Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0D008006.20ON1193117053950.0
NCAS0H008206.20ON1146118120590.0
Skud_13.1526.20ON1090118814960.0
Suva_13.1606.20ON1090118314880.0
Smik_13.1576.20ON1090118014471e-180
ZYRO0C07810g6.20ON1099117713651e-168
TDEL0G044906.20ON1093117912911e-158
Sklu_YGOB_Anc_6.20b6.20ON1088119112421e-151
Kpol_1037.256.20ON1105118310721e-126
Ecym_30246.20ON1079120110401e-122
KLTH0C11242g6.20ON1097119610371e-121
Sklu_YGOB_Anc_6.20singletonOFF84987610161e-121
Kwal_56.224246.20ON1089120210161e-118
ACR006C6.20ON1071119210001e-116
KNAG0M011606.20ON113111109941e-115
TPHA0J003306.20ON110710679601e-110
YML002W6.20ON7377769351e-110
CAGL0L07634g6.20ON113011899491e-109
TBLA0A072606.20ON120411388162e-90
KLLA0D01133g6.20ON10678387611e-83
YML003WsingletonOFF2902835193e-58
KAFR0L004006.20ON9428015016e-51
KLLA0C01155g1.33ON481125840.31
YJL176C (SWI3)1.163ON82599781.8
AER102W4.296ON190275781.9
TPHA0K007507.409ON85779772.7
NCAS0B010008.813ON115186737.4
KNAG0C042007.272ON99577737.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0D00800
         (1193 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....  2082   0.0  
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   797   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   580   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   577   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   561   e-180
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   530   e-168
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   501   e-158
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   483   e-151
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   417   e-126
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   405   e-122
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   404   e-121
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   395   e-121
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   395   e-118
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   389   e-116
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   387   e-115
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   374   e-110
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   364   e-110
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   370   e-109
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   318   2e-90
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   297   1e-83
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   204   3e-58
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   197   6e-51
KLLA0C01155g Chr3 (88084..89529) [1446 bp, 481 aa] {ON} similar ...    37   0.31 
YJL176C Chr10 complement(92053..94530) [2478 bp, 825 aa] {ON}  S...    35   1.8  
AER102W Chr5 (828188..833896) [5709 bp, 1902 aa] {ON} Syntenic h...    35   1.9  
TPHA0K00750 Chr11 (155270..157843) [2574 bp, 857 aa] {ON} Anc_7....    34   2.7  
NCAS0B01000 Chr2 complement(156442..159897) [3456 bp, 1151 aa] {...    33   7.4  
KNAG0C04200 Chr3 complement(820365..823352) [2988 bp, 995 aa] {O...    33   7.5  

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score = 2082 bits (5395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1080/1170 (92%), Positives = 1080/1170 (92%)

Query: 1    MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKL 60
            MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKL
Sbjct: 1    MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKL 60

Query: 61   SLNELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRG 120
            SLNELCYHNSDFLGSHILTWSNAI            EEFDNLNGNKFIIKWKHNIIFTRG
Sbjct: 61   SLNELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRG 120

Query: 121  NFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLK 180
            NFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLK
Sbjct: 121  NFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLK 180

Query: 181  SQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVN 240
            SQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVN
Sbjct: 181  SQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVN 240

Query: 241  EAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKA 300
            EAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKA
Sbjct: 241  EAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKA 300

Query: 301  QHLIKHFSIVEIDPNFYDIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILIESLQ 360
            QHLIKHFSIVEIDPNFYDIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILIESLQ
Sbjct: 301  QHLIKHFSIVEIDPNFYDIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILIESLQ 360

Query: 361  IITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANLYYLKYFSTDES 420
            IITDSNTGGEESKDKNKSGY                QSNITLHDLKANLYYLKYFSTDES
Sbjct: 361  IITDSNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKANLYYLKYFSTDES 420

Query: 421  SSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEELIMTDDLSTLSSTFENDKKTL 480
            SSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEELIMTDDLSTLSSTFENDKKTL
Sbjct: 421  SSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEELIMTDDLSTLSSTFENDKKTL 480

Query: 481  LMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSSTLLLQAIRSNN 540
            LMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSSTLLLQAIRSNN
Sbjct: 481  LMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSSTLLLQAIRSNN 540

Query: 541  FEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKIIGQFINWKQKDV 600
            FEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKIIGQFINWKQKDV
Sbjct: 541  FEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKIIGQFINWKQKDV 600

Query: 601  NGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSNGNSLLHILQNN 660
            NGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSNGNSLLHILQNN
Sbjct: 601  NGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSNGNSLLHILQNN 660

Query: 661  ISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKLIFNKFQSPNFI 720
            ISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKLIFNKFQSPNFI
Sbjct: 661  ISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKLIFNKFQSPNFI 720

Query: 721  DCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLYINYTILIDEAD 780
            DCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLYINYTILIDEAD
Sbjct: 721  DCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLYINYTILIDEAD 780

Query: 781  KSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNLRTIPLRYI 840
            KSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNLRTIPLRYI
Sbjct: 781  KSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNLRTIPLRYI 840

Query: 841  EKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXXXXXXXXXXXXXXXXKLRRSSTTPSAKS 900
            EKLRIRRFLKRLNTCLDVLLHFDDSTIATP                 KLRRSSTTPSAKS
Sbjct: 841  EKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEWISIEESKLRRSSTTPSAKS 900

Query: 901  KLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIFMNLKTLDIHDA 960
            KLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIFMNLKTLDIHDA
Sbjct: 901  KLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIFMNLKTLDIHDA 960

Query: 961  QIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISFFNECTLKLIHD 1020
            QIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISFFNECTLKLIHD
Sbjct: 961  QIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISFFNECTLKLIHD 1020

Query: 1021 VENXXXXXXPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGXXXXXXXXXXXXXXX 1080
            VEN      PNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSG               
Sbjct: 1021 VENIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGNNANTNTNTNTNTNT 1080

Query: 1081 XSPQRLXXXXXXXXXXXXGVFANLIENQKNKLERKTSHHIDETIXXXXXXXXXXXNKHEH 1140
             SPQRL            GVFANLIENQKNKLERKTSHHIDETI           NKHEH
Sbjct: 1081 NSPQRLHHHSEHQNNSNNGVFANLIENQKNKLERKTSHHIDETISLLESLGSGLLNKHEH 1140

Query: 1141 LAEELNRYMEFKNRFFGRNIMKNFVGEDIK 1170
            LAEELNRYMEFKNRFFGRNIMKNFVGEDIK
Sbjct: 1141 LAEELNRYMEFKNRFFGRNIMKNFVGEDIK 1170

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1181 (40%), Positives = 692/1181 (58%), Gaps = 70/1181 (5%)

Query: 1    MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKL 60
            M QYHLPTLLNPLLN++FNCP+PS+SP KKL+ +LK++ FILLVPPT TLLNYTD+  K+
Sbjct: 1    MEQYHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKI 60

Query: 61   SLNELCYHNSDFLGSHIL------TWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHN 114
             L +LCYHN DF+G+HIL        S++             E+FD LNG+  ++KW++N
Sbjct: 61   QLEDLCYHNVDFIGAHILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNN 120

Query: 115  IIFTRGNFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKC--- 171
             +       N Q+ KI +I  L NFNDY  GS  F L+ IDKP+    +  ND L+C   
Sbjct: 121  FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT 180

Query: 172  LLPNTRDLKSQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPN 231
            L  +  D  S     PL+QD+SQ  +S FEN +N N+ WN +F    N YK  ++  EPN
Sbjct: 181  LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240

Query: 232  HKLFRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSV 291
              LF+++V  A+ E+ S K F   K F    L +L H+Y+E +LYD +W +I  +     
Sbjct: 241  ETLFKQIVAVAYNELKSNKIF---KGF--GHLRRLIHEYLEINLYDHLWLQITTLCA--- 292

Query: 292  KNYADDQKAQHLIKHFSIVEIDPNFYDIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEK 351
                DD+     IK+ SI EID  FY++FPL F+  LEKN+  S   INKL    S+ EK
Sbjct: 293  ---LDDETKGTRIKNISIEEIDDKFYEMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEK 349

Query: 352  STILIESLQIITDSNTGGEESKDKNKSGY--XXXXXXXXXXXXXXXXQSNITLHDLKANL 409
            S  LI +LQI+T+ +    E   +N+ G                   +S I + DLK N+
Sbjct: 350  SENLIATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNI 409

Query: 410  YYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEELIMTDDLSTL 469
            +YLK F+ DE+  +FGIL+YTI+TF +V +  EN++++D+LK  S++IE+LI  DDL  +
Sbjct: 410  FYLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYSEIIEKLIKVDDLKKV 469

Query: 470  SSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSS 529
              T + ++   L +R+  GES+L   I N Q +KF   L++YE+I +MD I +D +++ +
Sbjct: 470  PKTIKWEQ--FLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGT 527

Query: 530  TLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKII 589
            TLL+QA+   NF+ +++L+ LL +NC N K+++ YIN++D  NRN+GHYL+  L ILKII
Sbjct: 528  TLLMQALIYRNFKISMVLINLLLRNCSN-KQIMEYINKIDKFNRNVGHYLINELEILKII 586

Query: 590  GQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSN 649
            G+++NWKQ+D+ GRTPLFTIFR YDQ NYDE++  VF I + WYA N LKFQM+DH D  
Sbjct: 587  GKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLK 646

Query: 650  GNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKL 709
             NS+LHIL++NI IL  Y+K  +  I++NK N KGFTPLM+Y KY R  N+++I+ +++L
Sbjct: 647  DNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRL 706

Query: 710  IFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLY 769
            +FN++Q   +  CFDY+ DS+I N++G+  L N  +FG+I + SLK + ST  +      
Sbjct: 707  LFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATF----- 761

Query: 770  INYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNN 829
             + T  + + +  T T  +K  +++  LK++++K  IS LPLD ++   +  +   SK N
Sbjct: 762  -SLTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRII---KVLVKLTSKEN 817

Query: 830  NNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXXXXXXXXXXXXXXXXKL 889
            N    I +R IE LR +  L+RL  CLD LL FD                        KL
Sbjct: 818  NK---IIVRKIEMLRNQSLLRRLTDCLDTLLFFD-----------IGIDYLSLITDETKL 863

Query: 890  RRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIF 949
                T  + K K        +KK LKPE+INIIQ+FLKFN+ EL  + +N+K L KL+ F
Sbjct: 864  LGWVTNENTKLKHNVNKTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNF 923

Query: 950  MNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISF 1009
            ++LK++D+ ++++ F  LVK + N ++     +S   I   +  +++      + +++ F
Sbjct: 924  IHLKSIDVKESRLAFVHLVKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDF 983

Query: 1010 FNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGXXXX 1069
               CTL L  ++E+      PNWWKLYGELLELNK+Y+K FP    H   T         
Sbjct: 984  LKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNKLFPPN--HYNNT--------- 1032

Query: 1070 XXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQKNKLERKTSHHIDETIXXXXX 1129
                        +                GVF  LIENQ+NK  +K    ID+       
Sbjct: 1033 -----------LATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLEI 1081

Query: 1130 XXXXXXNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIK 1170
                   KHE LAEELN+YMEFK  FF + I++N+   D++
Sbjct: 1082 LGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGDLE 1122

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1188 (33%), Positives = 604/1188 (50%), Gaps = 124/1188 (10%)

Query: 1    MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKL 60
            MS YHLPTLLNPL+NA+FNCP+P  SP KKLF  LK ++FILL PP   LLNY D   KL
Sbjct: 1    MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL 60

Query: 61   SLNELCYHNSDFLGSHIL-TWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTR 119
             L+ELCY N DF+ SHIL T  N+               ++ L+G   +I+WK+NII   
Sbjct: 61   PLHELCY-NVDFINSHILLTTENS-----YLNTTLRDSHYETLDGKAVVIQWKNNIIHAL 114

Query: 120  GNFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDL 179
              F   QR KIL+   L NFNDYF G+ +F ++FID+P+    +  ND LKC        
Sbjct: 115  NGFPIRQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCE-VAPNDYLKCFDSYEEVP 173

Query: 180  KSQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELV 239
            K+ +  + L  +  +Q +SSF+N L+ + A   + G L +NY+  +   +P+ K+F ++V
Sbjct: 174  KNAQSVSNLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIV 233

Query: 240  NEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQK 299
             ++F  + S   F   KNF++  L+ L HDY E +LYD+IWSR    ++   K Y  D +
Sbjct: 234  QQSFDGMKSDSLF---KNFSN--LYDLIHDYFELNLYDDIWSR----LVTHFKGYEVDTE 284

Query: 300  AQHLIKHFSIVEIDPNFYDI----FPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTIL 355
                 K+FS+ ++  +F+      F L  +  +E+ +  +     KL  T SY EKS IL
Sbjct: 285  K---YKYFSVNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKIL 341

Query: 356  IESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANLYYLKYF 415
            +E+LQ ++         ++                              LK++LYYL+ F
Sbjct: 342  VETLQQLSGPTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNF 401

Query: 416  STDESSSSFGILNYTIATFHMVSHVLENV-----------IDWDRLKEKSDLIEELIMTD 464
            S + SS+ FGIL Y I+T   V    E+            + + + +E  D +     T+
Sbjct: 402  SNNPSSTKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTN 461

Query: 465  DLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQ 524
            ++  L+ T+E++    L YRN  G+S+L++ I N +N      L EYED+  M+ I  D+
Sbjct: 462  EIENLA-TYEDN----LQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDE 516

Query: 525  SMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLT 584
            ++D STLL+++I++ N EAA IL+ ++  NC ++ EL+SY+N+ D + R + HYL   + 
Sbjct: 517  TLDGSTLLIESIKTGNIEAAKILIGIMLLNC-SEGELVSYVNKADKYARTVAHYLTHEMD 575

Query: 585  ILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMND 644
            ILK IG +++WK+K+ +G+TPLF+IFR+YDQ NY+E+V   F IA  WY  +N  F   D
Sbjct: 576  ILKSIGSYVDWKRKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLD 635

Query: 645  HDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMII 704
            H DS GNSLLHIL++++SILL  +K     +++N  N KG TPLM+Y KYKR  NI  I 
Sbjct: 636  HTDSKGNSLLHILKSDVSILLQLSK-----LDINGRNYKGLTPLMIYVKYKRISNIDAIT 690

Query: 705  KEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSL 764
            K+ +LI  K Q+  F  CFDY+ D S+++ IGE   +   LFG + + SL+         
Sbjct: 691  KDSRLILEKVQNSTFFTCFDYAKDHSVLSKIGE-RGARDSLFGLVYLHSLRYHN------ 743

Query: 765  PRGLYINYTILIDEA---DKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSF 821
                 +N T  I  A   DK  LT  +   ++   L+ + +    +FLPL+       S+
Sbjct: 744  -----LNATTNITTASNTDKPFLTTVINMKTIQGLLRSILKDNQFTFLPLN-------SY 791

Query: 822  LDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXXXXXXXXXX 881
            +D+ S  N +  TI    I K  +R  L +L  C +VLL         P           
Sbjct: 792  IDEISHLNRSDLTI----IGKADVRSLLHKLTNCFNVLLFLK----KVPQNLFTDEASVL 843

Query: 882  XXXXXXKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLK 941
                    +R+   PS          +   K ++PE IN+IQ+FL+FN +E+++   +L 
Sbjct: 844  YWMRINTSKRNQKPPS----------KDNPKTMEPEEINMIQSFLRFNFDEISSFKASLN 893

Query: 942  VLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLE 1001
            +L K++IF++LK+ D  D       + + + N E      + F   + + + D   + L 
Sbjct: 894  ILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFT--NHNMFSD---LALA 948

Query: 1002 SLHEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPNCVVHARRTD 1061
             L E +SF  +CT++L   V+         WWK YGE L L K Y K FP+ V     TD
Sbjct: 949  ELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATD 1008

Query: 1062 LLSGXXXXXXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQKNKLERKTSHHID 1121
                                +P  +                + IE ++ + E++ +  I 
Sbjct: 1009 --------------------TPSHIP-------------LGSFIETKREQSEQRLAVQIK 1035

Query: 1122 ETIXXXXXXXXXXXNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDI 1169
             +              HE LAEEL+ YMEF+     +  +  F   +I
Sbjct: 1036 ASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFATTNI 1083

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1183 (33%), Positives = 606/1183 (51%), Gaps = 114/1183 (9%)

Query: 1    MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKL 60
            MS YHLPTLLNPL+NA+FNCP+P  SP KKLF  L+ ++FILL PP+  LLNY D   KL
Sbjct: 1    MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL 60

Query: 61   SLNELCYHNSDFLGSHIL-TWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTR 119
             L+ELCY N+DF+ SHIL T  N+             + ++ L+G   +++WK+N+I T 
Sbjct: 61   PLHELCY-NADFINSHILLTTENS-----YINTTLRDDHYETLDGKTVVVQWKNNVIHTL 114

Query: 120  GNFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDL 179
              F   +R KIL    L NFNDYF G++ F +++ID+P+     + ND L C        
Sbjct: 115  NGFPLRRRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCE-FVPNDYLHCFNSYEETS 173

Query: 180  KSQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELV 239
            K+      L+ D SQ  +SSFEN L+ + AW  + G L +NY+  +   +P+ K+F ELV
Sbjct: 174  KTARNAPNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELV 233

Query: 240  NEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQK 299
             +AF  + S   F   KNF++  L+ L HDY E +LY++IWSR    +    K Y  + +
Sbjct: 234  EQAFDGMKSDSLF---KNFSN--LYDLIHDYFELNLYEDIWSR----LTIHFKGYEVNTE 284

Query: 300  AQHLIKHFSIVEIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTIL 355
                 ++FS+ ++  ++Y    + F L  +  +E+ +  +     KL  + SY EKS IL
Sbjct: 285  N---CEYFSVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKIL 341

Query: 356  IESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANLYYLKYF 415
            +E+LQ ++ +   G    D +                            ++++LYYL+ F
Sbjct: 342  VETLQHLSGTTDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNF 401

Query: 416  STDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDL--IEELIMTDDLSTLSSTF 473
            S + SSS FGIL Y I+T   V    EN    +    K++L  I+   + D LS  + T 
Sbjct: 402  SNNSSSSKFGILGYAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTN 461

Query: 474  E-NDKKT---LLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSS 529
            E ND  T   +L YRN  G+S+L+L I N +N      L EYE +  ++ I  D+++D S
Sbjct: 462  EVNDLATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGS 521

Query: 530  TLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKII 589
            TLL+++I+  N EA  IL++++  NC ++ EL++Y+N+ D + R++ HYL   + ILK I
Sbjct: 522  TLLIESIKVGNLEATKILIRIMLFNCTDE-ELVTYVNKTDKYARSVAHYLTHEMDILKSI 580

Query: 590  GQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSN 649
            G +INWKQK+ +G+TPLF+IFRSYDQ NY+E+V   F IA  WY  +N  F  +DH D+ 
Sbjct: 581  GSYINWKQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNK 640

Query: 650  GNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKL 709
            GNSLLH+L+ ++SILL   K     +N+N  N KG TPLM+Y KYKR  NI  I K+ +L
Sbjct: 641  GNSLLHVLKTDVSILLQLTK-----LNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRL 695

Query: 710  IFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLY 769
            I  K Q+  F  CFDY+ D  +++ IGE   +N  +FG I + SL+              
Sbjct: 696  ILEKVQNSTFFTCFDYAKDRLVLSKIGE-RGANDSIFGLIYLHSLRYHN----------- 743

Query: 770  INYTILIDEADKST---LTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKS 826
            +N T+ +    K+    +T  +   ++   L+ + +    +FLP+D       +++D  S
Sbjct: 744  LNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIVKDNPFTFLPID-------NYIDGIS 796

Query: 827  KNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXXXXXXXXXXXXXXX 886
              N +  TI    I K  +R  L +L  C +VLL         P                
Sbjct: 797  HLNRSDLTI----IGKADVRSLLHKLTNCFNVLLFLK----KVPQNLFTDEASVLYWMRI 848

Query: 887  XKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKL 946
               RR+   PS          +   K ++PE IN+IQ+FL+FN +E+ +   +L +L K+
Sbjct: 849  NTSRRNQKPPS----------KDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKI 898

Query: 947  VIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHED 1006
            +IF++LK+ D  DA      +   + N +          +I + +   D  + L+ L E 
Sbjct: 899  LIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFT---TIIKNHKMFSD--LSLDELLEH 953

Query: 1007 ISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGX 1066
            + F  ECT++L + ++       PNWWK YGE L L+K Y K FP+ V            
Sbjct: 954  VQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAV------------ 1001

Query: 1067 XXXXXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQKNKLERKTSHHIDETIXX 1126
                            P+                    IE ++ + E++ S  I  +   
Sbjct: 1002 ---------------KPKSTAGTSSHIP------LGGFIETKREQSEQRLSVQIKASSKI 1040

Query: 1127 XXXXXXXXXNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDI 1169
                     + HE+LAEEL+ YMEF+     +  +  F  ++I
Sbjct: 1041 LKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAIKNI 1083

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  561 bits (1447), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 387/1180 (32%), Positives = 599/1180 (50%), Gaps = 108/1180 (9%)

Query: 1    MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKL 60
            MS  HLPTLLNPL+NA+FNCP+P  SP KKLF TLK  +FILL PP+  LLNY D   KL
Sbjct: 1    MSISHLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKL 60

Query: 61   SLNELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRG 120
             L+ELCY N++F+ SHIL  +                 ++ L+G   +I+WK+N+I    
Sbjct: 61   PLHELCY-NAEFINSHILLMTE----NSFINTNSRDSHYETLDGKTVVIQWKNNVIHALN 115

Query: 121  NFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLK 180
             F   +R KIL    L NFNDYF G+ +F +I+I++P++  S + ND L+C     +  K
Sbjct: 116  GFQVRRRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCES-VPNDYLQCFHSYKKIPK 174

Query: 181  SQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVN 240
            S      L  D SQQ +SSFEN L+ +     + G + +NY+  +   +P+ K+F  +V 
Sbjct: 175  SVYSVHNLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQ 234

Query: 241  EAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKA 300
            +AF  + S   F+K  N     L+ L H+Y E +LYD+IWSR    + +  K+Y   +  
Sbjct: 235  QAFEGMKSDSLFKKFPN-----LYDLIHEYFELNLYDDIWSR----LTSHFKSY---EVG 282

Query: 301  QHLIKHFSIVEIDPNFYDI----FPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILI 356
                K+FSI  +  +FY      F L+ V  +EK +  +     KL  T SYTEKS IL+
Sbjct: 283  TEEYKYFSINHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILV 342

Query: 357  ESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANLYYLKYFS 416
            E+LQ ++ +   G    D                              LK++LYYL+ FS
Sbjct: 343  ETLQELSGTTDMGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFS 402

Query: 417  TDESSSSFGILNYTIATFHMVSHVLE-------NVIDWDRLKEKSDLIEELIMTDDLSTL 469
             + SSS FGIL Y ++T   V    E       N+   + L +K+  +  ++  ++++  
Sbjct: 403  NNSSSSKFGILGYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNK 462

Query: 470  SSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSS 529
                    K +L YRN  G+S+L++ I N +N      L EY+ I  ++ +  D+++D S
Sbjct: 463  VENLAT-YKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGS 521

Query: 530  TLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKII 589
            TLL+++I+S N EAA IL++++  NC  ++ELISYIN+ D ++R + HYL   + ILK I
Sbjct: 522  TLLIESIKSGNLEAAKILIRIMMLNC-TEEELISYINRTDKYSRTVAHYLTHEIDILKSI 580

Query: 590  GQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSN 649
            G +++WK+K+  G+TPLF+IFRSYDQ NY+ +V   F IA  WY   N  F   DH D+ 
Sbjct: 581  GNYVDWKRKNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNK 640

Query: 650  GNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKL 709
            GN LLH+L+ + SILL   K     +++N  N KG TPLM+Y KYKR +NI  IIK+++L
Sbjct: 641  GNDLLHVLKTDASILLQLTK-----LDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRL 695

Query: 710  IFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLY 769
            +  K Q   F  CFDY+ D ++++ +GE   +   LFG I   SL+       +L   + 
Sbjct: 696  VLEKIQKSTFFTCFDYAKDHTVLSKVGE-RGAKDSLFGLIYFHSLRYH-----NLNAAVN 749

Query: 770  INYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNN 829
            I +     + +K      +   ++   L+ + +    +FLPL+        ++D+ S+ +
Sbjct: 750  ITFA---SDTEKPFSNTVINMKTIQGLLRSILKDNPFTFLPLNI-------YIDEISQLS 799

Query: 830  NNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXXXXXXXXXXXXXXXXKL 889
             +  TI    I K  +   L +L+ C +VLL         P                   
Sbjct: 800  RSDVTI----IGKADVMSLLHKLSNCFNVLLFLK----KVPKSLFTDEASILYWMRINTS 851

Query: 890  RRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIF 949
            +R+   PS          ++  K ++PE IN+IQ+FL+FN +E+++   +L +L K++IF
Sbjct: 852  KRNQKQPS----------KENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILIF 901

Query: 950  MNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISF 1009
            ++LK+ D  D     N + K + N +       + N+ + + ++D     L  L E + F
Sbjct: 902  ISLKSNDFKDVNDNLNEMGKSIYNAKAADAF--AGNLTNHNMFNDYS---LAKLLEHVRF 956

Query: 1010 FNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGXXXX 1069
              ECT++L + V+       PNWWK YGEL+ L+K Y K FP+ VV  + T   SG    
Sbjct: 957  LEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPS-VVKPKSTTDTSGHIQ- 1014

Query: 1070 XXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQKNKLERKTSHHIDETIXXXXX 1129
                                               IE ++ + E++ +  I  +      
Sbjct: 1015 -------------------------------LGGFIETKREQSEQRLAVQIKVSSKSLKE 1043

Query: 1130 XXXXXXNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDI 1169
                    HE LAEEL+ YMEF+     +  +  F   +I
Sbjct: 1044 LGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAATNI 1083

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  530 bits (1365), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 378/1177 (32%), Positives = 599/1177 (50%), Gaps = 116/1177 (9%)

Query: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63
            YH+P LLNPL+N+VFNC +PS S FKKLF  LK ++FILLVPPT  LL + D+    S+N
Sbjct: 3    YHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSMN 62

Query: 64   ELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRGNFS 123
            +LC  N DF+ SHIL                   E+  LN  +  ++     I T   F 
Sbjct: 63   DLC-QNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGFP 121

Query: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183
              +R +I  +  +TNFNDY +GS++F L+ ID P+ + +LI    +   L    +    +
Sbjct: 122  LRRRARIQNVELITNFNDYLNGSEKFALVHIDHPL-IGTLIRKIDIPRGLAQG-NFNGVD 179

Query: 184  KETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVNEAF 243
             +  LV+DL+Q+S SSFEN L  +  W+       N Y+       P  +LFR +V +  
Sbjct: 180  AKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQVH 239

Query: 244  IEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKAQHL 303
             ++ + + F+K  +     L+ L  DY+E +L+D++W RI       V +Y  D+     
Sbjct: 240  AKMVNDELFRKIPH-----LYDLIFDYVELNLFDDVWIRI-------VNSYRKDEIDTEP 287

Query: 304  IKHFSIVEIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILIESL 359
            +K  SI E++   Y    + F L+ V  +EKN+  ++     L  T ++ EK+  LI +L
Sbjct: 288  LKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTL 347

Query: 360  QIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANLYYLKYFSTDE 419
            Q ++++       +D +                         + ++K++L+YLK FS DE
Sbjct: 348  QSLSNT-----REQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDE 402

Query: 420  SSSSFGILNYTIATFHMVSHV---LENVIDWDRLKEKSDLIEEL-IMTDDLSTLSSTFEN 475
            +S  FGIL Y I+T   V      L+      +L++ S+  +EL I+  D ST  +  + 
Sbjct: 403  NSIKFGILGYAISTLEAVVFYFDGLKGTKKLQKLQDDSNKAKELYILISDKSTGQAVLDI 462

Query: 476  DK-KTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSSTLLLQ 534
             + ++ L +R   GES+L+  IIN +N    + L  YEDI  ++ I +D+++D STLL+Q
Sbjct: 463  SQFRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQ 522

Query: 535  AIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKIIGQFIN 594
            A++ +N EAA ++V++L  +C  Q EL  Y+N+ D + R + HYL   + IL+ IG++IN
Sbjct: 523  ALKCDNSEAAQMIVEVLQNSCTEQ-ELREYVNRADKNRRTVAHYLTHEMNILESIGKYIN 581

Query: 595  WKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSNGNSLL 654
            WK +D NG TPLFTIFR YDQ NY+ ++   F+ A++WY AN   FQ +DH+D+ GN+LL
Sbjct: 582  WKSQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLL 641

Query: 655  HILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKLIFNKF 714
            HI++NN+SILLDY       +++N  N KG TPLM+Y +Y R+DN++ II+++++I +K 
Sbjct: 642  HIIKNNVSILLDYDN-----VDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKL 696

Query: 715  QSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLYINYTI 774
            Q P+F++ FDY+ +  ++ ++    +     F    V  LK +    PS     + + T+
Sbjct: 697  QHPSFLNSFDYARNPLVLKELVSQAIKTTA-FELAFVHHLKYE---APS----WFFHITV 748

Query: 775  LIDE-ADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNLR 833
             I   AD+   T  +   +L    +++ + +  SFLPL+  L +            +NL 
Sbjct: 749  KIGAGADEEYKTVKLHIKTLQNLFQVLLKMHFASFLPLEKALEDL-----------SNLY 797

Query: 834  TIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXXXXXXXXXXXXXXXXKLRRSS 893
               +  I KL    F   L  C DVLL  D+                       + R  S
Sbjct: 798  KSRMPSIAKLETLYFFYMLTDCFDVLLRHDN----------------LNKLVLRESRLVS 841

Query: 894  TTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIFMNLK 953
               S   K  N+   +K+K ++PE I I+ +FL+FN  EL+ + + L  + KL+IF+ LK
Sbjct: 842  WIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVKLKLMTMKKLLIFLKLK 901

Query: 954  TLDI-HDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISFFNE 1012
              D+ H  Q  F  L     N     ++ K    I+   + ++  +   +   +I+F   
Sbjct: 902  NTDLTHSYQ--FLSLFGTEYNLAQDRLLFKDLE-INCCAFGEEATM---TFVREIAFLEN 955

Query: 1013 CTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGXXXXXXX 1072
            CT KL+  VE       P WWKLYG++LE++K Y + FPN      R D  SG       
Sbjct: 956  CTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNI----SRND--SG------- 1002

Query: 1073 XXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQKNKLERKTSHHIDETIXXXXXXXX 1132
                                      G+ A+  E ++ K+E K S  + +          
Sbjct: 1003 -------------------------TGIIASFFEGKREKMESKLSSDLADCKKRMRRVGD 1037

Query: 1133 XXXNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDI 1169
               + HE LAEEL++YMEFK+ FF   I++  V E+I
Sbjct: 1038 RISSTHEILAEELSKYMEFKSNFFINGILRRAVRENI 1074

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  501 bits (1291), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 361/1179 (30%), Positives = 583/1179 (49%), Gaps = 123/1179 (10%)

Query: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63
            YHLP LLNPL+NAVFNCP+PS S  KKLF+ LK+++FILLVPP   LL+  D      L 
Sbjct: 3    YHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQ 62

Query: 64   ELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRGNFS 123
            ELCY + +F+ SH+L                   +FD LNG K I++ ++ II T   F 
Sbjct: 63   ELCY-SYEFVASHVLLIDEQ-NAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120

Query: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183
              +R  I K     NFN+Y     +F ++ ID+PI   S+            +   ++++
Sbjct: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180

Query: 184  KETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVNEAF 243
              +P + D SQ SKSSF+N L  +  W LKF  L   Y+      +P+ +LF +++  A+
Sbjct: 181  GSSPTL-DSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAY 239

Query: 244  IEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKAQHL 303
              + S   F    + +      L +DY+E +LYD+IW RI         ++ D +   + 
Sbjct: 240  SAMRSDALFASMPDLS-----DLIYDYVELNLYDDIWVRI-------THHFKDSEVESNG 287

Query: 304  IKHFSIVEID----PNFYDIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILIESL 359
            +++ S+ +++    P+ ++ F LK V  +E N++ ++   ++L    ++ +K+  LI++L
Sbjct: 288  LRYLSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTL 347

Query: 360  QIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANLYYLKYFSTDE 419
            + ++  +   +E                              L +LK  L+YL+ F+ +E
Sbjct: 348  RNLSRVDKSIQEVSP-------VAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNE 400

Query: 420  SSSSFGILNYTIATFHMVSHV---LENVIDWDRLKEKSDLIEELIMTDDLSTLSSTFE-- 474
            +S +FG+L Y I+T          L+      RL+ + +    L+  D LS+ SS+    
Sbjct: 401  TSITFGVLGYAISTLEAAVCYFDELKGSKKMSRLESECENARSLV--DKLSSESSSVNLI 458

Query: 475  NDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSSTLLLQ 534
            + +KTL  YR   GESLL++ I N +N    Q L+  E    ++ I  DQ+ +  TLL+Q
Sbjct: 459  HYQKTL-SYRTEQGESLLSICIANGKND-ILQELLSDERSFPLEDILEDQTTEGCTLLMQ 516

Query: 535  AIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKIIGQFIN 594
            +++  N +AA ++V L+  +C  Q+E+ +Y N+ D   R   HYL   + IL+ IG F +
Sbjct: 517  SLKCGNGDAASLIVDLIKSSC-TQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFD 575

Query: 595  WKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSNGNSLL 654
            W  KD +G T LFTIFRSYDQ NYD+++   F+ A +WYA     F    H+D   N+LL
Sbjct: 576  WDVKDSSGHTALFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLL 635

Query: 655  HILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKLIFNKF 714
            HIL+ +ISILL+Y       +++N  N KG TPLM+Y KY R DN + I+ ++++I  K 
Sbjct: 636  HILKRSISILLEYES-----VDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKI 690

Query: 715  QSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLYINYTI 774
            Q P  +   DY+ +  I+++I +   +    FGK  V +LK + S+         +N T+
Sbjct: 691  QHPLLLCSIDYAKNPLILHEIAK-QSAMDTAFGKCFVHTLKYESSS-------WLVNITV 742

Query: 775  LIDEADKSTLTKTMKF--TSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNL 832
               +AD+    +T++F   ++  F + + R   ++FLPLD+ LN+  S           L
Sbjct: 743  ---QADRKGNFETVEFHLKTVQNFFRTVLRTCPMTFLPLDSTLNQLAS-----------L 788

Query: 833  RTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXXXXXXXXXXXXXXXXKLRRS 892
                L  I KL    +L+ L  C +VL+   +S                      K  R+
Sbjct: 789  GKARLSSIGKLETVCYLRSLTNCFNVLI---NSQELPKDILANESKLLSWIKVQYKAFRN 845

Query: 893  STTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIFMNL 952
             TT     K+E            PE ++IIQ FL+FN  EL+T+   L V+ KL IF+ L
Sbjct: 846  GTTHIFSKKVE------------PEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRL 893

Query: 953  KTLDIHDA-QIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISFFN 1011
            K+ D+  + ++      +G+   ++  + +  F+   ++ Y +D  +LL    EDI    
Sbjct: 894  KSSDVEQSVELLLPLGSEGMG--DLYPLTDHKFSC--TTVYGNDSMILLV---EDIDLML 946

Query: 1012 ECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGXXXXXX 1071
            +CT++L   + N      P WWKLYGELL   K Y +NFP+ V +   +           
Sbjct: 947  KCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETS----------- 995

Query: 1072 XXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQKNKLERKTSHHIDETIXXXXXXX 1131
                                       G+   ++E +K KLE++ S  I ET        
Sbjct: 996  ------------------------TDAGIIGKILEGKKEKLEKRLSFSIAETRRSMNQAG 1031

Query: 1132 XXXXNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIK 1170
                + HE LAE+L+++MEFK  +  R ++K +V E+IK
Sbjct: 1032 AIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENIK 1070

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  483 bits (1242), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 361/1191 (30%), Positives = 583/1191 (48%), Gaps = 156/1191 (13%)

Query: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63
            YHLP LLNPL+N+VFNCP PS SP KK+F +L++Q+FIL+VP  + LL+Y D     SL 
Sbjct: 3    YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62

Query: 64   ELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRGNFS 123
            +LCY   +F+ +HI+                  +EF  LNG   +I+ ++ I+ T   F 
Sbjct: 63   DLCY-TYEFVANHIIILKK--------DSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFP 113

Query: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183
            + +R KI       NFNDY  GSK F LI IDKP+ +S  + ND L+     + +  S  
Sbjct: 114  SKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPL-MSDAVKNDELQVFGVRSTNTSS-- 170

Query: 184  KETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVN--- 240
               PL  DL+Q+  SSFE     +     +F  L   +K +  E+  N K    LV+   
Sbjct: 171  --LPLSTDLTQREVSSFEQLFRLHPQLGDRFSGL---FKEQRQEINANFKGLDSLVDFFD 225

Query: 241  ----EAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYAD 296
                EAF  I  ++ F+        +L Q  H+Y+E +LYD+IW +I ++       Y D
Sbjct: 226  KFNYEAFELIRHERRFE-----NHSKLHQTVHNYVELNLYDDIWKQITQL-------YRD 273

Query: 297  DQ-KAQH---LIKHFSIVEIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSY 348
            D+ +A +   L+K+ +I ++   FY      F LK V   EK+L+ +  C  +L  + S+
Sbjct: 274  DEIEATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSH 333

Query: 349  TEKSTILIESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKAN 408
            +EK+ I++++LQ +TD +    E  D +                    +S +   +LK++
Sbjct: 334  SEKTKIIMDTLQTLTDYS----EFPDADIEDVTIDADTLIGLMVLVVCRSQV--KNLKSH 387

Query: 409  LYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKE-KSDLIEELIMTDDLS 467
            L+YL+ FS DE++  FG++ Y ++T   V    E+  +  +++  + +        D LS
Sbjct: 388  LFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLS 447

Query: 468  TLSSTFENDK--KTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQS 525
              + +F++ K  + +L  R + GES L++ I           L  +E  L ++ I +DQ+
Sbjct: 448  CKAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQT 507

Query: 526  MDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTI 585
            ++ STLL+Q + + N   A +L+++L Q+C    EL  Y+N+ +   R   HYL  +L +
Sbjct: 508  INGSTLLMQTLETGNTRMADVLLEILCQSC-TINELREYLNRRNRWKRTAAHYLTQDLQM 566

Query: 586  LKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDH 645
               IG F +W+ KD++G TPLF IFRSYD  +Y ++V   F+ A KWY      F  + H
Sbjct: 567  ADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAH 626

Query: 646  DDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIK 705
             D+ GN+LLH+++ NI ILL+        I++N++N KG TPLM+Y KY R DN++ I++
Sbjct: 627  KDTKGNTLLHVMKTNIEILLEQEN-----IDVNEVNKKGLTPLMVYVKYNRLDNVKCILR 681

Query: 706  EEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLP 765
            + +LI  K Q   F++CFDY  +  I  ++G F  +    FG+++  + + + +      
Sbjct: 682  DNRLIMEKHQKSLFLNCFDYVKNPVIQAELG-FHAAEKTKFGEVVAHTFRFENNRW---- 736

Query: 766  RGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKK 825
              L+I       E D  T+   ++  ++   L++  R+  +SFLP+D +L +        
Sbjct: 737  -FLWITLKGKDRETDFQTVKHNIR--AIQGLLQVYLRRNPMSFLPIDAVLEDL------- 786

Query: 826  SKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXXXXXXXXXXXXXX 885
                + +    L  + KL + RFL  L   L ++   ++                     
Sbjct: 787  ----HEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEE--------------------- 821

Query: 886  XXKLRRSSTTPSAKSKLENAMGEKKKK------ELKPENINIIQNFLKFNLNELNTISMN 939
                +++   P+  S L N + E  +K       ++PE IN IQ+FL+FNL+EL+ I   
Sbjct: 822  ---FKKALYLPA--SDLVNWIRESGRKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDK 876

Query: 940  LKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYD--DDKG 997
            + +L KL IF  LK  DI+ A+         L +    + I ++F +   S  D  D   
Sbjct: 877  ISILQKLSIFSELKAQDINQARCMLFSQSVRLED----TAISQAFGISGLSEKDSEDLSA 932

Query: 998  VLLESLHEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPNCVVHA 1057
             +L S   +I F  ECT KL+  ++         WWKLY ELL+    Y+KNFPN V   
Sbjct: 933  TILTS---NIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSV--- 986

Query: 1058 RRTDLLSGXXXXXXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQKNKLERKTS 1117
                                     P               G+F   +E +++KLE K S
Sbjct: 987  ------------------------KPH---------LDDNKGLFGTYVEGKRSKLEEKLS 1013

Query: 1118 HHIDETIXXXXXXXXXXXNKHEHLAEELNRYMEFKNRFFGRNIMKNF-VGE 1167
              I   +            +HE LAEEL+ Y+EFK  +    I+++F VG+
Sbjct: 1014 AQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGK 1064

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  417 bits (1072), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 346/1183 (29%), Positives = 571/1183 (48%), Gaps = 137/1183 (11%)

Query: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63
            YH+P LLNPL+NAVFNCPDP +SP +KLF  +K + F+L+VPP   LL+Y D    L+L 
Sbjct: 6    YHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLK 65

Query: 64   ELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDN----LNGNKFIIKWKHNIIFTR 119
            ELCY   +F+ SHI+  ++              E  DN    LN N+ +IK  + I    
Sbjct: 66   ELCYE-FEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLDF 124

Query: 120  GNFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSL--IANDSLKCLLPNTR 177
             N +  +++KI+ I  L NFN+Y  GS+++ +I+ D P + S L  I  +S       + 
Sbjct: 125  NNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKESN 184

Query: 178  DLKSQE---KETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKL 234
            ++K+ +    ++PL QDL+Q++KSSF + +N ++ WN  F     ++K +   L      
Sbjct: 185  NIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSLPIY 244

Query: 235  FRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNY 294
            FRE+V++A+ ++  ++ F    +F +D L+ L  +Y+E   Y+ IW  I + M+      
Sbjct: 245  FREIVDKAYQKMKFEEIFL---SFHND-LYNLIFEYLESSFYNSIWDHIDRNMI------ 294

Query: 295  ADDQKAQH--LIKHFSIVEIDPNFYDI----FPLKFVPMLEKNLKHSVTCINKLKSTKSY 348
              D +  H  ++   SI +++   Y+     F L  V  +E+ +K +     K+  +KS+
Sbjct: 295  --DNQFLHTEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSH 352

Query: 349  TEKSTILIESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKAN 408
            +EK  ILI++LQ +T  +       D +                    +S +    L+ +
Sbjct: 353  SEKCQILIDALQKLTSYD-------DVHYEPLMVDADTLMNLFLLVICRSKVPF--LRNH 403

Query: 409  LYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEK-------SDLIEELI 461
            LYYL+ FSTDE++  FG+L Y I+TF      L++    ++  ++        +LI ++ 
Sbjct: 404  LYYLQNFSTDENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKIS 463

Query: 462  MTDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIIS 521
               D ST       D      +RN  GES+LAL I +K+N+   + L+ +ED+  ++ I 
Sbjct: 464  SEADHSTFQVKLYKD---CFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDIL 520

Query: 522  NDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVI 581
            +D+ ++ +TLL++A++  N   A ++V +L  +C ++ ELI Y N+ D + R   HY+  
Sbjct: 521  DDEDIEGTTLLMKALKVENEVGAKLIVDVLQSSC-SEDELIKYFNRTDNNQRIAAHYITN 579

Query: 582  NLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQ 641
             + +LK IG F NWK KD  G TPL TI R+YDQ  Y++++   F  A KWY   N K  
Sbjct: 580  QIDVLKRIGLFFNWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLN 639

Query: 642  MNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIR 701
              DH+DS  N+LLHIL+ +I +LL Y       IN+N  N K  TPLM Y KY R  NI+
Sbjct: 640  FKDHNDSKENTLLHILKCDIQVLLKYDN-----ININAHNLKYITPLMTYVKYNRVSNIQ 694

Query: 702  MIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTV 761
             II++E+LI  K+Q   F+DC+D+  ++ I  D+G   + N  +F      SL+ + S  
Sbjct: 695  EIIRDERLILGKYQKHTFLDCYDFVKNTIIFEDLGVRSVRNS-MFNLFSAYSLRVENSN- 752

Query: 762  PSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSF 821
                   ++ Y    D    S +TK++    L   +K   + Y + F+P   +L      
Sbjct: 753  -------WVLYFTFKDTNQDSYITKSVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGI 805

Query: 822  LDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLH---FDDSTIATPXXXXXXXX 878
            +    KNN      P   I+KL+ R FL  ++     L+    FD      P        
Sbjct: 806  V----KNN------PNNGIQKLKNRAFLNLISNYFGTLIETDDFDTELFKNP-------- 847

Query: 879  XXXXXXXXXKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISM 938
                          S T   K+       E   K +  ++IN+I++F++FN+NEL  ++ 
Sbjct: 848  -------------ESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINELGKLNR 894

Query: 939  NLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGV 998
             L +L KL  F+ LK  D++++   F      L  K++ + ++K   +I    +     +
Sbjct: 895  TLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSIFLI 954

Query: 999  LLESLHEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPNCVVHAR 1058
            LL+     ISF   CT+ +  +  +      P W  ++  L  L K Y ++F +      
Sbjct: 955  LLDQ----ISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDF----- 1005

Query: 1059 RTDLLSGXXXXXXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQKNKLERKTSH 1118
              D  +G                                  + +   +N++   E++ S 
Sbjct: 1006 --DSRNG------------------------------LNENILSRYTKNKREAAEKRISE 1033

Query: 1119 HIDETIXXXXXXXXXXXNKHEHLAEELNRYMEFKNRFFGRNIM 1161
             I E               HE+LAEE N+++ FK+RFF   I+
Sbjct: 1034 EIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVIL 1076

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  405 bits (1040), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 346/1201 (28%), Positives = 564/1201 (46%), Gaps = 180/1201 (14%)

Query: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63
            YHLP LLNPL+NAVFNCP P+ SP KKLF  +K Q+FILLVP T  LL Y D    L L+
Sbjct: 3    YHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLS 62

Query: 64   ELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRGNFS 123
            ELCY N DF+ SHIL                  +E+  LNGN  II+ +  I+ ++    
Sbjct: 63   ELCY-NYDFVASHILI--------QLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPEL- 112

Query: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183
              ++ ++     L NFNDY      F L+ ID+P+ V +L+ ND L+          S E
Sbjct: 113  --RKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPL-VGALVRNDELQVF-------GSYE 162

Query: 184  KETPLVQDLSQQSKSSFENDLNKNEAWNLKF-------GILSNNY--------KIESSEL 228
               P        SKS   N +++N     KF       G   + Y        + E  +L
Sbjct: 163  MHNP--------SKSKTINTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQL 214

Query: 229  EPNHKLFRELVNEAFIEIDSKKFFQKKKNFTS-DQLFQLTHDYMERHLYDEIWSRIWKMM 287
            +   K+F++LV      ID     ++ KNF +  +L  +T +Y+E ++Y++IW ++  + 
Sbjct: 215  DKLIKIFKDLV------IDVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKL--VQ 266

Query: 288  MNSVKNYADDQKAQHLIKHFSIVEID----PNFYDIFPLKFVPMLEKNLKHSVTCINKLK 343
            +N  K   D        K+ S+  +     P   + F L+ V  +EK +  +  C  KL 
Sbjct: 267  LNGSKE-PDRVSGYSSTKYISLNNVATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLS 325

Query: 344  STKSYTEKSTILIESLQIITD--SNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNIT 401
             T S+ EK+ I++ + QI+T     T  + + D +                         
Sbjct: 326  LTNSHNEKAKIVVSTFQILTTKMEYTSIDPTIDAD-----------TLIGLMLVVLCRSQ 374

Query: 402  LHDLKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIE--- 458
            + +LK++L YL+ F+       FG+  Y+++T   V    E     ++LK+   L E   
Sbjct: 375  VKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGTEKLKKLISLSEANR 434

Query: 459  ---ELIMTDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDIL 515
               +LI +    +LSS      K  L+ R+SN ES L++ I   +     + L+ Y++ +
Sbjct: 435  VFWDLIRSGVAVSLSSY-----KNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQI 489

Query: 516  NMDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNI 575
             ++ +  D +  +STLL+QA+ + + E A +L+ ++  NC N  E   Y+N+ +   R +
Sbjct: 490  KLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTNN-EFYEYVNRSNSAGRTV 548

Query: 576  GHYLVINLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAA 635
             HYL    +I++ IG +++W++KDVN  TPLF I R+YDQ +Y E++ + F+   ++   
Sbjct: 549  AHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFEYVFEYCRR 608

Query: 636  NNLKFQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYK 695
                F   DH+D  GNSLLHI++  I  +L         IN+NK N KG TPLM+Y KY 
Sbjct: 609  RGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPN-----INVNKSNIKGMTPLMLYAKYN 663

Query: 696  RYDNIRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLK 755
            R +NIR I+++++LI +K Q+P  +   DY  +  I+N IG  +  N  L+G +    +K
Sbjct: 664  RIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNS-LYGLLSADGIK 722

Query: 756  KQMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLL 815
             + +         Y+  T+   +   STL +++K  ++   L+   +K+ ++FLP+D +L
Sbjct: 723  FEDNC-------WYLWITVKFSDNSYSTLRQSVK--NIQGLLQFYNKKHPMNFLPIDHIL 773

Query: 816  NESQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLD------VLLHFDDSTIAT 869
                S L    KN      +P+  +E       L +L + +        +L +++S ++T
Sbjct: 774  ----SIL----KNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLST 825

Query: 870  PXXXXXXXXXXXXXXXXXKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFN 929
                               LR ++  P A           K + ++PE ++ IQ+FLKFN
Sbjct: 826  ------------------WLRTNNFKPRA----------NKDERIEPEEVSSIQSFLKFN 857

Query: 930  LNELNTISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDS 989
            L+E + I     +L KLV+F +LK  DI  AQ      ++ ++N   PS +EK+F     
Sbjct: 858  LSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVSNSVGPS-VEKTF----- 911

Query: 990  SRYDDDKGVLLESLHEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKN 1049
                 ++   L+S  + I F   C   L   ++         WW+LYGEL  L + Y +N
Sbjct: 912  --IGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRN 969

Query: 1050 FPNCVVHARRTDLLSGXXXXXXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQK 1109
            FP+     + +D +SG                                 G F + IE ++
Sbjct: 970  FPS---DFKSSD-VSG-----------------------------EESKGFFESYIEGKR 996

Query: 1110 NKLERKTSHHIDETIXXXXXXXXXXXNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDI 1169
             K E K    +   I             HE+LAEE++ ++ FKN  +   +MK +    I
Sbjct: 997  QKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICI 1056

Query: 1170 K 1170
            K
Sbjct: 1057 K 1057

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  404 bits (1037), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 314/1196 (26%), Positives = 558/1196 (46%), Gaps = 162/1196 (13%)

Query: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63
            Y+LP LLNPL+NAVFNCP P +SP +K+FT ++ Q+F L+ P    LL Y D     SL 
Sbjct: 3    YYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQ 62

Query: 64   ELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRGNFS 123
            +LCY ++ F+  HIL                  EE+  L+G    ++ +   +FT   F 
Sbjct: 63   DLCY-SASFVSDHILLLGGG--------GCSHEEEYKTLSGKTITLRNQQKALFTGEGFD 113

Query: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183
              +R ++L+   L+NFN+YF GS  + +I +D P+T   L   D      P  +  +   
Sbjct: 114  ARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLT-GRLARRDEW----PGFKAYRFAS 168

Query: 184  KETPLVQD---LSQQSKSSFENDLNKNEAWNLKFG--ILSNNYKIESSELEPNH--KLFR 236
             +T         S + K+S E  L  + ++  K    I +    + SS    ++    F 
Sbjct: 169  TDTTSANSSLAASTEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFM 228

Query: 237  ELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYA- 295
            +   +A   I   + F+   N       Q+ H+Y+E +LYD+ W++    + NS+K+   
Sbjct: 229  QTCEKALAAIQEDQSFRAFPNLR----LQI-HEYVEMNLYDDFWAQ----LTNSLKDSEI 279

Query: 296  DDQKAQHLIKHFSIVEIDPNFYDI----FPLKFVPMLEKNLKHSVTCINKLKSTKSYTEK 351
            ++Q    ++++ SI ++    Y      F ++ V  +EKNL+ +V C+ +L  T S++ K
Sbjct: 280  ENQSDFSILRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSK 339

Query: 352  STILIESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANLYY 411
            + +++E+LQ ++ S     E  DK  S                       + DLK++L+Y
Sbjct: 340  AKVIVETLQTVSRS----LEINDKVIS-----VDADTLVSLLVVVVCQAEVKDLKSHLFY 390

Query: 412  LKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEELI---------M 462
            L+ F+ D +S +FGIL Y ++T       LE V+ +   +EK  L+E+           +
Sbjct: 391  LQEFAKDSNSITFGILAYGMST-------LEAVLSYFESREKLKLLEKHCSSNASYWEAL 443

Query: 463  TDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISN 522
             D    L S   ++ K +L  R   G S L++ + N+Q   F     ++E    ++ + N
Sbjct: 444  ADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLN 503

Query: 523  DQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVIN 582
            D++++ S LL+Q + +     +   +++LF++C  + EL S++N V+ + R+ GHYL+  
Sbjct: 504  DETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSC-TKTELESFLNHVNRYQRSSGHYLMHA 562

Query: 583  LTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQM 642
            L ++  +G+FINW+Q+D NG TPLF I R+YD ++YD +V + ++ A  W      +F++
Sbjct: 563  LDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRL 622

Query: 643  NDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRM 702
            + H D+ GN+LLH++++N+S++LD     +  +N+N  N KG TP+M+Y +Y R DNI+ 
Sbjct: 623  SKHQDNKGNTLLHVIKSNVSVVLD-----DPLVNVNSFNKKGLTPIMVYARYNRLDNIKS 677

Query: 703  IIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGE---FLLSNGQLFGKIIVLSLKK--- 756
            I+++++LI  K Q+ +++ CFDY  +  ++ ++G+   FL  + Q+    I     +   
Sbjct: 678  ILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFLPQSYQIRAHNIKFEGDEWVL 737

Query: 757  QMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLN 816
             M+ V S+P             A    + +++KF  +  FL    +  +++F+P ++L  
Sbjct: 738  WMTLVGSVP------------NAPAKVIQRSLKF--IQSFLISFSKTNSMTFIPAESLAE 783

Query: 817  ESQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFD--DSTIATPXXXX 874
            E  S L K          + +  I +L  + FL+R +  L ++   +  +     P    
Sbjct: 784  E-LSLLAK----------MKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNP---- 828

Query: 875  XXXXXXXXXXXXXKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELN 934
                             S +  +A   ++          ++PE +  IQ  +KFN  E+ 
Sbjct: 829  -----------------SGSLVNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEIL 871

Query: 935  TISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDD 994
             I     +L KL IF  LK  D+  +   F       +      II +S NV  S ++  
Sbjct: 872  AIKSGALMLKKLAIFGILKGKDLERSHTMFQS-----HGNNFTKIIGRSTNVFGSLKHSL 926

Query: 995  DKGVLLESLHEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPNCV 1054
             +      L  + +     +  L+  ++       P+WWK YGEL+ L   Y+KNFP+ V
Sbjct: 927  PQ-CEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDV 985

Query: 1055 VHARRTDLLSGXXXXXXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQKNKLER 1114
                                        P+              G  ++ IE ++ +LE+
Sbjct: 986  ---------------------------RPR---------VAENTGFISSYIETKRVRLEQ 1009

Query: 1115 KTSHHIDETIXXXXXXXXXXXNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIK 1170
                 I+ +              +E LA ELN ++ FK  F+    +K     +IK
Sbjct: 1010 GLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIK 1065

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  395 bits (1016), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 278/876 (31%), Positives = 455/876 (51%), Gaps = 78/876 (8%)

Query: 4   YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63
           YHLP LLNPL+N+VFNCP PS SP KK+F +L++Q+FIL+VP  + LL+Y D     SL 
Sbjct: 3   YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62

Query: 64  ELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRGNFS 123
           +LCY   +F+ +HI+                  +EF  LNG   +I+ ++ I+ T   F 
Sbjct: 63  DLCY-TYEFVANHIIILKK--------DSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFP 113

Query: 124 NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183
           + +R KI       NFNDY  GSK F LI IDKP+ +S  + ND L+     + +  S  
Sbjct: 114 SKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPL-MSDAVKNDELQVFGVRSTNTSS-- 170

Query: 184 KETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVN--- 240
              PL  DL+Q+  SSFE     +     +F  L   +K +  E+  N K    LV+   
Sbjct: 171 --LPLSTDLTQREVSSFEQLFRLHPQLGDRFSGL---FKEQRQEINANFKGLDSLVDFFD 225

Query: 241 ----EAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYAD 296
               EAF  I  ++ F+        +L Q  H+Y+E +LYD+IW +I ++       Y D
Sbjct: 226 KFNYEAFELIRHERRFE-----NHSKLHQTVHNYVELNLYDDIWKQITQL-------YRD 273

Query: 297 DQ-KAQH---LIKHFSIVEIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSY 348
           D+ +A +   L+K+ +I ++   FY      F LK V   EK+L+ +  C  +L  + S+
Sbjct: 274 DEIEATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSH 333

Query: 349 TEKSTILIESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKAN 408
           +EK+ I++++LQ +TD +    E  D +                    +S +   +LK++
Sbjct: 334 SEKTKIIMDTLQTLTDYS----EFPDADIEDVTIDADTLIGLMVLVVCRSQVK--NLKSH 387

Query: 409 LYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKE-KSDLIEELIMTDDLS 467
           L+YL+ FS DE++  FG++ Y ++T   V    E+  +  +++  + +        D LS
Sbjct: 388 LFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLS 447

Query: 468 TLSSTFENDK--KTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQS 525
             + +F++ K  + +L  R + GES L++ I           L  +E  L ++ I +DQ+
Sbjct: 448 CKAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQT 507

Query: 526 MDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTI 585
           ++ STLL+Q + + N   A +L+++L Q+C    EL  Y+N+ +   R   HYL  +L +
Sbjct: 508 INGSTLLMQTLETGNTRMADVLLEILCQSC-TINELREYLNRRNRWKRTAAHYLTQDLQM 566

Query: 586 LKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDH 645
              IG F +W+ KD++G TPLF IFRSYD  +Y ++V   F+ A KWY      F  + H
Sbjct: 567 ADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAH 626

Query: 646 DDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIK 705
            D+ GN+LLH+++ NI ILL+        I++N++N KG TPLM+Y KY R DN++ I++
Sbjct: 627 KDTKGNTLLHVMKTNIEILLEQEN-----IDVNEVNKKGLTPLMVYVKYNRLDNVKCILR 681

Query: 706 EEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLP 765
           + +LI  K Q   F++CFDY  +  I  ++G F  +    FG+++  + + + +      
Sbjct: 682 DNRLIMEKHQKSLFLNCFDYVKNPVIQAELG-FHAAEKTKFGEVVAHTFRFENNRW---- 736

Query: 766 RGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKK 825
             L+I       E D  T+   ++  ++   L++  R+  +SFLP+D +L +    L + 
Sbjct: 737 -FLWITLKGKDRETDFQTVKHNIR--AIQGLLQVYLRRNPMSFLPIDAVLED----LHEI 789

Query: 826 SKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLH 861
            K         L  + KL + RFL  L   L ++  
Sbjct: 790 GKTG-------LVSVGKLEVHRFLCELTLVLKLICQ 818

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  395 bits (1016), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 312/1202 (25%), Positives = 555/1202 (46%), Gaps = 176/1202 (14%)

Query: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63
            Y+LP LLNPL+NAVFNCP P +S  KK+F+ ++  +F+L+ PPT  LL Y D    L L 
Sbjct: 3    YYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQ 62

Query: 64   ELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRGNFS 123
            +LCY  + F+  HI+                  EE+  L+G   +++ +  IIFT   F 
Sbjct: 63   DLCY-ATGFVSDHIVLLDG--------REGLQEEEYKTLSGKTILLRSQQGIIFTAAAFD 113

Query: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183
              +R +I +   LTNFN+Y  G   F +I +D P+T   L   D  +C     R  K+QE
Sbjct: 114  TRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLT-GRLARRDEWQCF----RVTKNQE 168

Query: 184  KETPLVQDLSQQSKS----SFENDLNKNEAWN------LKFGILSNNYKIESSELEPNHK 233
              T   ++  + S      S E  L  N  +       +K   +S N  +  +    +H 
Sbjct: 169  -HTNGPKNSGKLSHGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASH- 226

Query: 234  LFRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKN 293
             F +   +A   + +   FQ   N     L    H+Y+E +LYD+ W+++   + +S   
Sbjct: 227  -FVQTCKKALDVVRAYPAFQVLPN-----LPICVHEYIELNLYDDYWAQLTNSLRDSEIE 280

Query: 294  YADDQKAQHLIKHFSIVEIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSYT 349
             + D     L+KH S+ ++    Y    + F L+ +   EKN+K +V    K+  T  ++
Sbjct: 281  SSSDYS---LLKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHS 337

Query: 350  EKSTILIESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANL 409
             K+ ++IE+LQ ++ S    + +   +                      +  + DL+++L
Sbjct: 338  AKAKVIIETLQTLSRSLLVDDRAVTIDADTLVSLFVVVV---------CHAQVKDLRSHL 388

Query: 410  YYLKYFSTDESSSSFGILNYTIATFHMV--------------SHVLENVIDWDRLKEKSD 455
            +YL+ F+ D +  +FGIL Y ++T   V               +   N+  W  + E S 
Sbjct: 389  FYLQEFTKDTNLVTFGILAYGMSTLEAVLCYFESPEKVASLEKYCRANLSHWKSISEGSI 448

Query: 456  LIEELIMTDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDIL 515
                     DL+  ++   +D   LL  R S+G+S LA+ + +++ ++F       E   
Sbjct: 449  ---------DLNADTTVPLDD---LLKIRTSDGQSCLAVCLQHRRTEEFELIKNTREAWF 496

Query: 516  NMDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNI 575
             ++ + +D++ D S LL+  + S     A++L+  L  NC  + ELI+++N  + + R+ 
Sbjct: 497  PLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNC-TKDELIAFLNHTNKYQRSC 555

Query: 576  GHYLVINLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAA 635
            GHYL+    ++ ++G  +NW+Q+D NG TPLF I R+YD+ +Y ++V   ++ A+     
Sbjct: 556  GHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKV 615

Query: 636  NNLKFQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYK 695
             N +F++++H D  GN+LLH++++++SILL      +  I++N  N KG TPLM+Y +Y 
Sbjct: 616  RNSRFRVSNHTDDKGNTLLHVIKSDVSILL-----ADPFIDVNATNAKGLTPLMVYVRYN 670

Query: 696  RYDNIRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLK 755
            R  N+R I+++++LI  K QS  ++ CFDY  + +++ ++G++  S       I V S+K
Sbjct: 671  RIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKY-ASYLPFEFSINVHSVK 729

Query: 756  KQMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLL 815
            ++          L+I  T    +       ++++F  +  FL +    + ++F+P+D LL
Sbjct: 730  REGDEWV-----LWITVTGGEKQVPVKVFKRSLRF--IQAFLTLFSDAHPMTFVPVDELL 782

Query: 816  NESQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLH-------FDDSTIA 868
             E ++    +           +  + K+  +RFLKR +  L ++         F DS + 
Sbjct: 783  RELRALSQSR-----------ILILNKMDTKRFLKRCSVTLSMVSQERLFADAFTDSNL- 830

Query: 869  TPXXXXXXXXXXXXXXXXXKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKF 928
                                        S++    +    +  K ++PE +  IQ+ LKF
Sbjct: 831  -------------------------NLSSSRGLGSSESFTQNMKMMEPEEVRSIQSILKF 865

Query: 929  NLNELNTISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVID 988
            NL+E++ +   + ++ KL +F  LK  D+ +A + F    K +   ++ S  +   NV  
Sbjct: 866  NLSEISALKTAMLLMKKLAVFEGLKGKDLSEACMTFGAKCKYVTQGKIQS-FDHFLNVQA 924

Query: 989  SSRYDDDKGVLLESLHEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHK 1048
             + +D       E +  +I+    C+  L   +        P WW  YGELL L + Y K
Sbjct: 925  PNLFD------FEGIANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKK 978

Query: 1049 NFPNCVVHARRTDLLSGXXXXXXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQ 1108
            +FP+    A R  +                                    G+F + IE +
Sbjct: 979  SFPD----ANRPHV--------------------------------SENSGLFGSYIETK 1002

Query: 1109 KNKLERKTSHHIDETIXXXXXXXXXXXNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGED 1168
            + KLE+  +  I+ T              +E LA ELN ++ FKN F  ++ +K     +
Sbjct: 1003 RTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFL-KSAIKEHADTN 1061

Query: 1169 IK 1170
            IK
Sbjct: 1062 IK 1063

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  389 bits (1000), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 326/1192 (27%), Positives = 542/1192 (45%), Gaps = 163/1192 (13%)

Query: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63
            YHLP LLNPL+NAVFNCP P  SP KKLF   K+++FIL+VP T  LL Y D+   + L 
Sbjct: 3    YHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLT 62

Query: 64   ELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRGNFS 123
            ELCY N +F+ SH L                   EF  +NG   +I+ +  II  +    
Sbjct: 63   ELCY-NYEFVASHTLVQLQEARVTEL--------EFQTINGKSVVIRPQSGIITAQ---P 110

Query: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLK--- 180
            + ++ +I +   L +FNDY  G   F L++ID+P+ V  +     L+   P  + L+   
Sbjct: 111  SAKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPL-VGEIELITPLRVFGPQEQPLQYQR 169

Query: 181  -SQEKETPLVQDLSQQSKSSFENDLN---KNEAWNLKFGILSNNYKIESSELEPNHKLFR 236
             +Q  + PL  +   +      N L+   K+    +++  LS         L+   +LF 
Sbjct: 170  ITQTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALS---------LKELVRLFH 220

Query: 237  ELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYAD 296
            ELV + +  I   K F+   N     L ++   Y+E ++Y+++W ++ ++   + KN  D
Sbjct: 221  ELVEKVYCLIKLDKNFRNYLN-----LLEMVQGYVELNMYEDVWRKLVQL---NGKNEPD 272

Query: 297  DQKAQHLIKHFSIVEIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKS 352
                 ++ +  S+ ++  + Y    D F L  V  +EK +  +  C +KL  T S+ EK+
Sbjct: 273  RVPGYYITRSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKA 332

Query: 353  TILIESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANLYYL 412
             ILI + Q +T   +         ++                       + +LK++L YL
Sbjct: 333  RILISTFQKLTTKTS---------QATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYL 383

Query: 413  KYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEELIMTDDLSTLSST 472
            + F+ +     FG+L Y+++T       LE V+ +  +   S  +E LI        +  
Sbjct: 384  REFAQNSDDVKFGLLGYSLST-------LEAVVGYFDIGGSSIKLERLITQ---CQRNKI 433

Query: 473  FEN-----------DKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIIS 521
            F N           + + +L+ R  + ES+L+L I   +   F   +  Y+    ++ I 
Sbjct: 434  FWNLIEQGIPINLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDIL 493

Query: 522  NDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVI 581
             D +  + +LL+QA+++ N +    ++ LL  NC N  E+ +YIN+ DI  R +GHYL  
Sbjct: 494  QDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTN-TEMYAYINKCDIAGRTVGHYLPQ 552

Query: 582  NLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQ 641
            N  I+  +G+F++WK+KD+N  TPLFT+ R+YD  +Y EL+ + FQ    +Y+    +F 
Sbjct: 553  NYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFS 612

Query: 642  MNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIR 701
              DH+D  GN+LLHI+++ I + L          N+NK N +G TPLM+Y KY R +NIR
Sbjct: 613  FADHEDPLGNTLLHIIKDGIQLALSTPG-----ANVNKCNTRGMTPLMVYAKYNRIENIR 667

Query: 702  MIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTV 761
             I+ +++LI +K Q P  +   DY  +  I+N IG  +  N  L+G + V ++K + +  
Sbjct: 668  EILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNS-LYGCLSVHNIKYEENA- 725

Query: 762  PSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSF 821
                  L+I  ++    + +S  T +     +   L+I  +K+ +SFLP+D         
Sbjct: 726  ----WYLWITSSL----SPESYKTSSYALKDIQSLLQIYNKKHPMSFLPID--------- 768

Query: 822  LDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXXXXXXXXXX 881
                    ++L T  L+ + K  I   +   N+ L   L F  S I              
Sbjct: 769  --------HHLET--LKTLGKSGIISVINLENSMLLEALTFSLSII-------------- 804

Query: 882  XXXXXXKLRRSSTTPSAKSKLENAMGEK---KKKELKPENINIIQNFLKFNLNELNTISM 938
                  K   S T     + L  +M ++   K+ +++PE I+ IQNFLKF+L E N +  
Sbjct: 805  QQREDYKNVFSYTESELSTWLRASMVKQKPNKRDKIEPEEIHSIQNFLKFSLTEFNYLRE 864

Query: 939  NLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGV 998
               VL KL+IF + K+ DI  +Q R       +    VPS        + +S +D++   
Sbjct: 865  KFTVLKKLIIFEHYKSHDIECSQ-RILYSQGEIIASVVPS------KRLRTSPFDNEFND 917

Query: 999  LLESLHEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPNCVVHAR 1058
             ++   + + F   C   L   +          WW LYGE+  L K Y +NFP       
Sbjct: 918  GIDPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPE------ 971

Query: 1059 RTDLLSGXXXXXXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQKNKLERKTSH 1118
                                    P               G F + +E+++ KLE K   
Sbjct: 972  ---------------------KGKPN------SASSEDSKGFFVSYMEDKRQKLESKLQS 1004

Query: 1119 HIDETIXXXXXXXXXXXNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIK 1170
             +               + HE LAEE++ ++  KN  +   ++K +V   IK
Sbjct: 1005 RLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIK 1056

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  387 bits (994), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 324/1110 (29%), Positives = 536/1110 (48%), Gaps = 129/1110 (11%)

Query: 6    LPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLNEL 65
            +P LLNPL++AVFNC D   SP +K++++L +  FILLVPPT  L  Y D   K  L+EL
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 66   CYHNSDFLGSHILTWSNA-----IXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRG 120
            C H+ +F+ SHILT  +      I             +F   NG      +    ++T  
Sbjct: 61   C-HSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTD 119

Query: 121  NFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKP-ITVSSLIANDSLKCLLPNTRDL 179
             FS     +ILK   L +F +Y  GS  F LI+ID+P I  + L+  + L C  PN    
Sbjct: 120  GFSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCF-PNL--- 175

Query: 180  KSQEKETPLVQDLSQQSKSSFENDLNK------NEAWNLKFGILSNNYKIESSELE---- 229
                  TP  + L+  S +      N       +  +N KF  +  NY+ E ++ E    
Sbjct: 176  --TINTTPSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLI 233

Query: 230  PNHKLFRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMN 289
            P    FR+ +++ +  +D+   F      T   + QL  +Y+E+++YD++W    ++++N
Sbjct: 234  PG---FRKTIDKIYDGLDNS--FH-----TIPTIRQLIQEYVEQNVYDDVW----QVLIN 279

Query: 290  SVKNYADDQKAQH-----LIKHFSIVEIDPNFYDI----FPLKFVPMLEKNLKHSVTCIN 340
              +N A+ +K +      + +  S+ ++D +FY      F LK +  LEKN+  +     
Sbjct: 280  --RNNAEGEKEKQSESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFE 337

Query: 341  KLKSTKSYTEKSTILIESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNI 400
             L  T +Y EK  +L+E+LQI++           K   GY                    
Sbjct: 338  NLSVTHTYVEKCRVLVETLQILSKPV--------KRVGGYQVPITADTLVSLFILLIKRT 389

Query: 401  TLHDLKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENV-IDWDRLK--EKSDLI 457
             + +++ +LYYL+ F  DE+S  FG+L Y I+T   V   LE +  D +RL   EK+D  
Sbjct: 390  KMKNIRCHLYYLQNFHQDENSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDAN 449

Query: 458  EELIMTDDLSTLSSTFENDKKTL------LMYRNSNGESLLALSIINKQNKKFTQYLIE- 510
             E  +T  L T S    N+   L        YRN +G S L+L IIN +N  F + L E 
Sbjct: 450  LEEFLT--LLTRSKCVSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSEN 507

Query: 511  YEDILNMDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDI 570
            YE     + +  DQ+ + +TLL+Q+++ +N E    L  ++ +N   ++EL  Y  + D 
Sbjct: 508  YESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEITEYLTDIMLKN-STEEELYYYCGKRDK 566

Query: 571  HNRNIGHYLVINLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAI 630
            + RNIGHY+    T+L+ IG++I W  KD  G+TPL  IFRSYDQ+ YD +V   F IA+
Sbjct: 567  YKRNIGHYICGQQTLLQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAV 626

Query: 631  KWYA-ANNLKFQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLM 689
            +WY+   N KF   DH DS GN+LLHI++ NIS LL     Q+  +++NK+N +G +PL 
Sbjct: 627  EWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNISFLL-----QSPDVDINKVNSQGLSPLT 681

Query: 690  MYFKYKRYDNIRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKI 749
                Y R +N+  ++K+ +LIF+ F   +F+  +  +  + I++    + L N   F  I
Sbjct: 682  NNAMYDRGENVEALLKDPRLIFSSF---DFLKQYPNTKSAPILS---HYCLDNEAPFRNI 735

Query: 750  IVLSLKKQMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFL 809
            I      ++S   S+     +  +   ++A +   ++  +  +L    +++ +++  +F 
Sbjct: 736  IASHFDFRISNKRSV-----VLTSRSKEDAQELIGSEAFELKNLKALFRLLLKQHPFTFF 790

Query: 810  PLDTLLNESQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFD---DST 866
            PL+ LL+E  S ++K + + + +++    +  K+     LK+L  CLD ++  +    + 
Sbjct: 791  PLEELLDE-LSVVEKTASSRSLMKS---SFCSKV-----LKKLTYCLDSMVEMELLPTAA 841

Query: 867  IATPXXXXXXXXXXXXXXXXXKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFL 926
            + +                  KL+R S                K K+++PE+I  I  FL
Sbjct: 842  LQSVALLERHIAKEKVTVDEEKLKRRS----------------KDKKMQPESIGTITTFL 885

Query: 927  KFNLNELNTISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNV 986
            K+ L  L  +   +  L K  I   LK+ DI +++     L   +++K++   + + ++ 
Sbjct: 886  KYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVSSKKIGRAMVR-YST 944

Query: 987  IDSSRYDDDKGVLLESLHEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNK-- 1044
            ID+    +    LL      I FF  C   +I+ +++      P WWK YG+LLEL+K  
Sbjct: 945  IDNKFLGEQSFDLLVF---QIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKED 1001

Query: 1045 -------YYHKNFPNCV--VHARRTDLLSG 1065
                     HK  PN    V    TD  SG
Sbjct: 1002 PSVLARESDHKQTPNASNNVGTSTTDHTSG 1031

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  374 bits (960), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 309/1067 (28%), Positives = 512/1067 (47%), Gaps = 88/1067 (8%)

Query: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63
            Y +P L NPL+NAVFNCPDP  SPFKKL+  L+++ F+LLVP    LL Y DS   +S  
Sbjct: 3    YFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFR 62

Query: 64   ELCYHNSDFLGSHILTW--SNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRGN 121
            ELCY   DF+ +HIL    +++                 +LNG + +++ +   I  +G 
Sbjct: 63   ELCY-TYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLR-QSLCIPIKGY 120

Query: 122  FSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLK- 180
            FS  ++ ++     LTNFNDY HGS  F ++ ID P+ VS     D LK     +R+L  
Sbjct: 121  FSK-RKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGF-EESRELPF 178

Query: 181  -SQEKETPLVQDLSQQSKSS---FENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFR 236
             SQ+K+ P +   ++++K+    F     + + W ++       Y+          +LF 
Sbjct: 179  HSQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFH 238

Query: 237  ELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYAD 296
            ++VN  +  +  ++ FQ+  N     L+ + ++Y+E  LY +IW+++ +   + + ++  
Sbjct: 239  DIVNMIYNTLKEEQRFQRFTN-----LYDIAYEYIESLLYQDIWNKLQEHYRDKILDF-- 291

Query: 297  DQKAQHLIKHFSIVEIDPNFYDI----FPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKS 352
                  L+   S+  +D  FY+     F L  +  +E  +  +V+    +KS  SY++K 
Sbjct: 292  -----RLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKV 346

Query: 353  TILIESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANLYYL 412
             ++ ++L IIT  N+  +++   N                         + D+  ++ YL
Sbjct: 347  DVIFKTLNIITGKNS--DDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYL 404

Query: 413  KYFSTDESSSSFGILNYTIAT-------FHMVSHVLENVIDWDRLKEKSD-LIEELIMTD 464
            + F  DE++  FG L YT++T       F+ +S+  E+ I   +L    D LI+     D
Sbjct: 405  QSFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHD 464

Query: 465  DLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQ 524
            DL  +     N  K    YR   GES+L+L I NK+N+   + L+ +EDI  +D +  D 
Sbjct: 465  DLIPI-----NQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDT 519

Query: 525  SMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLT 584
             +  STLL++ ++  N EAA IL+++ FQN     EL++Y N+ D   R + HY+   + 
Sbjct: 520  DVSGSTLLIKCLKERNLEAAEILIEI-FQNSCTNSELLNYYNKTDKTKRTLAHYITDEIE 578

Query: 585  ILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMND 644
            IL+ IG++INW  KD+ GRT LFTIFRSYDQ+ Y   +      A+ WY  N++ F+++D
Sbjct: 579  ILEKIGKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSD 638

Query: 645  HDDSNGNSLLHILQNNISILLDYAK-DQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMI 703
            H D  G+SLLHIL++ +S+LL +   D NIP      N KG TPLM Y KY R DNI+ I
Sbjct: 639  HTDLFGDSLLHILKSQVSLLLKFEDLDINIP------NLKGMTPLMTYVKYNRIDNIKTI 692

Query: 704  IKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPS 763
            +++ +LI  K Q   +++C DY  + ++ N +    LS   +F    +   + + S    
Sbjct: 693  LEDGRLIIKKLQKDKYLNCLDYGKNFTVFNLLAA-KLSKDVIFENAYISYARYEKS---- 747

Query: 764  LPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLD 823
                 +    I + + D    T  +K       +  M++ Y   F+P   +L+     L 
Sbjct: 748  -----HWYLCISVQKDDLEYTTNIIKLKKYYNLINAMQKIYKSDFIPYSDMLD----CLK 798

Query: 824  KKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXXXXXXXXXXXX 883
            K  + +N    +P+R   +L+I+ +L  L+  L  LL+F+     T              
Sbjct: 799  KIIEGHN---ILPIR---RLKIKNYLNFLSHGLSALLYFEKIDPLT-----LLDENLIIK 847

Query: 884  XXXXKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVL 943
                KL++   +    S           K L  E+IN I+ F  F+  E+   +  ++  
Sbjct: 848  WISSKLQQQEKSIDDHSSF---------KPLSAEDINNIKAFCDFSFQEIGKTNNVIQSF 898

Query: 944  SKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESL 1003
             KL IF  +K  D++ +      L    +N E    I ++   + S        ++   L
Sbjct: 899  LKLSIFGEIKNTDLNTSYDILERLGSYFSNNE----ISRTLGDLQSISPHVHSSMVYYEL 954

Query: 1004 HEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNF 1050
             +DI F  +CTL L   + +        W K   +LLE  K Y   F
Sbjct: 955  SQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKF 1001

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  364 bits (935), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 256/776 (32%), Positives = 398/776 (51%), Gaps = 94/776 (12%)

Query: 405  LKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVLE-------NVIDWDRLKEKS-DL 456
            LK++LYYL+ FS + SS+ FGIL Y ++T   V    E       NV   + L EK+ +L
Sbjct: 38   LKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNL 97

Query: 457  IEELIM---TDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYED 513
            +++L     T+++  L++      K +L YRN  G+S+L++ I N +N      L EYE+
Sbjct: 98   LDKLSCENPTNEVEDLATY-----KDILTYRNEQGQSILSICITNHKNYILLDILSEYEN 152

Query: 514  ILNMDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNR 573
               ++ +  D+++D STLL+++I++ N EAA +L+K++  NC  ++EL+SYIN+ D + R
Sbjct: 153  DFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNC-TEEELVSYINKTDKYAR 211

Query: 574  NIGHYLVINLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWY 633
             + HYL   + ILK IG +I+WK+K+ +G+TPLF+IFRSYDQ NY+E+V   F IA  WY
Sbjct: 212  TVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQPNYEEMVKTAFDIANTWY 271

Query: 634  AANNLKFQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFK 693
              +N  F   DH D+ GNSLLH+L+ NI ILL   K     +++N+ N KG TPLM+Y K
Sbjct: 272  RKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTK-----LDINEENYKGLTPLMVYVK 326

Query: 694  YKRYDNIRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLS 753
            YKR  NI  I K+ +LI  K Q+  F  CFDY+ D S+++ IGE  + +  LFG I   S
Sbjct: 327  YKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVKDS-LFGLIYFHS 385

Query: 754  LKKQMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDT 813
            L+       +       N T  +  A+K   T  +   ++   L+ + +    +FLPL+T
Sbjct: 386  LRYHNLNATT-------NITS-VSNAEKPFATTVINMKTIQGLLRSILKDNPFTFLPLNT 437

Query: 814  LLNESQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXX 873
                   ++D+ S  N +  TI    I K  +   L +L  C +VLL         P   
Sbjct: 438  -------YIDEISHLNRSDLTI----IGKTDVTSLLHQLTNCFNVLLFLK----KIPENL 482

Query: 874  XXXXXXXXXXXXXXKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNEL 933
                            +R+   PS         G++  K ++PE IN+IQ+FL+FN +E+
Sbjct: 483  FTDEASILYWMRINTSKRNQ-KPS---------GKENPKTMEPEEINMIQSFLRFNFDEI 532

Query: 934  NTISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYD 993
            ++   +L +L K++IF+NLK+ D  DA    N + + L N E  S  +    +I  + ++
Sbjct: 533  SSFKASLNILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFK---GII--TNHN 587

Query: 994  DDKGVLLESLHEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPNC 1053
                + L +L E++ F  +CT++L   V+       PNWWK YGE L L+K Y K FPN 
Sbjct: 588  MFSELSLAALLENVRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNM 647

Query: 1054 VVHARRTDLLSGXXXXXXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIENQKNKLE 1113
            V     +D  S                 +P                     IE ++ + E
Sbjct: 648  VKPKSASDTSS----------------RAP-----------------LGGFIETKREQSE 674

Query: 1114 RKTSHHIDETIXXXXXXXXXXXNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDI 1169
            ++ +  I  +              HE LAEEL+ YMEF+     +  +  F   +I
Sbjct: 675  QRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAFATTNI 730

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  370 bits (949), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 333/1189 (28%), Positives = 551/1189 (46%), Gaps = 162/1189 (13%)

Query: 16   AVFNCPDPSHSPFKKLFTTL-KNQQFILLVPPTSTLLNYTDSYYKLSLNELCYHNSDFLG 74
            A+ NC +P+ SP KKL+T L K  ++++LVPPT  LL Y+D      L++LCY   +F  
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCY-TPNFAS 77

Query: 75   SHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFI---------IKWKHNIIFTRGNFSND 125
            +HIL                  +  +      FI         I WK+ +I+      + 
Sbjct: 78   AHILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQ 137

Query: 126  --QRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLL---------P 174
               R KIL I  +  FN+Y   +     I     + +  +  N +L+C L         P
Sbjct: 138  IKNRAKILDIESIPIFNNYMKTTDNTITI-----MYIDDVFLNGTLECNLRSDIDLLRSP 192

Query: 175  NTRDLKSQEKETPLVQDLS----QQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEP 230
            + R + + ++ + + +  +     +SK++F++ L  N+ W+ KF      +++ +++ + 
Sbjct: 193  SMRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDL 252

Query: 231  NHKLFRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNS 290
               +F  ++ E   E+ S   F   KN     L  + ++Y+E +L+D+IW    KM++  
Sbjct: 253  PIDVFHNIIEEMHEEMVSDNLF---KNIV--DLRNIIYEYVELNLFDDIW----KMILRM 303

Query: 291  VKNYADDQKAQHLIKHFSIVEIDPNF----YDIFPLKFVPMLEKNLKHSVTCINKLKSTK 346
             K    D        + SI ++D  F    Y  F L+ V   E+N+K +   + K++S  
Sbjct: 304  NKEVEIDLNP---FGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESAS 360

Query: 347  SYTEKSTILIESLQIIT-DSNTGGEESK--DKNKSGYXXXXXXXXXXXXXXXXQSNITLH 403
            +Y  K+ ILI +L+ +T +    G  SK  D N S +                     + 
Sbjct: 361  NYKSKANILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIK 420

Query: 404  DLKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEELIMT 463
            +LK +L YL+ F  ++S + FGIL Y ++T   V      V  +++LKEK +  + +   
Sbjct: 421  NLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAV------VCYFEQLKEKENYRKLIDFC 474

Query: 464  DD----LSTLSST----------FENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLI 509
            +     +  LSST          F    +  L YR+S G+SLLAL II+ +N      L 
Sbjct: 475  NSNERLVKVLSSTKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILN 534

Query: 510  EYEDILNMDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVD 569
            EYE +  ++ +  D+S+D STLL+QA++ +N  +A +L+ +L  NC  + ELI+YIN+ D
Sbjct: 535  EYETLFPIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNC-TEIELIAYINRHD 593

Query: 570  IHNRNIGHYLVINLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIA 629
            I+ R  GH+L   L +LK++G++INW QKD  G+TPLFTIFRSYDQ NYDE+V Q  + A
Sbjct: 594  INKRTAGHFLTNELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYA 653

Query: 630  IKWYAANNLKFQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLM 689
              WY  N   F   DH D  GN+LLHIL+ N+ ILL    D++  IN+N  N  G TPLM
Sbjct: 654  TNWYGLNGKNFNYLDHVDKKGNTLLHILKCNLPILL---ADKH--INVNATNRSGQTPLM 708

Query: 690  MYFKYKRYDNIRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKI 749
               +YKR +NIR ++ + +L  +  Q  N +  FD+S D  I + +GE  L N      +
Sbjct: 709  TSIRYKRTENIRDLLCDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLA-V 767

Query: 750  IVLSLKKQMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFL 809
               +LK   S          ++ T+ + +A K+T        +L   L+++ +     FL
Sbjct: 768  YAHTLKYTNSR-------WNLSLTVKLKDAPKTT---NFTLKTLRGILRVVIKNNMTVFL 817

Query: 810  PLDTLLNESQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIAT 869
            P+  L+ +  SF        N +R   L  I+ L +  F   ++ CL  L+H        
Sbjct: 818  PVQELVEDLISF--------NRIRFSELMRIKVLEMLPF---ISFCLSALVHI------- 859

Query: 870  PXXXXXXXXXXXXXXXXXKLRRSSTTPSAKSKLENAMGEK--KKKELKPENINIIQNFLK 927
                               + ++        K+  ++ +K  +  ++ PE+I++IQNFLK
Sbjct: 860  -------------KVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQNFLK 906

Query: 928  FNLNELNTISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVI 987
            FN+ E+      L++  KL +F  LK+ D+ ++   +  +V  L++K   S ++ S    
Sbjct: 907  FNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDT 966

Query: 988  DSSRYDDDKGVLLESLHEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYH 1047
                   +K +L       I++   C  KL + + +       NWW +YGELL  +K+Y 
Sbjct: 967  KLLSVRAEKALL-----SKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYT 1021

Query: 1048 KNFPNCV-VHARRTDLLSGXXXXXXXXXXXXXXXXSPQRLXXXXXXXXXXXXGVFANLIE 1106
            + FP    V     DL                   +P+R+                    
Sbjct: 1022 RAFPELANVTTENRDL------------ALHRMISNPKRI-------------------- 1049

Query: 1107 NQKNKLERKTSHHIDETIXXXXXXXXXXXNKHEHLAEELNRYMEFKNRF 1155
                KLE + S  I +               HE  AEE++R+++ K +F
Sbjct: 1050 ----KLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKF 1094

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  318 bits (816), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 331/1138 (29%), Positives = 541/1138 (47%), Gaps = 144/1138 (12%)

Query: 9    LLNPLLNAVFNC--PDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSY-------YK 59
            +LNPL+  +F+    D  + P KKLF  LK  +F+LL PPT  LLNY DS        Y 
Sbjct: 5    ILNPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDSSNITPRNPYN 64

Query: 60   LS----LNELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEE---FDNLNGNKFIIKWK 112
             S    L +LC ++ DF+ SHIL + + +             +      + GN  +   +
Sbjct: 65   GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGALNNGE 124

Query: 113  HNIIFTRGNFSNDQR-FKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKC 171
              +I    N++  ++  KI+K+    NFN Y  G + + + +ID P+   ++I N+ L  
Sbjct: 125  MLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPL-YPNIIKNEFLTA 183

Query: 172  LLPNTRDLKSQEKETPLVQ---DLSQQSK---------SSFENDLNKNEAWNLKFGI--- 216
                 R L   E+ + + Q   DL   +K         S  E D+++++       I   
Sbjct: 184  F---DRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDD 240

Query: 217  ------LSNNYKIESSELEPNHKLFREL------VN-EAFIEIDSKKFFQ----KKKNFT 259
                  L N+Y+  +  +E    L + +      VN E   +I+   F Q    K+ NF 
Sbjct: 241  RVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNFL 300

Query: 260  S-DQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKAQHLIKHFSIVEIDPNFYD 318
            S D L +L ++++E  L+D+IW RI      S  +++        + + S+ ++  NFY 
Sbjct: 301  SHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSK-------LSNISVNKLLLNFYS 353

Query: 319  I-----FPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILIESLQIITDSNTGGEESK 373
                  F L  + M+EK +  +VT   K  +  ++ EKST LI++LQI+T +     ++ 
Sbjct: 354  TNNFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILTINKLTDADT- 412

Query: 374  DKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANLYYLKYFSTDESSSSFGILNYTIAT 433
                                      + + +LK++L+YL+ F+ D ++  FGIL Y+I+T
Sbjct: 413  ---------------LIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSIST 457

Query: 434  FHMVSHVLENVIDWDRLKEKSDLIEELIMTDDLSTLSSTFENDKKTL----LMYRNSNGE 489
               +++  +++        K+DLI      D L  L  T  N+ K+L    L YR+ NGE
Sbjct: 458  LEAITYYFDHI----SHSHKADLIA---FCDKLHNLYDTILNNIKSLDNDILSYRSQNGE 510

Query: 490  SLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSSTLLLQAIRSNNFEAAIILVK 549
            SLL+L IIN +   F + L  YE    ++ I +D  ++ S+LL+QA + NN+ A+ ILV 
Sbjct: 511  SLLSLCIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVT 570

Query: 550  LLFQNCRNQKELISYINQVDIHNRNIGHYLVI--NLTILKIIGQFINWKQKDVNGRTPLF 607
            +L  +C N++EL  ++N+ D  NR++ HY  +  ++ IL   G  I+W+ KD+   TPL 
Sbjct: 571  ILKNSC-NEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLL 629

Query: 608  TIFRSYDQSNYDELVCQV-FQIAIKWYAANNLKFQMNDHDDSNGNSLLHILQNNISILLD 666
            TIF+ + + NY+E   ++ F++ + WY  +N  F +  H D NGN+LLH++++ I+ L++
Sbjct: 630  TIFKVH-KVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIE 688

Query: 667  YAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKLIFNKFQSPNFIDCFDYS 726
               +    IN+N  N KG +P M+YFK  RYDNIR+I+K   LI ++ Q P  I      
Sbjct: 689  -NPELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLI------ 741

Query: 727  VDSSIMNDIGEFLLSNGQL----FGKIIVLSLK--KQMSTVPSLPRGLYINYTILIDEAD 780
              +++ N     LL+   L    F  I + SL+     S+         ++ +IL  E++
Sbjct: 742  TSTNLYNSKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESE 801

Query: 781  KST------LTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNN---- 830
              T       TKT+K  ++   L    RKY  S LPL + L     F +   K+NN    
Sbjct: 802  FPTSHPSICRTKTLKLKTIKSLLHHFIRKYKYSSLPLKSAL----EFCNDLIKSNNSISW 857

Query: 831  --NLRTIPLR-YIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPXXXXXXXXXXXXXXXXX 887
              N   +PL   I+KL I+  LK ++ CL+ L  F  +                      
Sbjct: 858  TSNRHFLPLSLLIDKLEIQYNLKLISNCLNFL--FITTDFDFTLLFDELKLQAFLKINNK 915

Query: 888  KLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKLV 947
            KL+ S+++     K  +    +  K  +PE+IN IQ F+KFNL EL      +  +  + 
Sbjct: 916  KLKESNSSNKFSHKNNSDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVS 975

Query: 948  IFMNLKTLDIHDAQIRF--NGLVKGLNN---------KEVPSIIEK--SFNVIDSSRYDD 994
            I +  K +D++ +Q  F  N L  G+NN          + P I     S    D + Y D
Sbjct: 976  ILIKYKIMDLNSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSY-D 1034

Query: 995  DKGVLLESLHEDISFFNECTLKLIHDVENXXXXXXPNWWKLYGELLELNKYYHKNFPN 1052
             K   L  L E++ FF +   KL +D E+        WW  YG LL+    Y+K++PN
Sbjct: 1035 YKVEFLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPN 1092

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
           similarities with uniprot|Q04257 Saccharomyces
           cerevisiae YML002W and some similarities with
           uniprot|Q04257 Saccharomyces cerevisiae YML003W
           Hypothetical ORF
          Length = 1067

 Score =  297 bits (761), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 240/838 (28%), Positives = 412/838 (49%), Gaps = 92/838 (10%)

Query: 4   YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63
           YHLP LLNPLLNA+FNCP P  S  K++F+ L +++F +LVP T TLL + D    L L 
Sbjct: 3   YHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELA 62

Query: 64  ELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRGNFS 123
           ELCYH  DF+ SHI+   +              + F  LNG K  I+++++ I T   F+
Sbjct: 63  ELCYH-YDFVASHIVVIKDPTKDVPDQRSIYNTD-FTTLNGRKLSIRYRNSTIVTGDGFT 120

Query: 124 NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183
             ++  I +I+ L  FNDY  GS    ++ I  P+    L+  D L+       +  S++
Sbjct: 121 ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPL-CGDLVPLDELQVFSKVAGNKYSKQ 179

Query: 184 KETPLVQDLSQQSKSSFENDLNK----NEAWNLKFGILSNNYKIESSELEPNHKLF--RE 237
           ++ PL  D  Q+    FE  +       E   L F +     K   S +    +    R+
Sbjct: 180 EQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRD 239

Query: 238 LVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADD 297
            + +  I +D      K+ N   D L  + +DY+E  L+ +I  ++ +++ +    +  D
Sbjct: 240 SIRQ-IISLD------KRLNHLED-LDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFD 291

Query: 298 QKAQHLIKHFSIVEIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKST 353
            KA   ++  S+ ++  NFY      F L  V  LEK++  ++  +  +    +++ K  
Sbjct: 292 FKA---LRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLE 348

Query: 354 ILIESLQIITDSNTGGEESKDKNKSGYXXXXXXXXXXXXXXXXQSNITLHDLKANLYYLK 413
           +L  ++++++    G     D   S +                +S +T   L   L YL 
Sbjct: 349 VLSTTMRLLSREINGISTDADTLLSLFVLLIC-----------RSQVT--GLVRTLTYLT 395

Query: 414 YFSTDESSSSFGILNYTIATFHM-VSHVLENVID------------WDRLKEKSDLIEEL 460
            F   E+S  FG+  Y ++TF   +S   ++ +D            W  +++ S +  EL
Sbjct: 396 NFEISETSIKFGLQGYVLSTFEAALSFFHQDTVDSLTKKCASNKKIWASIQKHSKVEAEL 455

Query: 461 IMTDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDII 520
           + ++                L  R  +GESLL++ I +  N+  T  L  +E    ++ I
Sbjct: 456 LSSN----------------LRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDI 499

Query: 521 SNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLV 580
            +D+    STLL+QA++  N +AA IL +++ ++C  + E+ SY+N  ++HNR   HY++
Sbjct: 500 LDDRDFALSTLLIQALQVQNSQAAAILSEIILKSC-TESEVRSYLNSPNLHNRITAHYIM 558

Query: 581 INLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKF 640
            ++++L+ +G++ NW+ KD+NG TPLF +FRSYD  NYDE+V +V    +KWYA NN  F
Sbjct: 559 QDISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPF 618

Query: 641 QMNDHDDSNGNSLLHILQNNISILLDYAKDQNIP-INLNKMNCKGFTPLMMYFKYKRYDN 699
               H+D  GN+LLH++++ I  LL       +P +N+NK + KG TPLM+Y +Y R  N
Sbjct: 619 NFKIHEDPKGNTLLHVMKSGIESLL------KLPDVNVNKPDSKGLTPLMIYSRYNRITN 672

Query: 700 IRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMS 759
           I  I+K+E+L+ +  Q P  +   D++ +  +   I +   +   +   I  L  +++  
Sbjct: 673 IETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTILDATFNREPVV--IHSLRFEERKW 730

Query: 760 TVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNE 817
            +     G++  Y++ +                 +++LKIM   Y  SF P+  L NE
Sbjct: 731 KIGIFSEGIFKKYSLDL-------------IQYYLRYLKIM---YPCSFHPVQLLTNE 772

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 105/259 (40%), Gaps = 46/259 (17%)

Query: 913  ELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLN 972
            +L+PE IN IQ FLK+NL E   +   L +L KL I   +K  D+   +  F  L   ++
Sbjct: 837  KLEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMS 896

Query: 973  NKEVPSIIEKSF-NVIDSSRYDDDKGVLLESLHEDISFFNECTLKLIHDVENXXXXXXPN 1031
             K V     KSF N   +  YD    +       ++ +     + L+++ E+        
Sbjct: 897  QKGVA----KSFENTNCAWSYD----LSYYEFTRNLEYLEHSVVTLLNNFESLLAKTTL- 947

Query: 1032 WWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGXXXXXXXXXXXXXXXXSPQRLXXXXX 1091
            WWK +GEL+EL K + KNFPN                             +P        
Sbjct: 948  WWKHFGELMELKKEWKKNFPN---------------------------DKAPP------- 973

Query: 1092 XXXXXXXGVFANLIENQKNKLERKTSHHIDETIXXXXXXXXXXXNKHEHLAEELNRYMEF 1151
                         IE +++K   K S+ +  +              HE +A  +N ++EF
Sbjct: 974  --SSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEF 1031

Query: 1152 KNRFFGRNIMKNFVGEDIK 1170
            K +F+  +I+K+ V + I+
Sbjct: 1032 KEQFYHDHIVKSIVDQRIR 1050

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  204 bits (519), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 116/283 (40%), Positives = 168/283 (59%), Gaps = 11/283 (3%)

Query: 1   MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKL 60
           MS YHLPTLLNPL+NA+FNCP+P  SP KKLF  LK ++FILL PP+  LLNY D   KL
Sbjct: 1   MSVYHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKL 60

Query: 61  SLNELCYHNSDFLGSHILTWSNAIXXXXXXXXXXXXEEFDNLNGNKFIIKWKHNIIFTRG 120
            L++LCY N++F+ S+IL  +                 ++ L+G   +I+WK+N+I    
Sbjct: 61  PLHDLCY-NAEFINSYILLMTE----NSYINTNSRDSHYETLDGKTVVIQWKNNVIHALN 115

Query: 121 NFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLK 180
            F   +R KIL+   L NFNDYF G+ +F ++FID+P+     + ND L+C     +  K
Sbjct: 116 GFHIRRRLKILETKILPNFNDYFEGAADFIILFIDQPLNC-EFVPNDYLQCFHNYEKIPK 174

Query: 181 SQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVN 240
           +      L  D  QQ +SSFEN L+ + A   + G L ++Y+  +   +P+  +F  +V 
Sbjct: 175 NAHAMPNLSIDSFQQERSSFENILHIHPARLTQLGQLFSSYRTLAPGDDPSRSIFESIVQ 234

Query: 241 EAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRI 283
           +AF  + S   F   KNF++  L+ L HDY E +LYD+IWSR+
Sbjct: 235 QAFDGMKSDSLF---KNFSN--LYDLIHDYFELNLYDDIWSRL 272

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  197 bits (501), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 227/801 (28%), Positives = 362/801 (45%), Gaps = 138/801 (17%)

Query: 272  ERHLYDEIWSRIWKMMMNSVKNYADDQKAQHLIK-HFSIVEIDPNFY-----DIFPLKFV 325
            E  LY  IW+++       V   ++ Q        + S  E++ N Y     + F L+ V
Sbjct: 179  EARLYSSIWNKL-------VHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDV 231

Query: 326  PMLEKNLKHSVTCINKLKSTKSYTEKSTILIESLQIITDSNTGGEESKDKNKSGYXXXXX 385
              +E  +  +     KL+ + S+ EK  IL+ +  I+T      E   D           
Sbjct: 232  VFIENVVDLACKEFVKLRESLSFDEKIDILLSTFNILTSKLPQLEIDADN---------- 281

Query: 386  XXXXXXXXXXXQSNITLHDLKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVI 445
                        + + L++L  + +YL+ F+  ++   FGILNY I+T   V + ++N  
Sbjct: 282  ---LLNFMLIIINRVKLNNLNEHFHYLQNFNFKQNKD-FGILNYAISTLGAVLYYIDN-- 335

Query: 446  DWDRLKEKSDLIEELIMTDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFT 505
            + D+ K  +D I++           S    +K   L YRN NGES L   II K N    
Sbjct: 336  NLDKFKRYTDAIQD-----------SKISEEK---LKYRNENGESYLCHCIITKDNDTLR 381

Query: 506  QYLIEYEDILN--MDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELIS 563
            + L   E I N  M+ I +DQ++D STLL+ A++  N  AA IL+ ++  N     E+ +
Sbjct: 382  ELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNG-TPDEIRT 440

Query: 564  YINQVDIHNRNIGHYLVINLTILKIIGQFINWKQKD-VNGRTPLFTIFRSYDQS--NYDE 620
            Y+N VD +NRN+GH++     +L  IG ++NW  KD   G+TPLF IFRSYDQS  +Y +
Sbjct: 441  YVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKK 500

Query: 621  LVCQVFQIAIKWYAANNLKFQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKM 680
            +  + F+     +A ++  FQ+  H D++ N+LLHIL+ NI ++L +A      + +N  
Sbjct: 501  MSRRSFR-----FAMDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHA-----SLFINSP 550

Query: 681  NCKGFTPLMMYFKYKRYDNIRMII----KEEKLIFNKFQSPN-FIDCFDYSVDSSIMNDI 735
            N  G TPLM++ KY+R  NI++++    K+   IF   Q  N + +CF  + D  I+N +
Sbjct: 551  NSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLL 610

Query: 736  GEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVK 795
            G+F + N  +FG     SLK+ +       +  Y     L  E    T+   +K    + 
Sbjct: 611  GKFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALI 670

Query: 796  FLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTC 855
             + +    +  SFLPL  + NE              L  I      K +I  F+  LN  
Sbjct: 671  NMVLTSNSHVSSFLPLYKVFNE--------------LNGIASMISTKSKI-LFINNLNVI 715

Query: 856  LDVLLHFDDSTIATPXXXXXXXXXXXXXXXXXKLRRSSTTPSAKSKLENAMGEKKKKELK 915
            LD +L  +   +                    K++  +T               K K+L+
Sbjct: 716  LDTILFLE---LVPREGFILEARLKDYLRNQRKIKTVAT---------------KSKKLQ 757

Query: 916  PENINIIQNFLKFNLNELNTI------------SMNLKVLSKLVIFMNLKTLDIHDAQIR 963
             E+IN+I NFLKFNLNELN              S+NLK+  + + +M+L  L   D  + 
Sbjct: 758  IEDINMISNFLKFNLNELNAFKNGVKKILRQMNSINLKLFDQRISYMDL--LHCPDVVVH 815

Query: 964  FNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISFFNECTLKLIHDVEN 1023
             N  +  LN     +I+  +F ++++S        +  +LH    F NE   K       
Sbjct: 816  LNNPLWNLN----YNILISNFQILENS--------IDNTLHFLKVFQNEKIRK------- 856

Query: 1024 XXXXXXPNWWKLYGELLELNK 1044
                    WWKL  EL+ L K
Sbjct: 857  --------WWKLNNELINLTK 869

>KLLA0C01155g Chr3 (88084..89529) [1446 bp, 481 aa] {ON} similar to
           uniprot|P17709 Saccharomyces cerevisiae YCL040W GLK1
           Glucokinase catalyzes the phosphorylation of glucose at
           C6 in the first irreversible step of glucose metabolism
           one of three glucose phosphorylating enzymes expression
           regulated by non-fermentable carbon sources
          Length = 481

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 52/125 (41%), Gaps = 22/125 (17%)

Query: 170 KCLLPNTRDLKSQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELE 229
           K L P   D+ SQ K  P++        S  E+ +       L   +   N+++ S EL 
Sbjct: 37  KGLEPCESDI-SQNKGLPMIPTFVTDKPSGQEHGVTM-----LAADLGGTNFRVCSVELL 90

Query: 230 PNHKLFRELVNEAFIEIDSKK----FFQKKKNFTSDQLFQ----LTHDYMERHLYDEIWS 281
            NH        E  IE +  K    FFQ   + TS  LFQ    +TH ++ +H  D I  
Sbjct: 91  GNH--------EFKIEQEKSKIPTFFFQDDHHVTSKDLFQHMALITHQFLTKHHKDVIQD 142

Query: 282 RIWKM 286
             WKM
Sbjct: 143 YKWKM 147

>YJL176C Chr10 complement(92053..94530) [2478 bp, 825 aa] {ON}
           SWI3Subunit of the SWI/SNF chromatin remodeling complex,
           which regulates transcription by remodeling chromosomes;
           required for transcription of many genes, including
           ADH1, ADH2, GAL1, HO, INO1 and SUC2
          Length = 825

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 44/99 (44%), Gaps = 6/99 (6%)

Query: 742 NGQLFGKIIVLSLKKQMSTVPSLPRGLYI--NYTILIDEADKSTLTKTMKFT----SLVK 795
           + +L  K I   L  Q ST    PRGL+   +Y   +   D + L K M  +    +L K
Sbjct: 396 DSKLLPKNIEPPLTSQYSTRHDAPRGLFPFESYKPSVQLPDMAKLKKMMNTSDSESTLYK 455

Query: 796 FLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNLRT 834
           +LK  KRKY     P  T  +E+    D   K NN + T
Sbjct: 456 YLKESKRKYDEITHPPSTTDDENGDKNDNGGKMNNEVST 494

>AER102W Chr5 (828188..833896) [5709 bp, 1902 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR422W
          Length = 1902

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 762 PSLPRGLYINYTILIDEADKSTLT-KTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQS 820
           P L R L +NY +L+ E DKS+   K   F SL++FL         S +  +T  N+   
Sbjct: 766 PILVRLLELNYAVLVAEKDKSSANFKDTTFFSLIQFLD-------KSIIRQETYRNKFND 818

Query: 821 FLDKKSKNNNNLRTI 835
           F+D+ S  N+NL  +
Sbjct: 819 FIDRFSGENSNLPPV 833

>TPHA0K00750 Chr11 (155270..157843) [2574 bp, 857 aa] {ON} Anc_7.409
           YER111C
          Length = 857

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 18/79 (22%)

Query: 598 KDVNGRTPL-----FTIFRSYDQSNYDELVCQVFQIAIKWYAANN------LKFQMNDHD 646
           +D NGR PL      T+ ++ DQS    ++     + +++  +N+      LK  +N H 
Sbjct: 421 QDKNGRLPLHYLIELTVNKTKDQS----IITHYIDLILEYLQSNDNDDISILKLTVN-HQ 475

Query: 647 DSNGNSLLHI--LQNNISI 663
           DS GN++LHI  L NN+ I
Sbjct: 476 DSYGNTILHIAALNNNLKI 494

>NCAS0B01000 Chr2 complement(156442..159897) [3456 bp, 1151 aa] {ON}
           Anc_8.813
          Length = 1151

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 18/86 (20%)

Query: 171 CLLPNTRDLKSQEKET---------PLVQDLSQ--------QSKSSFENDLNKNEAWNL- 212
            LLP+   L + +  T         P+V+D  Q        +S S  E+D + N+ +N+ 
Sbjct: 322 ALLPDESRLSTSQTNTSRTHGDTLSPVVRDNLQKDSASKEDESYSDLEDDSSSNKKYNVP 381

Query: 213 KFGILSNNYKIESSELEPNHKLFREL 238
           +FG  S+N K+++  +  +H+LFR L
Sbjct: 382 QFGGFSDNAKLKAQLMRNSHELFRHL 407

>KNAG0C04200 Chr3 complement(820365..823352) [2988 bp, 995 aa] {ON}
           Anc_7.272 YIL073C
          Length = 995

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 296 DDQKAQHLIKHFSIVEIDPNFYDIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTIL 355
           D    + L+K  S V+I PNF  +       ++E N+K   TC++ + S K   EK   +
Sbjct: 354 DQSIEEVLMKMISSVDIAPNFAQVLECA-KELVEVNIKMGATCLDYILSNKLEPEKDKSI 412

Query: 356 IESLQ-----IITDSNT 367
           +E L      IIT S T
Sbjct: 413 LEKLIVARFFIITQSKT 429

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 129,739,482
Number of extensions: 6100828
Number of successful extensions: 23553
Number of sequences better than 10.0: 98
Number of HSP's gapped: 24294
Number of HSP's successfully gapped: 120
Length of query: 1193
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1072
Effective length of database: 39,606,813
Effective search space: 42458503536
Effective search space used: 42458503536
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)