---RKSR----------------------------------------------- 126

Query: 276 XNPDFMSTAQKLMSDPNAMQQVQS------MMSDPSMRDLANNFKNGNTDM-NDIMNNPA 328
             PDF  T  ++ SDPN +++++       MM+DPS+     ++K+    + +D+M +P 
Sbjct: 127 --PDFGMT--EMFSDPNLIEKLRQNPKTKDMMNDPSLVAKLQSYKSNPQGLSSDLMGDPR 182

Query: 329 IRNMASNLF 337
           +  + + L 
Sbjct: 183 LMTIMATLL 191

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/91 (43%), Positives = 55/91 (60%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +LEG +     D+  AV+ YTE IK  P +A  Y+NRAAA + L  F EAIKD E 
Sbjct: 390 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEK 449

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           AI+ DP++ + Y R A A+  +    +ALE+
Sbjct: 450 AIEKDPNFVRAYLRKATAQIAIKDFVKALET 480

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 57/130 (43%), Gaps = 10/130 (7%)

Query: 107 EGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDP 166
           EGNK      F  A+ +Y +A   L  +  Y  NR+AA     +FE A+     A++   
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAWD-LHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGR 320

Query: 167 SYSKGYSRLA--FAKYGLGKHEE-----ALESYKKVL--DIEGDNATAGMKRDYETAKKR 217
                Y  +A  FA+ G    ++     A+E Y+K L      D  T     + E  K+ 
Sbjct: 321 ELRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLTEHRTADILTKLRTCEKELKKQE 380

Query: 218 VEESMNVEKS 227
           +EE +N EK+
Sbjct: 381 IEEYINPEKA 390

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 98.2 bits (243), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 81/121 (66%), Gaps = 3/121 (2%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDA 158
           NA+ +K +GN A   KD+  A+E +T+AI++  T N + Y+NR+A ++SLK+F +A+ DA
Sbjct: 4   NADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDA 63

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA--GMKRDYETAKK 216
           +  I I+PS+SKGY+RL  A  GLG  +EA  +YKK L+++  N  A  G+ + + T + 
Sbjct: 64  KECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDASNKAAKDGLDQVHRTQQA 123

Query: 217 R 217
           R
Sbjct: 124 R 124

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 53/91 (58%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +LEG       D+  AV+ YTE IK  P +A  Y+NRAAA + L  F EAI D   
Sbjct: 396 AEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           AI+ DP++ + Y R A A+  + ++  ALE+
Sbjct: 456 AIEKDPNFVRAYIRKATAQIAVQEYAAALET 486

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 66/124 (53%), Gaps = 9/124 (7%)

Query: 81  EKEESVEVN-IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYA 139
           ++EE+ E + + V++ + KA A+  K EGNK    + F  A+E Y +A + L  +  Y  
Sbjct: 241 QREENKESDPMEVDEDDSKAEADKEKAEGNKFYKARQFDEAIEHYNKAWE-LHRDITYLN 299

Query: 140 NRAAAHSSLKEFEEAIKDAESAI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESY 192
           NRAAA     E++ AI     A+    ++   Y   S+ ++R+  A + LG  ++ +E Y
Sbjct: 300 NRAAAEYEKGEYKTAIATLNDAVEQGREMRADYKVISRSFARIGNAYHKLGDLKKTIEYY 359

Query: 193 KKVL 196
           +K L
Sbjct: 360 QKSL 363

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 80/120 (66%), Gaps = 3/120 (2%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDAE 159
           A+ +K +GN A   KD+  A+E +T+AI++  T N + Y+NR+A ++SLK+F +A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDAN 64

Query: 160 SAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA--GMKRDYETAKKR 217
             +KI+PS+SKGY+RL  A  GLG  +EA  +YKK L+++  N  A  G+ + + T + R
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKAAKEGLDQVHRTQQAR 124

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 76/137 (55%), Gaps = 8/137 (5%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +LEG +     D+  AV+ YTE IK  P +A  Y+NRAAA + L  F EAI D   
Sbjct: 396 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESY--KKVLDIEGDNATAGMKRD---YETAK 215
           AI+ DP++ + Y R A A+  + ++  ALE+    +  D E +N ++  + D   Y+ ++
Sbjct: 456 AIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQ 515

Query: 216 KRVEESMNVEKSKTPEQ 232
           +R +   + E   TPE+
Sbjct: 516 QRFQPGTSNE---TPEE 529

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 65/123 (52%), Gaps = 10/123 (8%)

Query: 81  EKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYAN 140
           E +ES  + +  +D++I+A+ E  K EGNK    + F  A+E Y +A + L  +  Y  N
Sbjct: 244 ESKESEPMEVDEDDSKIEADKE--KAEGNKFYKARQFDEAIEHYNKAWE-LHKDITYLNN 300

Query: 141 RAAAHSSLKEFEEAIKDAESAI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESYK 193
           RAAA     E+E AI     A+    ++   Y   SK ++R+  A + LG  ++ +E Y+
Sbjct: 301 RAAAEYEKGEYETAISTLNDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQ 360

Query: 194 KVL 196
           K L
Sbjct: 361 KSL 363

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 91/140 (65%), Gaps = 12/140 (8%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKIL-PTNAIYYANRAAAHSSLKEFEEAIKDA 158
           +A+ +K +GN A A KDF  A+E +T+AI++    N + Y+NR+A ++S K+F +A++DA
Sbjct: 2   SADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDA 61

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA--GMKRDYETAKK 216
           +  + I+P++SKGY+R+  A +GLG  +EA + YKK L+++  N  A  G+++ ++T + 
Sbjct: 62  KQCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQVHKTQQS 121

Query: 217 RVEESMNVEKSKTPEQGQGQ 236
           R ++         P+ G GQ
Sbjct: 122 RQQQ---------PDLGLGQ 132

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 52/91 (57%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +L+G +     D+  AV+ YTE IK  P +A  Y+NRAAA S L  F EAIKD   
Sbjct: 393 AEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNV 452

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           AI  DP++ + Y R A A+  + +    +E+
Sbjct: 453 AISKDPNFIRAYIRKATAQIAVREFVSVIET 483

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 8/106 (7%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           KA A+A K EGNK    + F  A+E Y++A + L  +  Y  NRAAA     E+E AIK 
Sbjct: 256 KAKADAEKAEGNKFYKARKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIKT 314

Query: 158 AESAI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
              A+    ++   Y   SK ++R+  + + L + ++A+E Y+K L
Sbjct: 315 LTEAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 95.5 bits (236), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILP-TNAIYYANRAAAHSSLKEFEEAIKDA 158
           +A+ +K +GN A + K++  AV+ +++AI++ P  N + Y+NR+A ++SLK+F +A+ DA
Sbjct: 4   SADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDA 63

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
               KI+P++SKGY+R+  A YGLG  +EA +SYKK L+++  N  A
Sbjct: 64  NECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNKVA 110

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 80  IEKEESVEVNIPVEDAEIKAN---AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAI 136
           + K  S+E  I V++AE   N   AE  +++G        +  AV+ YTE I   P +A 
Sbjct: 368 LTKLRSLEKKIKVQEAEAYINPEKAEEARIQGKDFFNKGQWPDAVKAYTEMIARAPDDAR 427

Query: 137 YYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVL 196
            Y+NRAAA S L  F EAI D E A++ DP++ K Y R A A+  + ++  ALE+    L
Sbjct: 428 AYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKATAQIAIKEYSSALET----L 483

Query: 197 DI 198
           DI
Sbjct: 484 DI 485

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 53/111 (47%), Gaps = 2/111 (1%)

Query: 89  NIPVEDAEI-KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSS 147
           N+ V+DA++ K  A+A K EGNK      F  A+E Y +A + L  +  Y  N+AAA   
Sbjct: 245 NMEVDDADVQKKLADAEKDEGNKLYKAHKFDEAIEHYDKAWE-LHNDITYLNNKAAAQYE 303

Query: 148 LKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDI 198
             ++E  IK  E AI+        Y  +A A   +G   E L   KK  + 
Sbjct: 304 KGDYETTIKTLEDAIEKGRELRADYKIIAKAFTRMGNAYEKLNDLKKAAEF 354

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 95.1 bits (235), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 86/139 (61%), Gaps = 11/139 (7%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDA 158
           +AE FK +GN A   KD+  A E +T+AI+     N + Y+NR+A  +SLK+F EA+ DA
Sbjct: 2   SAEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDA 61

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRV 218
              +KI+P++SKGY+R+  A +GLGK +EA + YKK L+I+  N         + A+  +
Sbjct: 62  NECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTSN---------KAAQDGL 112

Query: 219 EESMNVEKS-KTPEQGQGQ 236
           E+    +KS + P+ G GQ
Sbjct: 113 EQVQKAQKSQQQPDLGFGQ 131

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 60/112 (53%), Gaps = 3/112 (2%)

Query: 80  IEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYA 139
            EKE+ V       D E    AE  +L+G +     D+  AV+ YTE  K  P +A  Y+
Sbjct: 383 CEKEQKVREAQAYIDPE---KAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYS 439

Query: 140 NRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           NRAAA + L  F EAIKD + AI  DP++ + Y R A A+  + +   A+E+
Sbjct: 440 NRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRKATAQIAVREFASAIET 491

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 62/118 (52%), Gaps = 8/118 (6%)

Query: 86  VEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAH 145
           +EV+ P  + + K NA+A K EGNK    + F  A+E Y +A   L  +  Y  NR+AA 
Sbjct: 252 MEVDEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWD-LHKDVTYLNNRSAAE 310

Query: 146 SSLKEFEEAIKDAESAI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
               ++E+AIK    A+    ++   Y   SK ++R+  A   L   ++A+E Y+K L
Sbjct: 311 YEKGDYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDA 158
           +A+ FK EGN+A A KD+  A+E +T+AI++    N + ++NR+A ++S K+F +A+ DA
Sbjct: 2   SADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDA 61

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
              +KI+PS++KGY+RL  A YGLG  +EA +SYKK L+++  N  A
Sbjct: 62  NECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDSANKAA 108

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 54/91 (59%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +L+G +     D+  AVE YTE IK  P +A  Y+NRAAA S L  F +AI+D + 
Sbjct: 389 AEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDK 448

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           AI+ DP++ + Y R A  +  +  +  A+E+
Sbjct: 449 AIEKDPNFVRAYIRKATGQIAIKDYAGAIET 479

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 60/113 (53%), Gaps = 8/113 (7%)

Query: 91  PVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKE 150
           P+E  + K+ AEA K EGNK    + F  A+EKY EA +    +  Y  NRAAA     +
Sbjct: 245 PMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGD 303

Query: 151 FEEAI----KDAESAIKIDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
           +E AI    K  E   ++   Y   SK ++R+  + + LG  ++A++ Y+K L
Sbjct: 304 YEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSL 356

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 81/121 (66%), Gaps = 3/121 (2%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDA 158
           +A+ +K +GN A   KD+  A++ +++AI +    N + Y+NR+A ++SLK+F  A+KDA
Sbjct: 4   SADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDA 63

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA--GMKRDYETAKK 216
           E  +KI+PS+SKGY+R+  A +G+G  +EA   YKK L+++  N  A  G+++ + T + 
Sbjct: 64  EECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASNKAAQEGLEQVHRTQES 123

Query: 217 R 217
           R
Sbjct: 124 R 124

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 62/115 (53%), Gaps = 3/115 (2%)

Query: 80  IEKEESVEVNIPVEDAEIKAN---AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAI 136
           + K  + E  + +++AE   N   AE  +LEG       D+  AV+ YTE IK  P +A 
Sbjct: 373 LSKLRAAEKQVKIQEAEDYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDAR 432

Query: 137 YYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
            Y+NRAA  S L  F EAI D   AI+ DP++ + Y R A A+  + +   ALE+
Sbjct: 433 GYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRKATAQIAVREFSSALET 487

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 106 LEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKID 165
            EGNK    + F  AV KY EA +    +  Y  NR+AA     ++E +IK  E A++  
Sbjct: 268 AEGNKLYKARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVEKG 326

Query: 166 PSYSKGYSRLA--FAKYG-----LGKHEEALESYKKVL 196
                 Y  +A  FA+ G     L   ++A++ YKK L
Sbjct: 327 REMRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 71/107 (66%), Gaps = 1/107 (0%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIK-ILPTNAIYYANRAAAHSSLKEFEEAIKDA 158
           +AE +K EGN A   KDF  AVE +T AI+     N + Y+NR+ A++SLK+F+EA+ DA
Sbjct: 3   SAEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDA 62

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
              +KI   +SKG++RL  A +GLG  +EA ESYKK L+++  N  A
Sbjct: 63  TECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDATNKAA 109

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 56/91 (61%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +L+G +     D+  AV+ Y+E I   P +A  Y+NRAAA S L  F +AIKD + 
Sbjct: 392 AEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDK 451

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           AI+IDPS+ + Y R A A+  + ++  A+E+
Sbjct: 452 AIEIDPSFVRAYIRKATAQIAVQEYSAAIET 482

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 59/120 (49%), Gaps = 11/120 (9%)

Query: 87  EVNIPVEDAEI---KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAA 143
           +   P E  E+   + NAE  K EGN+    + F  A+ KY EA   L  +  Y  NRAA
Sbjct: 241 KTQTPPEPMEVDLDRENAEKAKAEGNQLYKQRKFDEAIAKYEEAWN-LQKDITYLNNRAA 299

Query: 144 AHSSLKEFEEAIKDAESAI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
           A     ++  AIK    A+    ++   Y   +K ++RL  A Y L + ++A+E Y+K L
Sbjct: 300 AEYEKGDYNSAIKTLNEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 81/120 (67%), Gaps = 3/120 (2%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDAE 159
           A+ +K +GN A   K++  A+E +T+AI++  T + + ++NR+A ++SLK+F +A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDAN 64

Query: 160 SAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA--GMKRDYETAKKR 217
             +KI+PS+SKGY+RL  A  GLG  +EA   YKK L+++ +N  A  G+++ + T + R
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANNKAAKDGLEQVHRTQQAR 124

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 105/252 (41%), Gaps = 71/252 (28%)

Query: 92  VEDAEIKANAEAF---------KLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRA 142
           VE  + KA AEA+         +LEG +     D+  AV+ YTE IK  P +A  Y+NRA
Sbjct: 378 VEKEQKKAEAEAYINPDKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRA 437

Query: 143 AAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESY--KKVLDIEG 200
           AA + L  F EAI D   AI+ DP++ + Y R+A A+  + +   ALE+    +  D E 
Sbjct: 438 AALAKLMSFPEAIADCNKAIEKDPNFVRAYIRMAAAQIAVKEFAAALETLDVARTKDAEV 497

Query: 201 DNATAGMKRD---YETAKKRVEESMNVEKSKTPEQGQGQQQTNESAQGNAPNPFAGGMPD 257
           +   +  + D   Y+ +++R +       S+TPE+                         
Sbjct: 498 NKGASAKEIDQLYYKASQQRFQPDTG---SETPEE------------------------- 529

Query: 258 MXXXXXXXXXXXXXXXXXXNPDFMSTAQKLMSDPNAMQQVQSMMSDPSMRDLANNFKNGN 317
                                    T Q+ M DP    +V ++M DP M+ +    +   
Sbjct: 530 -------------------------TYQRAMKDP----EVAAIMQDPVMQSILQQAQQNP 560

Query: 318 TDMNDIMNNPAI 329
             + + M NPA+
Sbjct: 561 AALQEHMKNPAV 572

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 51/106 (48%), Gaps = 8/106 (7%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           KA A+  K EGNK      F  A+E Y  A + L  +  Y  NRAAA     ++E  I  
Sbjct: 259 KAEADNEKAEGNKFYKAHQFDEAIEHYNRAWE-LHKDITYLNNRAAAEYEKGDYETVIAT 317

Query: 158 AESAIK----IDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
              A++    +   Y   SK ++R+  A + LG  ++ +E Y+K L
Sbjct: 318 LNDAVEKGRDMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 87/140 (62%), Gaps = 12/140 (8%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDA 158
           +A+ +K +GN A   KD+  A E + +AI +    N + Y+NR+A ++SLK+F E +KDA
Sbjct: 3   SADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDA 62

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRV 218
           E  +KI+P +SKGY+R+  A++GL   E+A +SY+K L+++  N         + AK+ +
Sbjct: 63  EECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSAN---------KAAKEGL 113

Query: 219 EESMNVEKSKT--PEQGQGQ 236
           ++ +   +S+   P+ G GQ
Sbjct: 114 DQVLKTRESRQQMPDLGLGQ 133

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (58%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +LEG +  +  D+  AV+ YTE IK  P +A  Y+NRAAA + L  F EAI D + 
Sbjct: 382 AEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDR 441

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKV 195
           AI+ DP++ + Y R A A+  + +   A+E+   V
Sbjct: 442 AIEKDPNFIRAYIRKASAQIAVKEFAAAVETLDTV 476

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 8/103 (7%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  K EGNK    + F  A+E Y +A + L  +  Y  NRAAA     ++E AI    +
Sbjct: 248 AEEEKAEGNKFYKARKFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGDYETAIATLTN 306

Query: 161 AI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
           A+    ++   Y   +K ++R+  A + LG  ++++  Y+K L
Sbjct: 307 AVDEGREMRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKSL 349

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 90.1 bits (222), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 75/106 (70%), Gaps = 1/106 (0%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDAE 159
           A+ +K +GN A   K++  A+EK+T+AI++  T N + Y+NR+A ++S K+F + ++DA 
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 160 SAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
             +KI+P++SKGY+R+  A +G+G  +EA ++YKK L+++  N  A
Sbjct: 65  ECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSNKAA 110

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 53/91 (58%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +LEG +     D+  AV+ YTE I   P++A  Y+NRAAA S L  F EAI D  +
Sbjct: 389 AEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNT 448

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           AI+ DP++ + Y R A A+  +     A+E+
Sbjct: 449 AIEKDPNFIRAYIRKATAQIAIKDFVPAIET 479

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 60/117 (51%), Gaps = 10/117 (8%)

Query: 87  EVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHS 146
           E + P ++++I A+AE  K EGNK      F  A+E Y +A + L  +  Y  NR+AA  
Sbjct: 243 EASTPEDESKIAADAE--KAEGNKLYKAHKFDEAIEHYNKAWE-LHNDITYLNNRSAAEF 299

Query: 147 SLKEFEEAIKDAESAI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
              +++ AI+    A+    ++   Y   +K ++R+A +   L   + A+  Y+K L
Sbjct: 300 EKGDYQTAIETLHEAVEKGREMRADYKLVAKSFTRIANSYMKLNDIKSAINYYQKSL 356

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDAE 159
           A+ +K +GN A   KD+  A++ +T+AI++    N + Y+NR+A ++SLK+F +A+ DA 
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDAT 64

Query: 160 SAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
             +KI+PS+SKGY+RL  A  GLG  ++A  +YKK L+++  N  A
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDAANKAA 110

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 68/124 (54%), Gaps = 5/124 (4%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +LEG +     D+  AV+ YTE IK  P +A  Y+NRAAA + L  F EAI D   
Sbjct: 393 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNK 452

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESY--KKVLDIEGDNATAGMKRD---YETAK 215
           AI+ DP++ + Y R A A+  + +   ALE+    +  D E +N  +  + D   Y+ ++
Sbjct: 453 AIEKDPNFVRAYIRKATAQIAVQEFAGALETLDAARTKDAEVNNGASAKEIDQLYYKASQ 512

Query: 216 KRVE 219
           +R +
Sbjct: 513 QRFQ 516

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 66/123 (53%), Gaps = 10/123 (8%)

Query: 81  EKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYAN 140
           E +E+  + +  +D++++A+ E  K EGNK    + F  A+E Y +A + L  +  Y  N
Sbjct: 241 ETKEAEPMEVDEDDSKVEADKE--KAEGNKFYKARQFEEAIEHYNKAWE-LHRDITYLNN 297

Query: 141 RAAAHSSLKEFEEAIKDAESAI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESYK 193
           RAAA     ++E AI     A+    ++   Y   SK ++R+  A + LG  ++ +++Y+
Sbjct: 298 RAAAEYEKGDYETAIATLTDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIDNYQ 357

Query: 194 KVL 196
           K L
Sbjct: 358 KSL 360

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 111/214 (51%), Gaps = 20/214 (9%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT-NAIYYANRAAAHSSLKEFEEAIKDAE 159
           A+ +K +GN A A K +  AV+ +T+AI++  T N + Y+NR+A+++S ++F EA+KDA 
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDAL 64

Query: 160 SAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVE 219
              KI+PS++KGY+R   A +G+G  ++A  SYKK L+++ +N         + AK+ +E
Sbjct: 65  ECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANN---------KIAKEGIE 115

Query: 220 ESMNVEKSKTPEQGQGQQQTNESAQGNAPNPF--AGGMPDMXXXXXXXXXXXXXXXXXXN 277
           +   V+      Q Q Q     +   N PN        P                    N
Sbjct: 116 QIQRVQS-----QRQAQPDLGLTEMFNDPNLIEKLKNNPKTAELMNDPQLVAKLLSFRSN 170

Query: 278 PDFMSTAQKLMSDPNAMQQVQSMMS-DPSMRDLA 310
           P+ +  AQ L SDP  M  + ++M  D +M DL+
Sbjct: 171 PNGL--AQDLFSDPRLMTIMGTLMGIDLNMPDLS 202

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 52/91 (57%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  +LEG +     D+  AV+ YTE IK  P +A  Y+NRAAA S L  F +AI D   
Sbjct: 385 AEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNK 444

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           AI+ DP++ + Y R A A+  +     A+E+
Sbjct: 445 AIEKDPNFVRAYIRKATAQIAVKDFSYAIET 475

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 57/112 (50%), Gaps = 8/112 (7%)

Query: 92  VEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEF 151
           V+  E K  AE  K+EGNKA   ++F  A+  Y +A + L  N  Y  NR+AA     E+
Sbjct: 242 VDQDESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEY 300

Query: 152 EEAIKDAESAI----KIDPSY---SKGYSRLAFAKYGLGKHEEALESYKKVL 196
           + AI     AI    ++   Y   +K ++R+  A   +G  +EA+  Y+K L
Sbjct: 301 DTAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 78/142 (54%), Gaps = 6/142 (4%)

Query: 99  ANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDA 158
           A A  FK  GN A+  +D+  A+E YTEAIK+  T +IY++NRA  H  +  F+  I D 
Sbjct: 10  AKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDC 69

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRV 218
           + A++IDP   K Y R   +  GL + + A +  K VL  + ++ATA  KR  +  +K +
Sbjct: 70  DKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDATA--KRGLDVCEKFI 127

Query: 219 EESMNVEKSKTPEQGQGQQQTN 240
            E    E+ K    G+ QQ+ N
Sbjct: 128 RE----ERFKKAIGGEEQQKVN 145

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 65/110 (59%), Gaps = 1/110 (0%)

Query: 97  IKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNA-IYYANRAAAHSSLKEFEEAI 155
           +  +++  K  GNK    K +  AV  +T A+    TN  I Y+NRAAAH  LK + EA+
Sbjct: 4   VSMSSQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEAL 63

Query: 156 KDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
           +D ++ +++ P++ KGYSR+  A  GL K +EA E++KK L +   N  A
Sbjct: 64  EDGKNCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNVHA 113

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E  ++EG +    +++  A++ YTE IK  PT+ + + NRAA    L    + I D + A
Sbjct: 430 EEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKA 489

Query: 162 IKIDPSYSKGYSRLAFAKYGLGKHEEALESY 192
           I +DPSY K Y R  FA+      +EALE++
Sbjct: 490 ISVDPSYIKAYVRKGFAQITERDLDEALETW 520

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 58/135 (42%), Gaps = 12/135 (8%)

Query: 93  EDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAH------- 145
           E+ E K  A+  K  GN     ++F  A+  YT+A      +  Y  N  AA        
Sbjct: 287 EETEKKRRADEEKRIGNDLYKKRNFKEAIIHYTKAWNTF-QDITYLNNIGAAQFERGDYG 345

Query: 146 SSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD---- 201
           + LK   +A+  AE         +K Y R+  A + +  HE A+ +Y+  L + G+    
Sbjct: 346 NVLKSLGQAVFFAEHTNPEPQVLAKSYIRMGNAYHRIWDHEHAITAYEYGLMLNGNEEHK 405

Query: 202 NATAGMKRDYETAKK 216
              A ++ ++E  KK
Sbjct: 406 KKLASLRVEFEKVKK 420

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 71/123 (57%), Gaps = 4/123 (3%)

Query: 100 NAEAFKL--EGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           +AEA KL  EGN  +  +DF  A++ YT+AI +  T +IY++NRA AH  L  F+ ++ D
Sbjct: 9   SAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLND 68

Query: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKR 217
            + A+K+DP  +K Y R   +  GL + ++A    + VL  +  +ATA   R  +  +K 
Sbjct: 69  CDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATA--SRALDVCEKF 126

Query: 218 VEE 220
           + E
Sbjct: 127 IRE 129

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (54%), Gaps = 5/131 (3%)

Query: 90  IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLK 149
           + V D E+   A ++K EGNK +  +DF  A E YT+AI+  PT +I+Y+NRA A+  L 
Sbjct: 1   MAVYDTEL---ATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLD 57

Query: 150 EFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKR 209
            F  A+ D  +AI+++ S  K Y R   A  GL   + A   +  VL  + ++  A  K 
Sbjct: 58  NFMNALNDCTNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIA--KN 115

Query: 210 DYETAKKRVEE 220
            ++T +K + E
Sbjct: 116 GFDTCEKVIRE 126

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 71/126 (56%), Gaps = 5/126 (3%)

Query: 98  KANAEA---FKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEA 154
           K +AEA   FK EGN  +  +D+  A+E YT+AI++  T++I+Y+NRA AH  L  F+ A
Sbjct: 6   KPDAEAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSA 65

Query: 155 IKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETA 214
           + D   AIK+D +  K Y R   A  GL +  +A      +L  + ++ATA  KR  E  
Sbjct: 66  LHDCNDAIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTILLKYKPNDATA--KRGLEMC 123

Query: 215 KKRVEE 220
           +  + E
Sbjct: 124 ESFIRE 129

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 78/146 (53%), Gaps = 6/146 (4%)

Query: 95  AEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEA 154
           A+ K  A AFK EGN  +  +++  A+E Y++AI++ PT +I+++NRA A   L  F+  
Sbjct: 6   ADAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSC 65

Query: 155 IKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETA 214
           + D + A+++DP   K Y R   +  GL + ++A    + VL  +  +ATA  KR     
Sbjct: 66  MNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDATA--KRALAMC 123

Query: 215 KKRVEESMNVEKSKTPEQGQGQQQTN 240
           +K + E    E+ K    G  Q + N
Sbjct: 124 EKVIRE----ERFKKAIGGDDQDKLN 145

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 68/130 (52%), Gaps = 4/130 (3%)

Query: 91  PVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKE 150
           P E   +KA+    K EGN  +  K F  A+EKYTEAI +  T  IY++NRA +H  +  
Sbjct: 4   PTEADRVKAHER--KNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDN 61

Query: 151 FEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRD 210
           F+ A+ D + AIK+DP   K Y R A +   L + ++A      +L ++ ++  A   R 
Sbjct: 62  FQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVLLKVKPNDPAA--TRA 119

Query: 211 YETAKKRVEE 220
             T  + + E
Sbjct: 120 LATCDRFIRE 129

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 74/135 (54%), Gaps = 3/135 (2%)

Query: 104 FKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK 163
           +K +GNK +A KD+  A+E YT+AI++    +I+++NRA A+  L  F+ A++D+  AI+
Sbjct: 12  YKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIE 71

Query: 164 IDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMN 223
           +D S  KGY R   A  GL     A    + VL ++   ATA  KR    A +R+     
Sbjct: 72  LDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEATA--KRTL-LACERMIRRER 128

Query: 224 VEKSKTPEQGQGQQQ 238
            EK+     G  +QQ
Sbjct: 129 FEKAIRASGGNEEQQ 143

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 65/117 (55%), Gaps = 2/117 (1%)

Query: 104 FKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK 163
           +K EGN  + ++D+  A+EKY +AI++  T ++Y++NRA  H  L  F+ A +D + A+ 
Sbjct: 12  YKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALA 71

Query: 164 IDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEE 220
           +DP   K Y R   A  GL + ++A      VL  +  +A A  KR  +  +K + E
Sbjct: 72  LDPKNVKAYHRRGLACVGLLEFKKARADLTVVLKAKPSDAAA--KRALDICEKVIRE 126

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 2/114 (1%)

Query: 107 EGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDP 166
           EGNK +  K +  AVE YT+AI++  T +I+++NRA A   L  F+  + D  SA+++DP
Sbjct: 19  EGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDP 78

Query: 167 SYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEE 220
              K Y R   ++ GL   ++A      VL  +  +ATA  KR  +  +K + E
Sbjct: 79  KNIKAYHRRGLSQLGLLHFKKAKNDLSIVLKAKPSDATA--KRALDMCEKVIRE 130

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 55/91 (60%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           +ANA   K EGN  +  K F  A+EKYT+AI +  T +IY++NRA AH  +  F+ A+ D
Sbjct: 9   RANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEA 188
            + A+K+DP   K Y R A +   L + ++A
Sbjct: 69  CDEALKLDPKNIKAYHRRALSCMALLEFKKA 99

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 54/91 (59%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           +A A   K EGN  +  K F  A+EKYTEAI +  T +IY++NRA AH  +  F+ A+ D
Sbjct: 9   RAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEA 188
            + AIK+DP   K Y R A +   L + ++A
Sbjct: 69  CDEAIKLDPKNIKAYHRRALSCMALLEFKKA 99

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 50/82 (60%)

Query: 107 EGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDP 166
           EGN  +  K F  A+EKYTEAI +  T +IY++NRA AH  +  F+ A+ D + AIK+DP
Sbjct: 18  EGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDP 77

Query: 167 SYSKGYSRLAFAKYGLGKHEEA 188
              K Y R A +   L + ++A
Sbjct: 78  KNIKAYHRRALSCMALLEFKKA 99

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 58/94 (61%), Gaps = 1/94 (1%)

Query: 96  EIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAI 155
           ++   A A K +GN+    KDF  A+E YT AI  L  + ++Y+NR+AA+ S+  FE+ +
Sbjct: 99  QVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVV 157

Query: 156 KDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189
           +D  +A+K+ P YSK + R A A   LG+  +A+
Sbjct: 158 EDTTAALKLKPDYSKCWLRRASAYENLGQFSDAM 191

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 54/93 (58%)

Query: 104 FKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK 163
           FK +GN  +  K+F  A E Y++AI++  T +IY++NRA AH  L  F+ A+ D   AI+
Sbjct: 15  FKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIE 74

Query: 164 IDPSYSKGYSRLAFAKYGLGKHEEALESYKKVL 196
           +DP   K Y R   +  GL +  +A +  K VL
Sbjct: 75  LDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVL 107

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (57%)

Query: 91  PVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKE 150
           P  D+   A A  +K EGN+ +  KD+  AVE YT AI+   T +I+++NRA A+  L  
Sbjct: 28  PRRDSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDR 87

Query: 151 FEEAIKDAESAIKIDPSYSKGYSRLAFAKYGL 182
           F+ A++D+  AI++D    K Y R   A  GL
Sbjct: 88  FQSALEDSARAIELDAGNVKAYHRRGLAHCGL 119

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 58/111 (52%)

Query: 95  AEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEA 154
           AE  A A  FK EGN  +  +++  A+E YT+AI++ P  +I+Y+NRA A   L  F+ A
Sbjct: 6   AEDIAKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSA 65

Query: 155 IKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
             D   A+ +D    K Y R   A  GL + + A      VL  +  +ATA
Sbjct: 66  YNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVVLKAKPSDATA 116

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 70/146 (47%), Gaps = 6/146 (4%)

Query: 99  ANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDA 158
           A A  FK +GN+ +   D+  A+E Y++AI +  T +IY++NRA AH     F  A+ D 
Sbjct: 10  ATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDC 69

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRV 218
           ++A+K+DP   K Y R   +  G+ +  +A      VL  + ++ TA        A K  
Sbjct: 70  DNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITA------SNALKVC 123

Query: 219 EESMNVEKSKTPEQGQGQQQTNESAQ 244
           E  +  E+ K    G G    +   Q
Sbjct: 124 ENFIREERFKNAIGGSGDNAKSNICQ 149

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 53/108 (49%), Gaps = 4/108 (3%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIK----ILPTNAIYYANRAAAHSSLKEFEEAIK 156
           AE FK +GN    +K F  A E YT+ I+    +   N   YANRAA    LK F   I 
Sbjct: 78  AENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCIS 137

Query: 157 DAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
           D ++A+  +P   K Y R+  A   + K E A ES +    I+ DN +
Sbjct: 138 DCKTALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKS 185

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 59/110 (53%), Gaps = 5/110 (4%)

Query: 99  ANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDA 158
           A A  +K +GN  +  +DF  A E YT+AI++  T +I+++NRA AH     F+ ++ D 
Sbjct: 10  AKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDC 69

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVL-----DIEGDNA 203
           + A+++D    K Y R   +  GL + ++A    K VL     D+  D A
Sbjct: 70  DKALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRA 119

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 51/95 (53%), Gaps = 4/95 (4%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKI-LPTNAI---YYANRAAAHSSLKEFEEAIK 156
           AE FK +GN    +K F  A E Y++ I +    N I    YANRAA    +K +   I 
Sbjct: 81  AENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCIN 140

Query: 157 DAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           D + A++++P   K Y R+A A   L + +EALES
Sbjct: 141 DCKQALQLNPKNIKCYYRIAKAFTALERLDEALES 175

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 4/107 (3%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKIL----PTNAIYYANRAAAHSSLKEFEEAIK 156
           AE FK + N    +K F  A E YT+ IK+       N   +ANRAA    LK +   + 
Sbjct: 85  AENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVA 144

Query: 157 DAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNA 203
           D + A++I+P   K + R+  A   LGK +EA ++    L I+ +N 
Sbjct: 145 DCQKAMEINPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEENV 191

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 61/114 (53%), Gaps = 4/114 (3%)

Query: 96  EIKA----NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEF 151
           E+KA     A   K EGNK +  K +  A E YT+AI+  P N I Y+NRA  +  L  F
Sbjct: 4   EVKACNPEKALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNF 63

Query: 152 EEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
           + ++ DA+ AI++D +  K Y R A +  GL +  +A +    VL  + +  TA
Sbjct: 64  QSSLDDAKRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIVLKFKPNELTA 117

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 70/134 (52%), Gaps = 6/134 (4%)

Query: 104 FKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK 163
           FK +GN  +  K +  AVE Y++AI++  T +I+++NRA +   L  F  A++D   +I+
Sbjct: 15  FKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIE 74

Query: 164 IDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMN 223
           +DP   K   R   +  GL +  +A +  K +L ++ +  +A   +  E  ++ + E   
Sbjct: 75  LDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQSA--LKALEVCERFIRE--- 129

Query: 224 VEKSKTPEQGQGQQ 237
            E+ K    G G++
Sbjct: 130 -ERFKKAISGDGEE 142

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (54%)

Query: 104 FKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK 163
           FK +GN  +  K +  AVE Y++AI++  T +IY++NRA +   L  F  A +D + AI 
Sbjct: 13  FKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIA 72

Query: 164 IDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
           +DP   K   R   +  GL +  +A +  + VL ++ +  +A
Sbjct: 73  LDPKNIKAIHRRGLSYVGLLEFFKARKDLRVVLQVKPNEQSA 114

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKI----LPTNAIYYANRAAAHSSLKEFEEAIK 156
           AE FK +GN+    K F  A E YT+ I +       N   +ANRAA    LK +   I+
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIE 142

Query: 157 DAESAIKIDPSYSKGYSRLAFAKYGLGKHEEA 188
           D   A+ I+P   K Y R + A + L K EEA
Sbjct: 143 DCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 94  DAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKIL----PTNAIYYANRAAAHSSLK 149
           D E    AE FK + N     K F  A E Y + I+I       N   +AN AA    +K
Sbjct: 71  DGEPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIK 130

Query: 150 EFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
            F   I   + A++ +P   K Y R+A A Y L K +EA ES K  L I+ +N +
Sbjct: 131 NFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKS 185

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKIL----PTNAIYYANRAAAHSSLKEFEEAIK 156
           AE FK +GN    +K F  A + Y + I+I       N   +ANRAA    LK +   I 
Sbjct: 80  AENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCIN 139

Query: 157 DAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           D + A+ ++P   K Y R+  A Y L   EEA ES
Sbjct: 140 DCKHALTLNPKNIKCYYRMGKAFYLLNNIEEAKES 174

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 55/109 (50%), Gaps = 5/109 (4%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKI-----LPTNAIYYANRAAAHSSLKEFEEAI 155
           AE FK +GN     K F  A + Y + I+I     +      +AN+AA    LK F   I
Sbjct: 76  AENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCI 135

Query: 156 KDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
            D ++A++++P   K Y R+  A + L K EEA ES +  L  + +N +
Sbjct: 136 NDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKESVEFGLKFDPENTS 184

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 75/148 (50%), Gaps = 6/148 (4%)

Query: 94  DAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKI-LPTNAI---YYANRAAAHSSLK 149
           D E    AE FK +GN+   +K +  A E Y + I+I   +N I    ++NRAA    LK
Sbjct: 71  DGEPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELK 130

Query: 150 EFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKR 209
            +   + D   A++ +P+  K + R+A A + L K E+A E+ +  L +  D+ +A +K 
Sbjct: 131 NYRRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKL--DSESAALKA 188

Query: 210 DYETAKKRVEESMNVEKSKTPEQGQGQQ 237
             +   KR E+    E  +  E+ + ++
Sbjct: 189 LLQKVIKREEDKKAHEAKRLREETEKEK 216

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKI----LPTNAIYYANRAAAHSSLKEFEEAIK 156
           AE FK +GN+    K F  A E Y++ + +       N   YANRAA    LK +   I+
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIE 142

Query: 157 DAESAIKIDPSYSKGYSRLAFAKYGLGKHEEA 188
           D   A+ I+P   K Y R + A + L K EEA
Sbjct: 143 DCSKALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 53/89 (59%), Gaps = 1/89 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A   K +GN+    K F  A++ Y+ AI++   + ++Y+NR+A + SL + E+ ++D  +
Sbjct: 96  AMGLKDKGNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTA 154

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189
           A+K+ P YSK   R A A   LGK  +A+
Sbjct: 155 ALKLKPDYSKCLLRRASANESLGKFADAM 183

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A K +GN+      F  A++ Y  A+K L  + IYY+N +A ++SL ++E+ I+ A  
Sbjct: 110 AMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATK 168

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189
           A+K+ P++SK   R A A   +G   +A+
Sbjct: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAM 197

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A K +GN     KDF  A++ YT A+  L  + +YY+N +A +SSL  +E+ I+ A  
Sbjct: 95  AGALKEKGNALFKKKDFENAIKYYTFALS-LKEDPVYYSNISACYSSLLNYEKVIEMATK 153

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189
           A+ + P YSK   R A A   LG   +A+
Sbjct: 154 ALALRPDYSKVLVRRANAYEKLGNFGDAM 182

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 76/142 (53%), Gaps = 4/142 (2%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A   K +GN+    K +  A++ Y+ AI++   + ++Y+NR+A + SL + E+ ++D  +
Sbjct: 95  AMGLKDKGNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTA 153

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEE 220
           A+K+ P YSK   R A A   LG   +A+     V  + GD + A ++   E  +   ++
Sbjct: 154 ALKLKPDYSKCLLRRASANESLGNFADAMFDLSAV-SLYGDFSGASIEPLLE--RNMNKQ 210

Query: 221 SMNVEKSKTPEQGQGQQQTNES 242
           SM V K K  +Q + +  +N S
Sbjct: 211 SMLVLKEKLEKQQEYKLPSNTS 232

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 19/110 (17%)

Query: 124 YTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLG 183
           + +A+K+ P+ A  Y +R   +   ++FE+A KD E A ++  S    Y +LA   Y  G
Sbjct: 362 FEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREG 421

Query: 184 KHE--EALES---------------YKKVLDIEGDNATAGMKRDYETAKK 216
           K +  E L S               Y + L  +GD   AG ++ Y+ A K
Sbjct: 422 KFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGD--LAGARKQYDIAAK 469

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 58/104 (55%), Gaps = 2/104 (1%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           K  A A K +GN     K F  A+E Y  AIK L  + ++++N +A + SL + ++ ++ 
Sbjct: 90  KVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVES 148

Query: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
           +  A+++ P YSK   R A A   +G++++A+     VL + GD
Sbjct: 149 STRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGD 191

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKI----LPTNAIYYANRAAAHSSLKEFEEAIK 156
           AE FK +GN+    K F  A E YT+ + +       N   +ANRAA    LK + + ++
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVE 142

Query: 157 DAESAIKIDPSYSKGYSRLAFAKYGLGKHEEA 188
           D   A+ I+P   K Y R++ + + L K EEA
Sbjct: 143 DCGKALTINPKNIKCYYRISKSFFQLRKLEEA 174

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A K +GN+    + +  A++ Y  A+K L  + ++Y+NR+A +  L + E+ ++D  +
Sbjct: 95  AMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTA 153

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189
           A+K+ P YSK   R A A   LG + +A+
Sbjct: 154 ALKLKPDYSKCLLRRATANESLGNYADAM 182

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 71/141 (50%), Gaps = 4/141 (2%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           +A A   K  GN     K+F+ A++ Y  AI++ P   ++Y+N +A + S  + E+ I+ 
Sbjct: 124 QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEF 183

Query: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYET-AKK 216
              A++I P +SK   R A A   LG   +A+     VL + GD   A ++   E    K
Sbjct: 184 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGDFDGASIEPMLERNLNK 242

Query: 217 RVEESMNVEKSKTPEQGQGQQ 237
           +  + +N   SK  ++G+G Q
Sbjct: 243 QAMKVLNENLSK--DEGRGSQ 261

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 66/120 (55%), Gaps = 4/120 (3%)

Query: 88  VNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSS 147
            ++P+E  E K  +   K +GNK    KD+  A++ Y  A+  L  + I+Y+N +A + S
Sbjct: 111 TSLPLE--EQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVS 167

Query: 148 LKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGM 207
           L + ++ I+ +  A++++P+YSK   R A A   L  + +AL     VL + GD + A +
Sbjct: 168 LGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGDYSGASI 226

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 69/155 (44%), Gaps = 7/155 (4%)

Query: 93  EDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKI----LPTNAIYYANRAAAHSSL 148
           E  EI  N   FK +GN     K F  A E Y + I+I       N   YANRAA    +
Sbjct: 73  EPHEIAGN---FKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEI 129

Query: 149 KEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMK 208
           K +   + D ++A++ +P   K Y R+  A   L   EEA +S +  L ++  N      
Sbjct: 130 KNYRRCLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVEFGLQVDSSNKPLQSL 189

Query: 209 RDYETAKKRVEESMNVEKSKTPEQGQGQQQTNESA 243
            D    K+  ++  N +K +  +  +G Q   E+A
Sbjct: 190 LDIVLKKQEAKKEQNSKKEQEKQIREGMQIILENA 224

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 69/145 (47%), Gaps = 14/145 (9%)

Query: 93  EDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKIL----PTNAIYYANRAAAHSSL 148
           E  EI  N   FK  GN+   +K +  A E YT+ I +       N   YANRAA    L
Sbjct: 69  EPHEIAGN---FKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELEL 125

Query: 149 KEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT---- 204
           K F + I+D + A+  +    K Y R+  A   + + +E+ ES +  L I+ +N +    
Sbjct: 126 KNFRKCIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKSLKNL 185

Query: 205 --AGMKRDYETAKKR-VEESMNVEK 226
             A  KR  E  +++ +E  + +EK
Sbjct: 186 LQAIEKRQLEIQRRKDMEMKIKLEK 210

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 80  IEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYA 139
           I  E  +E+    E AE    A   K  GN    +KD+  A+  Y  A++ L  + ++Y+
Sbjct: 65  INDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYS 123

Query: 140 NRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189
           N AA + SL+  +EAI+    A++++P YSK   + A     +GK  +AL
Sbjct: 124 NMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 5/71 (7%)

Query: 141 RAAAHSSLKEFEEAIKDAESAIKI--DPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDI 198
           R  A+  +K++E AI   + A+++  DP +   YS +A     L  ++EA+E+  K L++
Sbjct: 92  RGNAYFKVKDYENAINYYKFALQLKNDPVF---YSNMAACYISLEHNKEAIEACSKALEL 148

Query: 199 EGDNATAGMKR 209
             D +   +KR
Sbjct: 149 NPDYSKVLLKR 159

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 103 AFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAI 162
           A K +GN+    K +  A++ Y+ A++ L  + ++Y+NR+A    L + E+ ++D  +A+
Sbjct: 100 AMKDKGNECFKEKKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAAL 158

Query: 163 KIDPSYSKGYSRLAFAKYGLGKHEEAL 189
           ++ P YSK   R A A   LG   +A+
Sbjct: 159 ELKPDYSKCLLRRATANESLGNFADAM 185

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 4/110 (3%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKIL----PTNAIYYANRAAAHSSLKEFEEAIK 156
           AE FK +GN     + +  A E Y + +++       N   + NRAA    LK     I 
Sbjct: 80  AENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCIN 139

Query: 157 DAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAG 206
           D + A++ +P   K + R+  A + L K EEA E+ +  L  + +NA  G
Sbjct: 140 DCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNAALG 189

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 70/140 (50%), Gaps = 6/140 (4%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKI----LPTNAIYYANRAAAHSSLKEFEEAIK 156
           AE FK +GN+A  +K +  A   Y   I++       N + + N+AA    +K +   I 
Sbjct: 74  AENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCIN 133

Query: 157 DAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA--GMKRDYETA 214
           D + A+  +P   K Y R+A A   + K++E+ ES +  L ++  N++    +K   +  
Sbjct: 134 DCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNSSLLNLLKTIIKKQ 193

Query: 215 KKRVEESMNVEKSKTPEQGQ 234
           +++    + +E+ K  ++G+
Sbjct: 194 EEKTAYRLKLEREKQEKEGK 213

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 55/116 (47%), Gaps = 7/116 (6%)

Query: 93  EDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILP----TNAIYYANRAAAHSSL 148
           E  EI  N   FK +GN    +K F  A E Y +AI +       N   YANRAA    L
Sbjct: 69  EPHEIAGN---FKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELEL 125

Query: 149 KEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
           K +   I D + A+ ++P   K Y R+A A   + K ++  E+ +  L  + +N +
Sbjct: 126 KNYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKS 181

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 53/105 (50%), Gaps = 2/105 (1%)

Query: 103 AFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAI 162
           A K +GN       F  A++ Y  AI+ L  N I+Y+N +A + SL + EE IK    A+
Sbjct: 113 ALKDKGNSLFKADKFEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKAL 171

Query: 163 KIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGM 207
           ++ P YSK   R A A   L  + +A+     VL + GD   A +
Sbjct: 172 ELKPDYSKVLLRRANANEKLENYADAMFDL-SVLSLNGDYNGASI 215

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 1/104 (0%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           +A A   K +GN     K F  A++ Y  AI++ P + ++Y+N +A + S  + ++ ++ 
Sbjct: 128 QAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEY 187

Query: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
              A++I P +SK   R A A   LG   +A+     VL + GD
Sbjct: 188 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

Query: 94  DAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNA----IYYANRAAAHSSLK 149
           D E    AE FK +GN    +K F  A   Y + I++   +A    +   NRAA    LK
Sbjct: 70  DGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELK 129

Query: 150 EFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDN 202
            +   I D   A+K++P   K + R+  A   L K EEA E+    L ++ +N
Sbjct: 130 NYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTEN 182

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A   K +GN+    K F  A++ Y  A++ L  + ++Y+NR+A + S+ + E+ ++D  +
Sbjct: 102 AMGLKDKGNEFFKEKKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTA 160

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189
           A+K+   YSK   R A A   LG + +A+
Sbjct: 161 ALKLKSDYSKCLLRRASANESLGNYADAM 189

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 4/92 (4%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILP----TNAIYYANRAAAHSSLKEFEEAIK 156
           A  FK +GN+    K F  A E Y + + +       N   +AN+AA    LK +   I+
Sbjct: 83  AGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIE 142

Query: 157 DAESAIKIDPSYSKGYSRLAFAKYGLGKHEEA 188
           D   A+ I+P  +K Y R + A + L K EEA
Sbjct: 143 DCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 107 EGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDP 166
           +GN     K+F  A++ Y  AI++ P + ++Y+N +A + S  +  + ++    A++I P
Sbjct: 131 KGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKP 190

Query: 167 SYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
            +SK   R A A   LG   +A+     VL + GD
Sbjct: 191 DHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 57/101 (56%), Gaps = 2/101 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A K +GN+    K +  A++ Y  A++ L  + ++Y+N +A + S+ + ++ ++ +  
Sbjct: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTK 157

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
           A+++ P YSK   R A A  GLGK  +A+     VL + GD
Sbjct: 158 ALELKPDYSKVLLRRASANEGLGKFADAMFDL-SVLSLNGD 197

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 107 EGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDP 166
           +GN     K+F  A++ Y  AI++ P + ++Y+N +A + S  +  + ++    A++I P
Sbjct: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189

Query: 167 SYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
            +SK   R A A   LG   +A+     VL + GD
Sbjct: 190 DHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (51%)

Query: 133 TNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESY 192
           T A+   N+     + K F EAIK  + AI++DP+    YS ++      G   + LE  
Sbjct: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181

Query: 193 KKVLDIEGDNATAGMKR 209
            K L+I+ D++ A ++R
Sbjct: 182 TKALEIKPDHSKALLRR 198

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A+  K +GN+    KD   A++ Y  A++ L  + ++Y+N +A + ++ + ++ I+ +  
Sbjct: 158 AKELKNKGNQYFKSKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNK 216

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
           A+++ P YSK   R A A   LG ++EAL  +  +L + G+
Sbjct: 217 ALELKPDYSKALLRRANAYEALGNNKEALYDF-SILSLFGE 256

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 56/101 (55%), Gaps = 2/101 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A K +GN+    K +  A++ Y  A++ L  + ++Y+N +A + S+ + ++ ++ +  
Sbjct: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTK 157

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
           A++I P YSK   R A A  GLG   +A+     VL + GD
Sbjct: 158 ALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 111 AMAMKDFHLAVEKYT---EAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           A+ M D + + E Y    +A+K+ P N+  Y +R   +  L+ +++A KD + A ++DP 
Sbjct: 370 ALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPE 429

Query: 168 YSKGYSRLAFAKYGLGKHEEA 188
               Y +LA   Y   K ++ 
Sbjct: 430 NIFPYIQLACLAYRENKFDDC 450

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 42/92 (45%), Gaps = 7/92 (7%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E  K +GN A    +F  A E Y + I + P N I Y+NRA A   L++F E I   +  
Sbjct: 5   ETVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRG 64

Query: 162 I-------KIDPSYSKGYSRLAFAKYGLGKHE 186
           +       K +P   K   RL  A+  L K +
Sbjct: 65  LGKLEDNEKDEPIRKKLLYRLHLAQESLNKFQ 96

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 69/141 (48%), Gaps = 13/141 (9%)

Query: 104 FKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK 163
            K +GN+    KD+  A++ Y  A+ IL  + ++Y+N +A + SL E ++ I+ +  A++
Sbjct: 111 LKDKGNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALE 169

Query: 164 IDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYE--TAKKRVEES 221
           + P YSK   R A A        E LE+Y    D   D +   +  D+   T +  +E +
Sbjct: 170 LKPDYSKALLRRATAN-------EQLENYS---DAMFDLSVLSLNNDFNGATIEPMLERN 219

Query: 222 MNVEKSKTPEQGQGQQQTNES 242
           +N +  K  +Q       NES
Sbjct: 220 LNKQAIKVLDQKSKNPSKNES 240

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 56/101 (55%), Gaps = 2/101 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A K +GN+    K +  A++ Y  A++ L  + ++Y+N +A + S+ + ++ ++ +  
Sbjct: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTK 157

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
           A+++ P YSK   R A A  GLG   +A+     VL + GD
Sbjct: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 56/101 (55%), Gaps = 2/101 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A K  GN+    KD+  A++ Y  A+ ++  + ++Y+N +A + SL + ++ ++++  
Sbjct: 101 ATALKDRGNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTK 159

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
           A+++ P YSK   R A A   L  + +A+     VL + GD
Sbjct: 160 ALELKPDYSKALLRRASANESLENYADAMFDL-SVLSLNGD 199

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 2/101 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A K +GN     +DF  A++ Y  A+  L  + ++Y+N +A + SL + E+ ++ +  
Sbjct: 105 AMALKDKGNDYFKKQDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTE 163

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
           A+K+   YSK   R A A   L  + +A+     VL + GD
Sbjct: 164 ALKLKHDYSKALLRRASAYESLANYVDAMVDL-SVLSLNGD 203

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 7/107 (6%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           DF   +E +  A+KI P + + +    A+ ++    EEAIK    AI + PS+ +    L
Sbjct: 456 DFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRARYNL 515

Query: 176 AFAKYGLGKHEEA---LESYKKVLDIEGDNATAGMKRD---YETAKK 216
           A A   +G ++EA   L +  K+  + G + T+ +K D    ET K+
Sbjct: 516 AVASMNIGCYQEAAGHLLTVLKMHQVHGQDNTS-VKTDTAVLETLKR 561

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 35/55 (63%)

Query: 145 HSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIE 199
           H S  +F++ ++  ++A+KI+P+    ++RL  +     + EEA+++Y K ++++
Sbjct: 451 HYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 56/101 (55%), Gaps = 2/101 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A K +GN+    K +  A++ Y  A++ L  + ++Y+N +A + S+ + ++ ++ +  
Sbjct: 99  ALALKDKGNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTK 157

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
           A+++ P YSK   R A A  GLG   +A+     VL + GD
Sbjct: 158 ALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 7/100 (7%)

Query: 93  EDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKIL----PTNAIYYANRAAAHSSL 148
           E  E+ AN   FK +GN    +K +  A   Y++ I++       N   Y NRAA    L
Sbjct: 74  EPHEVAAN---FKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELEL 130

Query: 149 KEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEA 188
           + F   I D + A+  +    K + R+  A + L K EEA
Sbjct: 131 RNFRSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEA 170

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 62/126 (49%), Gaps = 9/126 (7%)

Query: 80  IEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYA 139
           I+K   +  ++P  DA+++       + G    A  DF   +E + E++KI P + + + 
Sbjct: 416 IKKFNRLAESLPEHDAKLEL------IRGLLYYAEDDFDKTIECFKESLKINPNDEVMWN 469

Query: 140 NRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVL--- 196
              A+ ++  + E+AI+    A+ + PS+ +    LA A   +G ++EA E    VL   
Sbjct: 470 RLGASLANSNKPEDAIQAYHRALNLKPSFVRARYNLAVASMNIGCYKEAGEHLLTVLRMH 529

Query: 197 DIEGDN 202
            +EG N
Sbjct: 530 QVEGVN 535

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 55/99 (55%), Gaps = 2/99 (2%)

Query: 103 AFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAI 162
           A K +GN+    KD+  A++ Y  A+  L  + ++Y+N +A + S+ + ++ ++++  A+
Sbjct: 108 ALKDKGNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166

Query: 163 KIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
           ++ P YSK   R A A   L  + +A+     VL + GD
Sbjct: 167 ELKPDYSKALLRRASANESLENYPDAMFDL-SVLSLNGD 204

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 90  IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLK 149
           +PV D++++         G    A  DF+  ++ +  A+++ P + + +    AA ++  
Sbjct: 441 LPVVDSDVQL------CLGLLFYANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSN 494

Query: 150 EFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVL---DIEG 200
             EE+IK    A+++ PS+ +    LA +   +G ++EA+E     L   ++EG
Sbjct: 495 RSEESIKAYHRALQLKPSFVRARYNLAVSSMNIGCYKEAVEHLLTALSMHEVEG 548

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 48/102 (47%), Gaps = 7/102 (6%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E +K EGN+      + +A E Y + + I P N I Y+N+A A   L  + E ++     
Sbjct: 4   EQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKG 63

Query: 162 IKIDPSYSKG-YSRLAFAKYGLGKHEEALESYKKVLDIEGDN 202
           +   P+ +   Y +L +      + E AL++ K V D E  N
Sbjct: 64  LTFTPNTTDTVYKKLNY------RLEMALKNMKHVNDQEQSN 99

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E +   GN     K+ H A++ + +A ++ P  A  Y  +   ++S   F+ A +    A
Sbjct: 529 ETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKA 588

Query: 162 IKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
           I  DP +   Y  L      LG++EEAL  ++K   I   N  
Sbjct: 589 IACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVV 631

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 55/132 (41%), Gaps = 8/132 (6%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A+ L+G++  +   F +A   Y +AI   P +   Y         L ++EEA+   E 
Sbjct: 562 AYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEK 621

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKR--------DYE 212
           A  I+P           A   L   E+AL+ Y+   +++  ++ A  KR         Y 
Sbjct: 622 ARSINPINVVLVCCGGVALEKLSYQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYT 681

Query: 213 TAKKRVEESMNV 224
            A K  EE  +V
Sbjct: 682 LALKFFEELKHV 693

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 46/98 (46%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           G  +M +  +  A+  + +A  I P N +       A   L   E+A++  E A ++ PS
Sbjct: 603 GMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLSYQEKALQYYELACELQPS 662

Query: 168 YSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
            S    + A   Y +G++  AL+ ++++  +  D AT 
Sbjct: 663 SSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATV 700

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 44/103 (42%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E +   GN     KD   A+E + +A KI P  A  Y  +    SS   F+ A K    A
Sbjct: 552 ETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKA 611

Query: 162 IKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
           I  DP +   Y  +      LG ++EAL  ++K   I   NA 
Sbjct: 612 IACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAV 654

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 10/153 (6%)

Query: 93  EDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKI----LPTNAIYYANRAAAHSSL 148
           E  EI  N   FK +GN     K F  A   Y +A+ +    L  N   Y N AA    +
Sbjct: 65  EPHEIATN---FKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEI 121

Query: 149 KEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMK 208
           K +   I     A+K++    K + R+  A   LG+ E++LE+ +  L ++ +N    +K
Sbjct: 122 KNYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPEN--GALK 179

Query: 209 RDYETAKKRVEESMNVEKSKTPEQGQGQQQTNE 241
                A ++++    +E ++T  Q Q +++  E
Sbjct: 180 SIQSKATEKLKRKKELE-NRTLAQKQKEKELQE 211

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 58/119 (48%), Gaps = 23/119 (19%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTN----AIYYANRAAAHSSLKEFEEAIKD 157
           E FK +G  +    D+H A + Y +++  LP       + ++N       + E+ EA+ D
Sbjct: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385

Query: 158 AESAIKIDP---------------SYSKGYSRL----AFAKYGLGKHEEALESYKKVLD 197
           A SA+K+ P               +Y + +S++    A A   +  +E+ALE+Y+++++
Sbjct: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIE 444

>TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3.32
           YNL313C
          Length = 914

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 50/108 (46%), Gaps = 1/108 (0%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAE 159
           N E +   G   +      LA E ++  + +  TNA+ ++N +AA+ +  + +EA     
Sbjct: 645 NFETWYFYGCIGLECGKMQLAAEAFSRCVSLDDTNAMAWSNLSAAYVNQGKLKEAFSCLN 704

Query: 160 SAIKIDPSYS-KGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAG 206
            A + D   + + +       + L + +E L S KK++DI  D A  G
Sbjct: 705 RATRTDSQKNWRIWENYMIVAFKLREWDEVLLSCKKLIDINKDRAGEG 752

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 78/183 (42%), Gaps = 31/183 (16%)

Query: 90  IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTN----AIYYANRAAAH 145
           IP+   E+    E +   G+      D+  A+E+Y +++  LP +     I Y+N  AA 
Sbjct: 347 IPISSIELSGYNE-YNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAE 405

Query: 146 SSLKEFEEAIKDAESAIKIDP-----------------SYSKGYSRLAFAKYGLGKHEEA 188
             + E+   +K A+ A+K+ P                 SY   +S+L   K    +H E 
Sbjct: 406 LKIGEYSNLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLEN 465

Query: 189 LE-SYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTNESAQGNA 247
            E +YK+   +  +N  +    D    K+R ++ +N E +K     + QQ+ + S     
Sbjct: 466 FELAYKQYHSLIENNVFSDKIMD---GKRRCQKVLNPEIAK-----KTQQKPSSSKPAAV 517

Query: 248 PNP 250
           P P
Sbjct: 518 PTP 520

>NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {ON}
           Anc_7.458 YJR088C
          Length = 300

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 69/137 (50%), Gaps = 22/137 (16%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTN---------AIYYANRAAAHSSLKEFE 152
           E + + G   M +KDF  A+  + E + I+P N         ++YY  ++ +HSS  + E
Sbjct: 165 ELWWMLGEIYMNLKDFDRAIYCFEEILCIMPFNYVAFAQLAESLYYKAKSMSHSSKAKVE 224

Query: 153 -------EAIKDAESAIKIDPSYSKGYSRLAFAKYGLG-KHEE-ALESYKKVLDIEGDNA 203
                  +++ +A  +I++   Y KG+S +A     LG KH + AL + +K+ +I    +
Sbjct: 225 LRKEIVQKSMNNALRSIELSGLYLKGWSMVAITSQELGPKHVKIALLAKRKLQEI----S 280

Query: 204 TAGMKRDYETAKKRVEE 220
           T    +D  TAK  +E+
Sbjct: 281 TVSNAKDQITAKYLLEK 297

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAE 159
           N E  K +GN +     +  A+  Y   I I P+N I Y+N+A A      F+EAI   E
Sbjct: 2   NFEELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCE 61

Query: 160 SAIKI 164
             +++
Sbjct: 62  KGLQL 66

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 61/129 (47%), Gaps = 14/129 (10%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           G  +M + ++  A+  + +A  I P+NAI           L   E+A+   E A +I P+
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

Query: 168 YSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA-----------GMKRDYETAKK 216
            S    + A   Y + K+ +AL+++++++ I  + AT            G K+D   A K
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLYQIMGRKKD---AIK 781

Query: 217 RVEESMNVE 225
           R   +MN++
Sbjct: 782 RYTIAMNLD 790

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 44/108 (40%)

Query: 96  EIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAI 155
           E +   E +   GN     KD   A+  + +A K+ P     Y  +   + S+  ++ A 
Sbjct: 585 EFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAK 644

Query: 156 KDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNA 203
                AI  D  +   Y  +      LG++E+AL  ++K   I   NA
Sbjct: 645 TFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNA 692

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 66/149 (44%), Gaps = 28/149 (18%)

Query: 88  VNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILP----TNAIYYANRAA 143
           V +P+   E+    E F+  G +     D+  A+ +Y +++  LP       I Y+N  A
Sbjct: 534 VKVPISTIELSGYTE-FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILA 592

Query: 144 AHSSLKEFEEAIKDAESAIKIDPSYSKGYS---------------------RLAFAKYGL 182
           A   + E+ +++KD + A+++ P   K ++                     R A A   +
Sbjct: 593 AQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHM 652

Query: 183 GKHEEALESYKKVL--DIEGDNATAGMKR 209
            K++ A +SY+ +L  ++  D   AG +R
Sbjct: 653 EKYQIAYDSYQLLLHKNVFNDKIMAGKRR 681

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%)

Query: 132 PTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALES 191
           P   +   NRAA    L + + A+ DA   I +D    KGY R       LG++EEAL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 192 YKKVLDIEGD 201
           Y+  L   G+
Sbjct: 127 YENGLKQAGE 136

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 46/89 (51%), Gaps = 3/89 (3%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           +F   ++ +  A+K+ P + + +    A+ ++    EEAI+    A+++ PS+ +    L
Sbjct: 439 EFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 498

Query: 176 AFAKYGLGKHEEALESYKKVL---DIEGD 201
           A +   +G ++EA E     L   D+EG+
Sbjct: 499 AVSSMNIGCYKEAAEHLLTALSMHDVEGE 527

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A K +GN+    K    A++ Y  A++    + ++YAN +A + SL +FE+ +++   
Sbjct: 106 ALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNK 164

Query: 161 AIKIDPSYSKGYSRLA 176
           A+++ P YSK   R A
Sbjct: 165 ALELKPDYSKVLLRRA 180

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           + FK  GN+     ++ LA+E+Y + I + PTNA+ Y+N A A+  LK       +A++A
Sbjct: 36  QHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAY--LK--NRCPDEAKTA 91

Query: 162 IKIDPSYSK 170
            ++  SY K
Sbjct: 92  CEMGLSYCK 100

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 103 AFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAI 162
           A K +GN+    + +  A++ Y  A+  L  + ++Y+N +A + SL   E+ ++ +  A+
Sbjct: 101 ALKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKAL 159

Query: 163 KIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
           ++ P YSK   R A A   L    EA+     VL + GD
Sbjct: 160 ELKPDYSKALLRRASANENLENFAEAMFDL-SVLSLNGD 197

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 59/132 (44%), Gaps = 4/132 (3%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKIL----PTNAIYYANRAAAHSSLKEFEEAIK 156
           AE FK +GN     K +  A E Y   I I       N   ++NRAA    LK +   + 
Sbjct: 78  AENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVN 137

Query: 157 DAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKK 216
           D + A++ +    K Y R+A A   L K E+A ++ +  L ++ +N      R     KK
Sbjct: 138 DCKRALQYNVKNIKCYYRIAKAFLLLNKLEDAKQAAEFGLKLDPENQALNALRQNVDKKK 197

Query: 217 RVEESMNVEKSK 228
           +  ++   +K K
Sbjct: 198 QDADAFEAKKLK 209

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEA 154
           E FK++GN A    +F  AV  Y +AI   PTN + Y+N A A   L  + +A
Sbjct: 5   EEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADA 57

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E +K  GN      ++  AVE Y + I++ P N I Y+N A +   L ++ EA++   + 
Sbjct: 4   EEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTG 63

Query: 162 IK-IDPSYSKGYSRLAFAKYGLGKHE 186
           +K ++ + S+ Y +L + +Y L   E
Sbjct: 64  LKYVNDADSQVYKKLQY-RYNLADTE 88

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 52/101 (51%)

Query: 95  AEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEA 154
           AE++ N   F++ G   +  ++   ++E +  A++I P +   +     A+ +    E +
Sbjct: 681 AELRKNNWPFRVVGIAHLEKQEESDSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEAS 740

Query: 155 IKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKV 195
           IK  + AI++ PS++      A +   +G++ E+LE  KKV
Sbjct: 741 IKVFDKAIQLRPSHTYAQYFKAVSLCDIGEYLESLEILKKV 781

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           + +   GN     KD   A++ + +A ++ P  A  Y  +   HSS   F+ A      A
Sbjct: 536 QTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKA 595

Query: 162 IKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDI 198
           +  DP +   Y  L  +   LG+++EAL  ++K   I
Sbjct: 596 LACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 45/98 (45%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           G   M +  +  A+  + +A  I P N I       A   L+  E+A+   E A ++ PS
Sbjct: 610 GMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKALSYYELACELQPS 669

Query: 168 YSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
            S    + A   Y +G++  AL+ ++++  +  D AT 
Sbjct: 670 SSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEATV 707

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 47/109 (43%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           A A+ L+G++  +   F  A   Y +A+   P +   Y     +   L +++EA+   E 
Sbjct: 569 AYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEK 628

Query: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKR 209
           A  I+P           A   L   E+AL  Y+   +++  ++ A  KR
Sbjct: 629 ARSINPINVILICCCGVALEKLQYQEKALSYYELACELQPSSSLANFKR 677

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%)

Query: 104 FKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK 163
           FK EGN+     ++  A++ Y + I+I P N I Y+N+A A     + +EA++  +  +K
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGLK 65

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 45/96 (46%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           +F   ++ +  A+K+ P + + +    A+ ++    EEAI+    A+ + PS+ +    L
Sbjct: 465 EFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVRARYNL 524

Query: 176 AFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDY 211
           A +   +G ++EA +     L +       G K +Y
Sbjct: 525 AVSSINIGCYKEAAQYLLTALSMHEVEGLKGSKSNY 560

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 37/69 (53%), Gaps = 8/69 (11%)

Query: 131 LPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALE 190
           L    ++Y+N         EF++ I   ++A+K+ P+    ++RL  +     + EEA++
Sbjct: 454 LGLGLLFYSN--------NEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQ 505

Query: 191 SYKKVLDIE 199
           +Y K L+++
Sbjct: 506 AYHKALNLK 514

>SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 628

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 3/126 (2%)

Query: 103 AFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAI 162
           A+ L G++ + +K+ H A+E Y  A+ I P +   +     A+  L     ++   + A 
Sbjct: 434 AWTLMGHEFVELKNSHAAIESYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKAC 493

Query: 163 KIDPSYSKGYSRLAFAKYGLGKHEEALESYKKV--LDIEGDNATAGMKRDYETAKKRVEE 220
            + P   + +  LA     L K +E+++ Y++   L I  D+ TA + R      +R+++
Sbjct: 494 ALKPLDKRMWQALASCYEKLSKKDESIKCYERALQLSISSDHDTAILYR-LALLYERIQD 552

Query: 221 SMNVEK 226
             N  K
Sbjct: 553 VRNCRK 558

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (42%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E +   GN     KD   A++ + +A ++ P  A  Y  +   HSS    + A      A
Sbjct: 546 ETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKA 605

Query: 162 IKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
           +  DP +   Y  L  +   LG++EEAL  ++K   I   N  
Sbjct: 606 LACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 648

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 25/129 (19%)

Query: 90  IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILP----TNAIYYANRAAAH 145
           IP+   EI    E FK  G       D+  AVE+Y +++  LP       I Y+N  A+ 
Sbjct: 352 IPISHIEISGYNE-FKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASR 410

Query: 146 SSLKEFEEAIKDAESAIKIDP-----------------SYSKGYSRLAFAKYGLGKHEEA 188
             + +  +++ DA+ A+K+ P                 SY+  + ++   +    +  EA
Sbjct: 411 IKIGQHSQSVVDAQEAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQ---AESYEA 467

Query: 189 LESYKKVLD 197
           +E YK  LD
Sbjct: 468 IEKYKLALD 476

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (42%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E +   GN     KD   A++ + +A ++ P  A  Y  +   HSS    + A      A
Sbjct: 534 ETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKA 593

Query: 162 IKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
           +  DP +   Y  L  +   LG++EEAL  ++K   I   N  
Sbjct: 594 LACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 636

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 42/84 (50%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           DF   ++ +  A+K+ P + + +    A+ ++    EEAI+    A+++ PS+ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 176 AFAKYGLGKHEEALESYKKVLDIE 199
           A +   +G ++EA      VL + 
Sbjct: 532 AVSSMNIGCYKEAAGYLLTVLSMH 555

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (42%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E +   GN     KD   A++ + +A ++ P  A  Y  +   HSS    + A      A
Sbjct: 541 ETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKA 600

Query: 162 IKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
           +  DP +   Y  L  +   LG++EEAL  ++K   I   N  
Sbjct: 601 LACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVV 643

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 45/92 (48%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           G    A ++F   ++ +  A+++ P + + +    A+ ++    EEAI+    A+ + PS
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 168 YSKGYSRLAFAKYGLGKHEEALESYKKVLDIE 199
           + +    LA +   +G ++EA ES    L + 
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 41/88 (46%), Gaps = 17/88 (19%)

Query: 121 VEKYTEAIKILP---------TNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKG 171
           + KY +    LP            ++YAN        +EF + I    +A++++P+    
Sbjct: 401 ITKYLQVANALPQVDPEVQLGLGTLFYAN--------EEFGKTIDCFRTALEVNPNDELM 452

Query: 172 YSRLAFAKYGLGKHEEALESYKKVLDIE 199
           ++RL  +     + EEA+++Y K L ++
Sbjct: 453 WNRLGASLANSNRSEEAIQAYHKALALK 480

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 6/97 (6%)

Query: 140 NRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIE 199
           NRAA    + + ++A+KDA  A + +P   K Y R       L    +ALE+Y+     E
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALENYE-----E 130

Query: 200 GDNATAGMKRDYET-AKKRVEESMNVEKSKTPEQGQG 235
           G  A   M R Y     K++ E++  +K+    + +G
Sbjct: 131 GVKAIRDMTRKYHLDPPKKLYEALEYQKNLVSRRLKG 167

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%)

Query: 138 YANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVL 196
           Y N +A +  L+E ++A + +   I I+P   KGY R+       GK  EA + YKK L
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKKGL 132

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 36.2 bits (82), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160
           AE  K++GN      D+  A+  Y +A  +  +N IY++N A A   L+ ++EA+   + 
Sbjct: 41  AEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDK 100

Query: 161 AI 162
            +
Sbjct: 101 GL 102

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 41/84 (48%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           DF   ++ +  A+K+ P + + +    A+ ++    EEAI+    A+++ PS+ +    L
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 532

Query: 176 AFAKYGLGKHEEALESYKKVLDIE 199
           A +   +G  +EA      VL + 
Sbjct: 533 AVSSMNIGCFKEAAGYLLSVLSMH 556

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 8/120 (6%)

Query: 132 PTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSR-------LAFAKYGLGK 184
           P   I   NRAA+   +    +A+ DA+  IK+D    KGY R       +A  K  L  
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALYV 126

Query: 185 HEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTNESAQ 244
           + E L   K+   +  +   +      E  K  V + +N++K  TP  G  ++   E+ Q
Sbjct: 127 YREGLSKAKEAYQLHFEKPPSKFVEIVEHQKNEVIKRLNLQKL-TPTTGASKRTHIEAIQ 185

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 71/150 (47%), Gaps = 25/150 (16%)

Query: 104 FKLEGNKAMAMKDFHLAVEKYTEAIKILPTN----AIYYANRAAAHSSLKEFEEAIKDAE 159
           FK +G  + +  D+H A + + +++  LP +    AI  +N       L E+ +AI+D+ 
Sbjct: 307 FKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSS 366

Query: 160 SAIKI-------------DP--SYSKGYSRL----AFAKYGLGKHEEALESYKKVLDIEG 200
            A+K+             DP  ++ + + ++    A A   +  +++AL+ Y+  L I+ 
Sbjct: 367 VALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQ--LLIKR 424

Query: 201 DNATAGMKRDYETAKKRVEESMNVEKSKTP 230
             A+  +       +K VE    V++SKTP
Sbjct: 425 GAASRKVMEGRRRCQKIVEPEKFVQRSKTP 454

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 45/98 (45%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           G  +M + +F  A+  + +A  I P+N I       A   L   E+A+   E A ++ PS
Sbjct: 640 GMCSMKLGEFEHALLYFEKARSINPSNVILICCCGVAFEKLSYPEKALSYYELACQVQPS 699

Query: 168 YSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
            S    + A   Y +  +  ALE ++++  +  + AT 
Sbjct: 700 SSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEATV 737

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 41/84 (48%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           DF   ++ +  A+K+ P + + +    A+ ++    EEAI+    A+++ PS+ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 176 AFAKYGLGKHEEALESYKKVLDIE 199
           A +   +G  +EA      VL + 
Sbjct: 532 AVSSMNIGCLKEAAGYLLSVLSMH 555

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           +F   ++ +  A+ + P +   +    A+ ++    EEAI+    AI++ P++ +    L
Sbjct: 436 EFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVRARYNL 495

Query: 176 AFAKYGLGKHEEALESYKKVL---DIEGDNATAG 206
           A +   +G ++EA E     L   ++EG   +AG
Sbjct: 496 AVSSMNIGCYKEAAEQLLTALSMHEVEGVVMSAG 529

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 61/135 (45%), Gaps = 28/135 (20%)

Query: 90  IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILP----TNAIYYANRAAAH 145
           +P+   E+  + E FK  G++     D+  A+++Y +++  LP       I Y+N  A  
Sbjct: 404 VPISHIELSGHIE-FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462

Query: 146 SSLKEFEEAIKDAESAIKIDPS-----------------------YSKGYSRLAFAKYGL 182
             + E+ ++I+D + A+ + P                        +SK   R A +   L
Sbjct: 463 LKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHL 522

Query: 183 GKHEEALESYKKVLD 197
             ++ AL+SY+K+++
Sbjct: 523 ENYKLALDSYQKLIE 537

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%)

Query: 105 KLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAI 162
           K EGN+   + D+  A + Y   I   PTN I Y+N+A +    + F++AI+   + +
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 41/84 (48%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           DF   ++ +  A+++ P + + +    A+ ++    EEAI+    A+++ PS+ +    L
Sbjct: 472 DFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 176 AFAKYGLGKHEEALESYKKVLDIE 199
           A +   +G  +EA      VL + 
Sbjct: 532 AVSSMNIGCFKEAAGYLLSVLSMH 555

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           G  ++ +  +   +  + +A  I P N I       A   L   E A+++ + A ++ P 
Sbjct: 485 GMCSLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPM 544

Query: 168 YSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
            S    + A     +GK+  ALES++K++ I  D AT
Sbjct: 545 SSLALFKRAQLLLAMGKYNYALESFEKLVKIAPDEAT 581

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           +  K +GN      D+  AV  Y +AI   P+N I Y+N A     L+++ EA+      
Sbjct: 5   DTLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKG 64

Query: 162 IKI 164
           +K+
Sbjct: 65  LKM 67

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 140 NRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESY 192
           NRAA+   L + ++A+KDA++ I+++P   K Y R       L K +EA  +Y
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNY 128

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 44/91 (48%), Gaps = 3/91 (3%)

Query: 113 AMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGY 172
           A +DF   ++ +  A+ + P +   +    A+ ++    EEAI+    AI++ P++ +  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRAR 488

Query: 173 SRLAFAKYGLGKHEEALESYKKVL---DIEG 200
             LA +   +G + EA E     L   ++EG
Sbjct: 489 YNLAVSSMNIGCYREAAEHLLTALSMHEVEG 519

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           D+   V+ +  A+ + P + + +    A+ ++    EEAI+    A+++ P++ +    L
Sbjct: 441 DYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 500

Query: 176 AFAKYGLGKHEEALESYKKVL---DIEG 200
           A +   +G ++EA E     L   ++EG
Sbjct: 501 AVSCMNMGCYKEAAEYLLTALSMHEVEG 528

>NCAS0H03540 Chr8 (672730..675012) [2283 bp, 760 aa] {ON} Anc_2.665
           YKL022C
          Length = 760

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 131 LPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAK-YGL-GKHEEA 188
            P +AI + + A  + ++++  +A K    A  +DPS+S  +  L FA  YGL G+H++A
Sbjct: 465 FPKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAW--LGFAHTYGLEGEHDQA 522

Query: 189 LESY 192
           L +Y
Sbjct: 523 LSAY 526

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           +F   ++ +  A+ + P + + +    A+ ++    EEAI+    A+++ PS+ +    L
Sbjct: 411 EFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVRARYNL 470

Query: 176 AFAKYGLGKHEEALE---SYKKVLDIEG--DNATA 205
           A +   +G ++EA E   S  K+ ++EG   N TA
Sbjct: 471 AVSSINIGCYKEAAEYLLSALKMHEVEGVSQNGTA 505

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 58/133 (43%), Gaps = 26/133 (19%)

Query: 90  IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTN----AIYYANRAAAH 145
           +P+   EI    E +K  G +     D+  A ++Y +++  LP N     + Y+N  AA 
Sbjct: 263 VPISHLEISGYKE-YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAAL 321

Query: 146 SSLKEFEEAIKDAESAIKIDPS---------------------YSKGYSRLAFAKYGLGK 184
             + E++  + D ESA+++ P                      + K  +R A A   +  
Sbjct: 322 FKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIEN 381

Query: 185 HEEALESYKKVLD 197
           +E AL+ Y+ +++
Sbjct: 382 YERALQDYQSLIE 394

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (47%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           DF   +E +  A+   PT+ + +    AA ++    E++IK    AI++ PS+ +    L
Sbjct: 421 DFDKTIECFKAALNENPTDELMWNRLGAALANSNRSEDSIKAYYKAIQLKPSFVRARYNL 480

Query: 176 AFAKYGLGKHEEALESYKKVLDIE 199
           A A   +  ++EA E     L + 
Sbjct: 481 AVACMNIHCYKEAAEHLLTALSMH 504

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 48/97 (49%), Gaps = 3/97 (3%)

Query: 113 AMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGY 172
           A +D+   ++ +  A+ + P + + +    A+ ++    EEAI+    A+++ PS+ +  
Sbjct: 434 ANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 493

Query: 173 SRLAFAKYGLGKHEEALESYKKVL---DIEGDNATAG 206
             LA +   +G ++EA E     L   ++EG    +G
Sbjct: 494 YNLAVSSMNIGCYKEAAEYLLTALSMHEVEGVPVASG 530

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 5/84 (5%)

Query: 99  ANAEAFKLE---GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAI 155
           AN   F+ E   GN       +  AV+ Y + I   P N + Y+N+A A   L E+  AI
Sbjct: 3   ANVTQFEKEKELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAI 62

Query: 156 KDAESAIK--IDPSYSKGYSRLAF 177
           +  +  ++  + P ++   S+L +
Sbjct: 63  QTCQEGLRYALGPEHAAIRSKLQY 86

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 39/75 (52%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           +F   ++ +  A+ I P + + +    A+ ++    EEAI+    A+++ PS+ +    L
Sbjct: 446 EFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVRARYNL 505

Query: 176 AFAKYGLGKHEEALE 190
           A +   +G ++EA E
Sbjct: 506 AVSSINIGCYKEAAE 520

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 57/134 (42%), Gaps = 14/134 (10%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           G   M +  +  A+  + +A  I P N I       A   L   E+A++  E A ++ PS
Sbjct: 557 GMCYMKLGQYDKALLFFEKARNINPVNVILICCCGVALEKLSYQEKALQYYEQACELQPS 616

Query: 168 YSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA-----------GMKRDYETAKK 216
            S    + A   Y + ++  ALE+++++  +  D AT            G K+D   A K
Sbjct: 617 SSLAKFKKAHLLYSMARYSAALENFEELAKLAPDEATVHFLLGQLYQIMGRKKD---AVK 673

Query: 217 RVEESMNVEKSKTP 230
               +MN++    P
Sbjct: 674 EFTVAMNLDPKGNP 687

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 42/97 (43%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           + +   GN     +D   A++ + +A KI    A  Y  +   HSS    + A      A
Sbjct: 483 QTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYRRA 542

Query: 162 IKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDI 198
           +  DP +   Y  L      LG++++AL  ++K  +I
Sbjct: 543 LACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNI 579

>CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166c CDC23
          Length = 639

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 46/101 (45%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           K    A+ L G++ + +K+ + A+E Y  A+ I P +   +     A+  L     ++  
Sbjct: 441 KKTTSAWTLMGHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQAYEVLDMHLYSLYY 500

Query: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDI 198
            + A  + P   + +  L      +G H EA++ Y++ L +
Sbjct: 501 FQRACILKPLDKRMWQALGSCYAKVGNHAEAIKCYERALQL 541

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 39/91 (42%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           GN     +D   A+  + +A ++ P  A  Y  +   HSS    + A      AI  DP 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 168 YSKGYSRLAFAKYGLGKHEEALESYKKVLDI 198
           +   Y  L      LG++EEAL  ++K   I
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEKARSI 606

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 46/98 (46%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           G   M +  +  A+  + +A  I P N I       A   +   E+A++  E A ++ PS
Sbjct: 584 GMCCMKLGQYEEALLYFEKARSINPVNVILICCCGVALEKMSYQEKALQYYELASELQPS 643

Query: 168 YSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
            S    + A   Y + ++  ALE+++++ ++  D AT 
Sbjct: 644 SSLAKFKKAHLLYVMARYSVALENFEELAELAPDEATV 681

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 32.3 bits (72), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E  K +GN     +D+  A+  Y + ++   TN I ++NRA     L   +EA K  ++ 
Sbjct: 5   ERLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAG 64

Query: 162 IKI 164
           + +
Sbjct: 65  LAL 67

>KAFR0E00850 Chr5 complement(178580..184180) [5601 bp, 1866 aa] {ON}
            Anc_8.555 YPL082C
          Length = 1866

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 26/46 (56%)

Query: 304  PSMRDLANNFKNGNTDMNDIMNNPAIRNMASNLFKGNPSEENQDKQ 349
            P +R +    K  N +++D++N P +  + + LF+    EE+ DK+
Sbjct: 1588 PQLRQVEQYLKQANLELHDVVNAPKLNALRTLLFECGIGEEDMDKR 1633

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 80  IEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILP----TNA 135
           + ++ SV   +P+ + E+    E FK    +     D+  A+++Y ++   LP       
Sbjct: 325 VSRQGSVVPTVPITEIELSGYNE-FKDRAGELFKTGDYVAALQEYEKSANTLPHGHPLRI 383

Query: 136 IYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           I Y+N  A+     +++E++  A  A+K+ P  +  +++L
Sbjct: 384 ISYSNLMASQLKTGQYKESLHVASMALKLFPEDTTQWTQL 423

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 43/103 (41%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E +   GN     KD   A++ + +A ++ P  A  Y  +   HSS    + A      A
Sbjct: 552 ETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKA 611

Query: 162 IKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
           +  D  +   Y  L  +   LG++EEAL  ++K   I   N  
Sbjct: 612 LACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 654

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 44/97 (45%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           G   + +  +   +  + +A  I P N I       A   L   E+A++  + A ++ P 
Sbjct: 484 GMCCLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQEKALQYYDLACELQPV 543

Query: 168 YSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNAT 204
            S    + A     +GK+  ALE+++K++ I  D AT
Sbjct: 544 SSLALFKRAQLLLAMGKYNFALENFEKLVTIAPDEAT 580

>Skud_16.201 Chr16 complement(369772..375375) [5604 bp, 1867 aa] {ON}
            YPL082C (REAL)
          Length = 1867

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%)

Query: 304  PSMRDLANNFKNGNTDMNDIMNNPAIRNMASNLFKGNPSEENQDKQ 349
            P + D+ +  K    D++DI+N P +  + + LF+    EE+ DK+
Sbjct: 1586 PQLGDVQDYLKQTGLDLHDIINAPKLSALRTLLFECGIGEEDMDKK 1631

>NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}
           Anc_5.689 YOR080W
          Length = 698

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 50/122 (40%), Gaps = 35/122 (28%)

Query: 110 KAMAMKDFHLAVEKYTEAIKIL---------------------------PTNAIYYA--- 139
           KA+++   +   EKYT+AIKI                            P +A  Y    
Sbjct: 13  KALSLGTTYFQSEKYTKAIKIFQKAIELTKSYSKNDIIELRRKHNLHSYPESANAYHPKY 72

Query: 140 -----NRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKK 194
                NRAA    L E E A++D++    I+P   K Y R       LGK ++A ++YK+
Sbjct: 73  IKLLDNRAACWEKLGELERALRDSQKMCYIEPYNLKCYLRRGRLLQRLGKDKDAYKNYKE 132

Query: 195 VL 196
            L
Sbjct: 133 AL 134

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 31.6 bits (70), Expect = 0.93,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 30/62 (48%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E  K +GN       +  AV  Y + I   P N + Y+N+A A   L E+ +AI+  +  
Sbjct: 5   EKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQG 64

Query: 162 IK 163
           ++
Sbjct: 65  LR 66

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 44/104 (42%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAE 159
           N+ ++   GN    + D   A++   +A  I P     Y       +S+  F+ A     
Sbjct: 617 NSISWCFIGNYFSLINDHDKAIKYLKKATTINPRFTYAYTLEGHEQASIDAFDTAKNCYR 676

Query: 160 SAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNA 203
            AI  DP++   Y  L      LG++++AL  ++K   I   NA
Sbjct: 677 KAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNA 720

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 43/98 (43%), Gaps = 2/98 (2%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           D+   ++ +  A+ + P + + +    A+ ++    EEA+     A+ + PS+ +    L
Sbjct: 508 DYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPSFVRARYNL 567

Query: 176 AFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYET 213
           A +   +G  +EA E     L +   N    +  D ET
Sbjct: 568 AVSSINIGCFKEAAEHLLTALSMHEINGI--LDTDLET 603

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 3/88 (3%)

Query: 116 DFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175
           D+   V+ +  A+ + P + + +    A+ ++    EEAI+    A+++ P++ +    L
Sbjct: 434 DYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 493

Query: 176 AFAKYGLGKHEEALESYKKVL---DIEG 200
           A +   +G  +EA E     L   ++EG
Sbjct: 494 AVSCMNMGCFKEAAEYLLTALSMHEVEG 521

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 46/104 (44%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           K    A+ L G++ + MK+ H A+E Y  A+ I P +   +     A+  L     A+  
Sbjct: 415 KTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYY 474

Query: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201
            + A  + P   + +  LA     L +  +A++ +++   +  D
Sbjct: 475 LQKACSLKPLDKRMWQALANCYDKLDRPNQAIKCFQRASQLSND 518

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%)

Query: 140 NRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVL 196
           NRAA    + E E+A++DA     I+P   K + R       L K ++A  +YK  L
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTAL 155

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 138 YANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLD 197
           Y     AH   +   E+I+  +SA++++P+  + +  L  A Y  G+ E +++ ++K L+
Sbjct: 684 YRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALE 743

Query: 198 IEGDNATAGMKRDYETAKKRV-EESMNVEKSKTPEQ 232
           +   NA A   +    +K  + +ES+ + +  T E 
Sbjct: 744 VSPGNAYAHYFKALSLSKMGLYDESIEIFRELTAEH 779

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%)

Query: 104 FKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK 163
            K EGN      D+  A   Y + IK+ PTN I Y+N+A +         A++  +  +K
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 164 IDPSYSK 170
              S +K
Sbjct: 66  YTSSSTK 72

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRV 218
           +  IK++P+   GYS  A +    G H  A+E+ +     EG   T+   ++  T K+++
Sbjct: 27  DQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQ-----EGLKYTSSSTKEATTIKRKL 81

Query: 219 EESMNVEKSKTPEQGQGQQQTNESAQGNAPNPFA 252
           E  + + K +   QGQ    ++ S+  + P P  
Sbjct: 82  EYRLELAK-RACHQGQKHSSSSSSSSSSTPVPIT 114

>Suva_16.230 Chr16 complement(408651..414254) [5604 bp, 1867 aa] {ON}
            YPL082C (REAL)
          Length = 1867

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 302  SDPSMRDLANNFKNGNTDMNDIMNNPAIRNMASNLFKGNPSEENQDK 348
            S P +  + +  K    D++DI+N P +  + + LF+    EE+ DK
Sbjct: 1584 SHPQLSQVQDYLKQTGLDLHDIINAPKLSALRTLLFECGIGEEDMDK 1630

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/107 (15%), Positives = 50/107 (46%), Gaps = 2/107 (1%)

Query: 119 LAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFA 178
           +A+    +++++ PT++  +      H + K+F  A +  + A+  D      +  +   
Sbjct: 398 IAMGHLVKSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVL 457

Query: 179 KYGLGKHEEALESYKKVLDIEG--DNATAGMKRDYETAKKRVEESMN 223
            Y +G++ +AL++Y + + +          +   YET   ++ ++++
Sbjct: 458 YYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALD 504

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 117 FHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK--IDPSYSKGYSR 174
           FH A + Y  A+ I P+ +  +A     +  L + ++A    + A+    DP+  K +  
Sbjct: 214 FHKASQLYERALAIDPSLSDIWATLGHCYLMLDDLQKAYNAYQQALNNLSDPNVPKLWHG 273

Query: 175 LAFAKYGLGKHEEALESYKKVLDIE 199
           +       G  + A E++KKVLD++
Sbjct: 274 IGILYDRYGSLDFAEEAFKKVLDLD 298

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/83 (20%), Positives = 39/83 (46%)

Query: 117 FHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLA 176
           F   ++ +  A+ +   + + +    A+ ++    EEAI+    A+++ PS+ +    LA
Sbjct: 442 FDKTIDCFKAALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQLKPSFVRARYNLA 501

Query: 177 FAKYGLGKHEEALESYKKVLDIE 199
            +   +G ++EA E     L + 
Sbjct: 502 VSSINIGCYKEAAEHLLTALSMH 524

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAE 159
           N++  + +GN   +  ++  AV  Y  A    P+N ++ AN + A   L+ +E+A+   +
Sbjct: 7   NSDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACD 66

Query: 160 SAIKI 164
            A++I
Sbjct: 67  RALEI 71

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 54/123 (43%), Gaps = 22/123 (17%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPT------------------NAIYYANRAAAHSSLK 149
           G+    +KD+  +  KY +A+K + T                      Y N   A  +LK
Sbjct: 241 GSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEKHCLLFIELKKKLYLNICLALFNLK 300

Query: 150 EFEEAIKDAESAIKIDP----SYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATA 205
           +++E++K     +++D       +K Y R+  + +   +++EAL++Y+   D   D+   
Sbjct: 301 DYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRYDEALKNYRLCRDHNPDDNVI 360

Query: 206 GMK 208
           G K
Sbjct: 361 GQK 363

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%)

Query: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157
           K N  A+   GN     KD   A+  + +AI++ P  A  Y  +   +S+   F+ A   
Sbjct: 489 KYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSC 548

Query: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKK 194
              A+ I+ ++      L      LGK EEAL  ++K
Sbjct: 549 FRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEK 585

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 46/102 (45%)

Query: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESA 161
           E + + GN    +KD   A++ + +A  +    A  Y  +   H++ + ++ A      A
Sbjct: 522 ETWCVVGNYFSLIKDHGEAIKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKA 581

Query: 162 IKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNA 203
           I  DP +   Y  L      LGK+++AL  ++K   I   NA
Sbjct: 582 IACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNA 623

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/103 (20%), Positives = 46/103 (44%), Gaps = 15/103 (14%)

Query: 108 GNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPS 167
           G   M   D+  A + + +A+     N I++ +    +  + ++ +A+     AI+++P 
Sbjct: 313 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 372

Query: 168 YSKGYSRLAFAKYGLGKHEE--------ALESYKKVLDIEGDN 202
            S+ +       Y LG   E        AL++YK+   ++ +N
Sbjct: 373 ISEVW-------YDLGTLYETCNNQLNDALDAYKQAARLDPEN 408

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/111 (19%), Positives = 49/111 (44%), Gaps = 15/111 (13%)

Query: 100 NAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAE 159
           +A  +   G   M   D+  A + + +A+     N I++ +    +  + ++ +A+    
Sbjct: 310 DATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYT 369

Query: 160 SAIKIDPSYSKGYSRLAFAKYGLGKHEE--------ALESYKKVLDIEGDN 202
            AI+++P  S+ +       Y LG   E        AL++YK+   ++ +N
Sbjct: 370 RAIRLNPYISEVW-------YDLGTLYETCNNQLNDALDAYKQAARLDPEN 413

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 90  IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT----NAIYYANRAAAH 145
           +P+   E+    E F + G +     D+H A ++Y +++  LP       + Y+N     
Sbjct: 356 VPISQIEMSGYQE-FNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQ 414

Query: 146 SSLKEFEEAIKDAESAIKI 164
             + E  E++K+ E A  +
Sbjct: 415 LKIGEHTESLKNIEKACDL 433

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLK--EFEEAIKDA 158
           A A+ L+G++      F  A   Y +A+ I P +  Y A+     S +K  +++EA+   
Sbjct: 472 AYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHF 529

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKR 209
           E A  I+P           A   LG+ E+AL+ Y+   +++ +++ A  K+
Sbjct: 530 EKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 580

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 64/147 (43%), Gaps = 28/147 (19%)

Query: 90  IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT----NAIYYANRAAAH 145
           +P+ + E+    E FK  G +     D+  A+E Y +++  LP       I  +N  A+ 
Sbjct: 384 VPISEIELLGYKE-FKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASM 442

Query: 146 SSLKEFEEAIKDAESAIKIDP-----------------SYSKGYSRLAFAKYGLGKH--- 185
           S   E+ ++I+ + SA++  P                 +Y   + ++   +    +H   
Sbjct: 443 SKTGEYRKSIEISTSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIES 502

Query: 186 -EEALESYKKVLD--IEGDNATAGMKR 209
            E ALE+Y+++++     D   +G +R
Sbjct: 503 YENALETYQQMIEKNFFNDKVMSGKRR 529

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 140 NRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSR 174
           NRAA    L +  +A+KDA  A+K +P   K Y R
Sbjct: 76  NRAATWEKLGDLTKALKDANRAVKYEPYNLKCYLR 110

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%)

Query: 105 KLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIK 163
           K +GN       +  AV+ Y   I   P N + Y+N+A A   L E  +AI+  +  ++
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQ 70

>NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {ON} 
          Length = 1502

 Score = 30.8 bits (68), Expect = 7.5,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 30/58 (51%)

Query: 195  VLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTNESAQGNAPNPFA 252
            +L+I G  ATA +K D+ +  K   E   V    T    + +++ +E+  G +P+ FA
Sbjct: 1104 ILEIIGAGATASIKEDWHSIWKNSSEYKEVTNEVTSLIEELREKPDEAHIGKSPSKFA 1161

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 140 NRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIE 199
           N AA    L + + A+  ++  ++++P   K Y R       LGK +EA ++Y+  L   
Sbjct: 72  NLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRRGKVLQKLGKDKEAYDNYRLGL--- 128

Query: 200 GDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQ 236
             NA    ++    A K+  E ++ +K+K   + Q Q
Sbjct: 129 -RNAKEAYEKFNIDAPKKFIELVSAQKAKAKLRLQSQ 164

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLK--EFEEAIKDA 158
           A A+ L+G++      F  A   Y +A+ I P +  Y A+     S +K  +++EA+   
Sbjct: 491 AYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHF 548

Query: 159 ESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKR 209
           E A  I+P           A   LG+ E+AL+ Y+   +++ +++ A  K+
Sbjct: 549 EKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKK 599

>KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} similar
           to uniprot|P20424 Saccharomyces cerevisiae YPR088C SRP54
           Signal recognition particle (SRP) subunit (homolog of
           mammalian SRP54) contains the signal sequence- binding
           activity of SRP interacts with the SRP RNA and mediates
           binding of SRP to signal receptor contains GTPase domain
          Length = 530

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%)

Query: 291 PNAMQQVQSMMSDPSMRDLANNFKNG 316
           PN MQ +  MM DPSM+++A  F  G
Sbjct: 505 PN-MQDIMGMMQDPSMQEMAKQFSGG 529

>TBLA0E01990 Chr5 (483675..484799) [1125 bp, 374 aa] {ON} Anc_7.313
           YLR216C
          Length = 374

 Score = 30.0 bits (66), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 69/159 (43%), Gaps = 30/159 (18%)

Query: 87  EVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILP-------------- 132
           +VN+   ++ IKA AE  K+ G +     ++ +A++KYT+  K+L               
Sbjct: 208 KVNMSDVNSVIKA-AEDVKVIGTEQFKKANYPIALQKYTKCEKLLKEYFPDDLPDEDSAR 266

Query: 133 ----TNAIYYANRAAAHSSLKEFEEAIKDAESAI-----KIDPSYSKGYSRLAFAKYGLG 183
                NAI   N       +K++  AI  A   +       D   +K Y R   A  G  
Sbjct: 267 LRQLRNAIA-LNITLCCLKVKDYTRAIYTASEVLYEESGATDKDKTKAYYRRGLAYKGRN 325

Query: 184 KHEEALESYKKVLDIEGDNAT--AGMKRDYETAKKRVEE 220
             +EAL+ +++ + +  ++ T  A M+   ET  KR +E
Sbjct: 326 DTDEALKDFQRAMVLNPNDTTVVAAMR---ETKAKRKQE 361

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.125    0.335 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,548,719
Number of extensions: 1466207
Number of successful extensions: 7334
Number of sequences better than 10.0: 260
Number of HSP's gapped: 7238
Number of HSP's successfully gapped: 351
Length of query: 349
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 239
Effective length of database: 40,868,139
Effective search space: 9767485221
Effective search space used: 9767485221
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)