Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0D007906.19ON40140117560.0
NCAS0H008106.19ON32335711731e-161
Kpol_1037.246.19ON3663599451e-125
KNAG0M011506.19ON3073289041e-120
KLLA0D01111g6.19ON3143078991e-119
Suva_15.1816.19ON3362898961e-118
Smik_15.1756.19ON3122618921e-118
TPHA0J003206.19ON3423568941e-118
YOR006C (TSR3)6.19ON3132618831e-117
SAKL0E01144g6.19ON4302618881e-116
TDEL0G045006.19ON3013078681e-115
Skud_15.1676.19ON3123078661e-114
CAGL0E02717g6.19ON3253068601e-113
ZYRO0C07832g6.19ON2812648401e-111
Ecym_30236.19ON3492658091e-105
ACR007W6.19ON3133167991e-104
KAFR0L003906.19ON3293417891e-102
KLTH0C11264g6.19ON3462597536e-97
Kwal_56.224216.19ON3373057466e-96
TBLA0A072506.19ON3043607192e-92
Suva_2.737singletonON63552713.3
NCAS0H020605.434ON322106677.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0D00790
         (401 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   681   0.0  
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   456   e-161
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   368   e-125
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   352   e-120
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   350   e-119
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   349   e-118
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   348   e-118
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   348   e-118
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   344   e-117
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   346   e-116
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   338   e-115
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   338   e-114
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   335   e-113
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   328   e-111
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   316   e-105
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   312   e-104
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   308   e-102
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   294   6e-97
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   291   6e-96
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   281   2e-92
Suva_2.737 Chr2 (1282028..1283935) [1908 bp, 635 aa] {ON} YOR389...    32   3.3  
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434      30   7.9  

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/401 (84%), Positives = 339/401 (84%)

Query: 1   MMYHHPLRRVIIIDQEIRLSLPNLRQTKTRGDGTEEEHIFITIKMGKGKNKSRDDGPKNP 60
           MMYHHPLRRVIIIDQEIRLSLPNLRQTKTRGDGTEEEHIFITIKMGKGKNKSRDDGPKNP
Sbjct: 1   MMYHHPLRRVIIIDQEIRLSLPNLRQTKTRGDGTEEEHIFITIKMGKGKNKSRDDGPKNP 60

Query: 61  RAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSVKKIPVKLGMWDFDHC 120
           RAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSVKKIPVKLGMWDFDHC
Sbjct: 61  RAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSVKKIPVKLGMWDFDHC 120

Query: 121 DPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADIIKEFGAAVVECSWAR 180
           DPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADIIKEFGAAVVECSWAR
Sbjct: 121 DPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADIIKEFGAAVVECSWAR 180

Query: 181 LDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWASDL 240
           LDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWASDL
Sbjct: 181 LDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWASDL 240

Query: 241 LSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQEATERKLQAQETDIWMM 300
           LSNFSWG             YSKCTDSDSVKAAQEEWLDKIEQEATERKLQAQETDIWMM
Sbjct: 241 LSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQEATERKLQAQETDIWMM 300

Query: 301 GNTNRLDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKELRYDNLGNVIXXXXXXXXX 360
           GNTNRLDANLRSMNIS                  HITRNKELRYDNLGNVI         
Sbjct: 301 GNTNRLDANLRSMNISDEDEEEEEEYDEEEDGGEHITRNKELRYDNLGNVIEDTDEEYLS 360

Query: 361 XXXXXIRYDNLGNXXXXXXXXXXXXXXXXXLRYDSLGNIIE 401
                IRYDNLGN                 LRYDSLGNIIE
Sbjct: 361 EEEKEIRYDNLGNIIESEEEEEEEKEEGIELRYDSLGNIIE 401

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  456 bits (1173), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 235/357 (65%), Positives = 261/357 (73%), Gaps = 35/357 (9%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           MGKGKNK RDDG    R HRGANGHSSRHNHKNMEM+KH +              ++  +
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHEN--------------EDTSN 46

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
           VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSP+DAD
Sbjct: 47  VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDAD 106

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
           IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL
Sbjct: 107 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 166

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAIIGRSDWA+DLLSNFSWG             YS+CTDSDS++ AQE WL+KI++E
Sbjct: 167 AACFAIIGRSDWAADLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEE 226

Query: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKELRY 344
           A ERKLQAQ+ DIW+MGNTNR++ NLR + +S                  ++T  K ++Y
Sbjct: 227 AKERKLQAQDNDIWLMGNTNRVNDNLRDLTLS-----DGDEDEEEEDAEDYLTE-KSVKY 280

Query: 345 DNLGNVIXXXXXXXXXXXXXXIRYDNLGNXXXXXXXXXXXXXXXXXLRYDSLGNIIE 401
           DNLGNVI              +RYDNLGN                  RYD+LGN+IE
Sbjct: 281 DNLGNVI------ESSEDEITLRYDNLGNVIEEEEEEK---------RYDALGNLIE 322

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  368 bits (945), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 194/359 (54%), Positives = 233/359 (64%), Gaps = 32/359 (8%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           M KGKNK  +   +  +  RG+NGHSS+ NHK+MEMKK+    S       DD       
Sbjct: 1   MAKGKNKQHE--ARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQ------DD------- 45

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
             K PVKL MWDFDHCDPKRCSGK+LERLGLIKSL++GQ+FQG+++SPNGK V+ P+D +
Sbjct: 46  --KFPVKLAMWDFDHCDPKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDRE 103

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
           I++EFGA+VVECSWARLDE+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 104 IVEEFGASVVECSWARLDEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEAL 159

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAI+GR DWA++LLSNFSWG             Y +CTDS+SVK A+EEWL KIEQE
Sbjct: 160 AACFAIVGRMDWAAELLSNFSWGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQE 219

Query: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKELRY 344
             ERK QA+E+DIWMMGNTN      R+MN                        NK  RY
Sbjct: 220 IQERKTQARESDIWMMGNTN------RNMNGDDDEEEGNSYEALSGDDYEEENNNKSARY 273

Query: 345 DNLGNVIXXXXXXXXXXXXX---XIRYDNLGNXXXXXXXXXXXXXXXXXLRYDSLGNII 400
           DNLGN+I                 ++YD+LGN                 LRYDSLGN+I
Sbjct: 274 DNLGNIIESEEDYDDYDDEEDRVEVKYDSLGN--IIENSDYEQYEEEKELRYDSLGNLI 330

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  352 bits (904), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 184/328 (56%), Positives = 221/328 (67%), Gaps = 38/328 (11%)

Query: 46  GKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSV 105
           GKGKNKSR D   +  +H+G+NGHSSR NHK ME+++H+    T                
Sbjct: 4   GKGKNKSRGD-ETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGT---------------- 46

Query: 106 KKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADI 165
            K PVK+ MWDFDHCDPKRCSGKKLERLGLI SLK+GQ+FQG+++SPNG+ VV PDD  I
Sbjct: 47  -KFPVKMAMWDFDHCDPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAI 105

Query: 166 IKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALA 225
           ++EFGA+VVECSWARLDE+PF+++    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALA
Sbjct: 106 VEEFGASVVECSWARLDEVPFNRI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALA 161

Query: 226 ACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQEA 285
           ACFAI+GR D ASDLLSNFSWG             Y KCTD +SVK A+E+WL+KIE+EA
Sbjct: 162 ACFAIVGRMDLASDLLSNFSWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEA 221

Query: 286 TERKLQAQETDIWMMGNTNRLDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKELRYD 345
            +RK +A++ DIWMMGN NR   N+  M +S                    T    +RYD
Sbjct: 222 QQRKNEARDGDIWMMGNVNR---NMNKMTLSDEESDEEE------------TEASSIRYD 266

Query: 346 NLGNVIXXXXXXXXXXXXXXIRYDNLGN 373
           NLGN I              IRYDNLGN
Sbjct: 267 NLGNAI-IDESDEEEPEISSIRYDNLGN 293

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  350 bits (899), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 178/307 (57%), Positives = 214/307 (69%), Gaps = 33/307 (10%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           MGKGKNK   +    PR+ +G+NGHSSR NHK MEMK H D T++               
Sbjct: 1   MGKGKNK---ESSTRPRSQKGSNGHSSRLNHKRMEMK-HVDSTTS--------------- 41

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
             K PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV PDD  
Sbjct: 42  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKA 99

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
           +++E GA+VVECSWARLDE+PF+K+    GGKNERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 100 LVEENGASVVECSWARLDEVPFNKI----GGKNERLLPYLVAANQVNYGRPWRLNCVEAL 155

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAI+GR+D A+DLLSNFSWG             Y +CTD DSVKAA+E+WL KIEQE
Sbjct: 156 AACFAIVGRTDLAADLLSNFSWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQE 215

Query: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKELRY 344
           A ERK QA+  DIWM+GN NR   +L   +                     +   ++++Y
Sbjct: 216 AIERKQQAKTEDIWMIGNVNRASRDLPGSSGEEEEEDYLNGDS--------LIDVRDIKY 267

Query: 345 DNLGNVI 351
           D+LGNVI
Sbjct: 268 DSLGNVI 274

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  349 bits (896), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 172/289 (59%), Positives = 207/289 (71%), Gaps = 31/289 (10%)

Query: 19  LSLPNLRQTKTRGDGTEEEHIFITIKMGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNM 78
           L  P L+    R         +   KMGKGKNK+ +  PKN R  RGANGHSSR NHK M
Sbjct: 6   LGTPELKALHCRA-------FYRATKMGKGKNKTHE--PKNGRPQRGANGHSSRQNHKRM 56

Query: 79  EMKKHNDFTSTQMVNDNDDGIDEIHSVKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKS 138
           EMK    + +++M N               PVKL MWDFDHCDPKRCSGKKLERLGLIKS
Sbjct: 57  EMK----YDNSEMTN--------------FPVKLAMWDFDHCDPKRCSGKKLERLGLIKS 98

Query: 139 LKIGQRFQGLIISPNGKKVVSPDDADIIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNE 198
           L++GQ+FQG+++SPNG  VV PDD +++++ GA+VVECSWARL+E+PF+K+    GGK+E
Sbjct: 99  LRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEVPFNKI----GGKHE 154

Query: 199 RLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXX 258
           RLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR DWAS LLS+FSWG           
Sbjct: 155 RLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGLGFLDLNRELL 214

Query: 259 XXYSKCTDSDSVKAAQEEWLDKIEQEATERKLQAQETDIWMMGNTNRLD 307
             Y KCTDS+SVK A+EEWL K+E+E  ERK Q+++ DIWMMGN NR D
Sbjct: 215 EIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKD 263

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  348 bits (892), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 168/261 (64%), Positives = 200/261 (76%), Gaps = 24/261 (9%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           MGKGKNK+ +  PKN R  RGANGHSSR NH+ MEMK  N               D++  
Sbjct: 1   MGKGKNKAHE--PKNGRPQRGANGHSSRQNHRRMEMKYENS--------------DKV-- 42

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
             K PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV PDD +
Sbjct: 43  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLE 100

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
           ++++ GA+VVECSWARL+E+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 101 VVEQHGASVVECSWARLEEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEAL 156

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAI+GR DWAS+LLS+FSWG             Y +CTD+DSVK A+EEWL K+E+E
Sbjct: 157 AACFAIVGRMDWASELLSHFSWGMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKE 216

Query: 285 ATERKLQAQETDIWMMGNTNR 305
             ERK QA+E DIWMMGN NR
Sbjct: 217 TQERKSQAKEEDIWMMGNINR 237

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  348 bits (894), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 227/356 (63%), Gaps = 37/356 (10%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           M KGKNKS +     P   RG+NGH +R NHK MEMK  N  T     N  + G      
Sbjct: 1   MAKGKNKSSETRSGKP--SRGSNGHHTRTNHKRMEMKFSNAGTG---ANSKEAGF----- 50

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
               PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV PDD +
Sbjct: 51  ----PVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKE 106

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
            ++EFGA+VVECSWARLDE+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 107 TVEEFGASVVECSWARLDEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEAL 162

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAI+GR D A++LL +FSWG             Y KCTDS+SVK  +EEWL+KI++E
Sbjct: 163 AACFAIVGRVDLAAELLEHFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKE 222

Query: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKELRY 344
             ERK Q++E DIW+ GNTNR   +L+ M+                         +++RY
Sbjct: 223 VQERKSQSREGDIWLQGNTNR---DLQDMSDDEEFDSEQYYSEENT--------ERKIRY 271

Query: 345 DNLGNVIXXXXXXXXXXXXXXIRYDNLGNXXXXXXXXXXXXXXXXXLRYDSLGNII 400
           DNLGNV+              +RYD LGN                 L+YDSLGN+I
Sbjct: 272 DNLGNVL-ISEEENESEEEEEVRYDALGN-------IIESEEEAAELKYDSLGNLI 319

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  344 bits (883), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 169/261 (64%), Positives = 198/261 (75%), Gaps = 24/261 (9%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           MGKGKNK  +  PKN R  RGANGHSSR NH+ MEMK  N   S +M             
Sbjct: 1   MGKGKNKMHE--PKNGRPQRGANGHSSRQNHRRMEMKYDN---SEKM------------- 42

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
             K PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV PDD +
Sbjct: 43  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLE 100

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
           I+++ GA+VVECSWARL+E+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 101 IVEQHGASVVECSWARLEEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEAL 156

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAI+GR DWAS+LLS+FSWG             Y +CTD DSVK A+EEWL K+E+E
Sbjct: 157 AACFAIVGRMDWASELLSHFSWGMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKE 216

Query: 285 ATERKLQAQETDIWMMGNTNR 305
             ERK +A+E DIWMMGN NR
Sbjct: 217 TQERKSRAKEEDIWMMGNINR 237

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  346 bits (888), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 166/261 (63%), Positives = 200/261 (76%), Gaps = 22/261 (8%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           MGKGKNK+ ++  ++ R HRGANGHSSR NHK MEMK+  D ++                
Sbjct: 1   MGKGKNKNHEE--RSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGN-------------- 44

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
             K PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNG+ VV P+D  
Sbjct: 45  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRV 102

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
           I++E GA+VVECSWARLDE+PF ++    GGK+ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 103 IVEEHGASVVECSWARLDEVPFGRI----GGKHERLLPYLVAANQVNYGRPWRLNCVEAL 158

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAI+GR+D AS+LLSNFSWG             Y +CTD+DSVKAA+E WL KIE+E
Sbjct: 159 AACFAIVGRTDLASELLSNFSWGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEE 218

Query: 285 ATERKLQAQETDIWMMGNTNR 305
           A +RK Q++E DIWMMGN NR
Sbjct: 219 AQQRKQQSKEEDIWMMGNVNR 239

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  338 bits (868), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 174/307 (56%), Positives = 205/307 (66%), Gaps = 32/307 (10%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           M KGKNK+R+   KN  + +G+NGHSSR NHK MEMK+  + T                 
Sbjct: 1   MSKGKNKNRE--AKNGHSGKGSNGHSSRQNHKRMEMKRGTEDT----------------- 41

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
             K PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNG  VV PDD  
Sbjct: 42  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKS 99

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
           I++E GA+VVECSWARLDE+PF+K+    GGK+ERLLPYLVAANQVNYGRPWKLNCVEAL
Sbjct: 100 IVEEHGASVVECSWARLDEVPFNKI----GGKHERLLPYLVAANQVNYGRPWKLNCVEAL 155

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAI+GR DWAS+LLS+FSWG             Y +CTD+DSVKAA+  WL KI++E
Sbjct: 156 AACFAIVGRMDWASELLSHFSWGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKE 215

Query: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKELRY 344
             ERK QA++ DIWM GN NR        N                         K LRY
Sbjct: 216 VEERKSQAKDEDIWMTGNVNRKGTTFLDDNEEEESSEVEESDEEE-------DNGKTLRY 268

Query: 345 DNLGNVI 351
           D LGN+I
Sbjct: 269 DRLGNLI 275

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  338 bits (866), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 210/307 (68%), Gaps = 33/307 (10%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           MGKGKNK+ +  PKN R  RGANGHS+R NHK+MEMK      S +M             
Sbjct: 1   MGKGKNKTHE--PKNERQQRGANGHSARQNHKHMEMKYD---KSEKM------------- 42

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
             K PVKL MWDFDHCDPKRCSGKKLERLGLI+SL++GQ+FQG+++SPNG+ VV P+D +
Sbjct: 43  --KFPVKLAMWDFDHCDPKRCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLE 100

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
           I+++ GA+VVECSWARL+E+PF+K+    GGK ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 101 IVEQHGASVVECSWARLEEVPFNKI----GGKYERLLPYLVAANQVNYGRPWRLNCVEAL 156

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAI+G+ DWAS+LLS+FSWG             Y +CTD+DSVK A++EWL+K+E E
Sbjct: 157 AACFAIVGKMDWASELLSHFSWGLGFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEME 216

Query: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKELRY 344
             ERK   ++TDIWMMGN NR    ++S  +                        + + Y
Sbjct: 217 TQERKSHTKKTDIWMMGNINRRGNGVQSDELESGEDSEQSGLE---------NSEQPIEY 267

Query: 345 DNLGNVI 351
           D LGN I
Sbjct: 268 DALGNAI 274

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  335 bits (860), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 168/306 (54%), Positives = 208/306 (67%), Gaps = 28/306 (9%)

Query: 46  GKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSV 105
           GKGKNKS D+G  N     G+NGH +R NH++MEMK       +                
Sbjct: 4   GKGKNKSHDEGRSNKSG--GSNGHHTRRNHRHMEMKYCGGSKDSS--------------- 46

Query: 106 KKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADI 165
              PVKL MWDFDHCDPKRCSGKKLERLGLIKSL++GQ+FQG+++SPNGK VV PDD +I
Sbjct: 47  --FPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREI 104

Query: 166 IKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALA 225
           ++  GA+VVECSWARL+E+PF+K+    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALA
Sbjct: 105 VEAHGASVVECSWARLEEVPFNKI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALA 160

Query: 226 ACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQEA 285
           ACFAI+GR+D A +LLS+FSWG             Y +CTDS+S+K  +E+WL +I+QE 
Sbjct: 161 ACFAIVGRTDLAHELLSHFSWGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEV 220

Query: 286 TERKLQAQETDIWMMGNTNRLDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKELRYD 345
            ERKL+AQ  D+WMMGNTNR ++ L   + S                    T  K +RYD
Sbjct: 221 QERKLKAQTEDVWMMGNTNRGNSGLMPPSDSEEEYEEEAEEEEED-----TTTRKNVRYD 275

Query: 346 NLGNVI 351
           NLGN+I
Sbjct: 276 NLGNII 281

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  328 bits (840), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 158/264 (59%), Positives = 198/264 (75%), Gaps = 21/264 (7%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           MGKGKNK+ +   ++ R  RGANGH+S+ NHK+MEMK H   +++   N           
Sbjct: 1   MGKGKNKNHE--VRSTRPGRGANGHNSKQNHKHMEMK-HGGASNSNKTN----------- 46

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
               PVKLGMWDFDHCDPKRCSGKKLERLGLI+SL++GQ+FQG++++PNG  VV P+D  
Sbjct: 47  ---FPVKLGMWDFDHCDPKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKS 103

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
           I++E GA+VVECSWARLDE+PF+++    GG++ERLLPYLVAANQVNYGRPWKLNCVEAL
Sbjct: 104 IVEEHGASVVECSWARLDEVPFNRI----GGRHERLLPYLVAANQVNYGRPWKLNCVEAL 159

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAI+GR DWAS+LLSNFS+G             Y +CTD++SVK A+  WL+KIE+E
Sbjct: 160 AACFAIVGRMDWASELLSNFSYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKE 219

Query: 285 ATERKLQAQETDIWMMGNTNRLDA 308
             +RK QA+  DIWM GN NR+ A
Sbjct: 220 IKDRKAQAKNEDIWMTGNVNRMPA 243

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  316 bits (809), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 188/265 (70%), Gaps = 26/265 (9%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           MGKG+NK  D       + +G+NGHSSR NH+ +E K    + + Q              
Sbjct: 1   MGKGRNKDYDKN----HSQKGSNGHSSRTNHRRIETK----YNAIQG------------- 39

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
             K PV L MWDFDHCDPKRCSGKKLERLGLIKSL++ Q+FQG+++SPNGK VV P+D +
Sbjct: 40  -SKFPVTLAMWDFDHCDPKRCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDRE 98

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
           I +++G +VVECSWARL+EIPF K+    GG++ERLLPYLVAANQVNYGRPW+LNCVEAL
Sbjct: 99  IAEKYGVSVVECSWARLEEIPFEKI----GGRHERLLPYLVAANQVNYGRPWRLNCVEAL 154

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAI+GR D A  LLS+FSWG             Y KCTD DS+KAA+E WL +IE E
Sbjct: 155 AACFAIVGRMDLAETLLSHFSWGLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETE 214

Query: 285 ATERKLQAQETDIWMMGNTNRLDAN 309
           A ER+ Q +E DIWMMGN NR +A+
Sbjct: 215 AMERRKQTKENDIWMMGNVNRKNAS 239

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  312 bits (799), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 201/316 (63%), Gaps = 34/316 (10%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           M KGKNK  ++  K     +G++ H+ + N +  E+K H     T+              
Sbjct: 1   MAKGKNKKTEERQK---PAKGSSKHNGKSNQRRTELK-HGHTKETE-------------- 42

Query: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164
               P KL MWDFDHCDPKRCSGKKLERLGLIKSL+IGQ+FQG+++SPNGK VV P+D +
Sbjct: 43  ---FPAKLAMWDFDHCDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKE 99

Query: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224
           I+++ G +VVECSWARLDEIPFSK+    GG++ERLLPYLVAANQVNYGRPW+LNCVEA+
Sbjct: 100 IVEQHGVSVVECSWARLDEIPFSKI----GGRHERLLPYLVAANQVNYGRPWRLNCVEAI 155

Query: 225 AACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQE 284
           AACFAI+GR+D A +LLS+FSWG             Y +CTD  S+KAA+E WL K+E+E
Sbjct: 156 AACFAIVGRTDLAEELLSHFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEE 215

Query: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISXXXXXXXXXXX---------XXXXXXXH 335
           A +R+ Q  E DIWMMGN NR   N+RS  +                             
Sbjct: 216 AEQRRKQTHEEDIWMMGNVNRKAPNMRSSMLDSDDNSDSEYASDVDHDLVSDTEEGEDIA 275

Query: 336 ITRNKELRYDNLGNVI 351
           I   +++ YD+LGNVI
Sbjct: 276 IGSKRDVTYDSLGNVI 291

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  308 bits (789), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 167/341 (48%), Positives = 204/341 (59%), Gaps = 53/341 (15%)

Query: 66  ANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSVKKIPVKLGMWDFDHCDPKRC 125
           +NGH SRHN+K ME K+H                  +      PVKL MWDFDHCDPKRC
Sbjct: 23  SNGHHSRHNNKKMEFKQH------------------VSRETSFPVKLAMWDFDHCDPKRC 64

Query: 126 SGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADIIKEFGAAVVECSWARLDEIP 185
           SGKKLERL LI+SLKI Q+FQG+ +SPNGKK VSP+D +++ EFG AVVECSWAR+DEIP
Sbjct: 65  SGKKLERLNLIRSLKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIP 124

Query: 186 FSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWASDLLSNFS 245
           FSK +     K +RLLPYLVAANQVNYGRPWKLNCVEA+AAC AI+G  D A +LLS+FS
Sbjct: 125 FSKFSTP---KLDRLLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFS 181

Query: 246 WGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQEATERKLQ--AQETDIWMMGNT 303
           WG             Y +CTDSD ++AAQ+ W+D+IE+E  ERK    AQ  DIWM GN 
Sbjct: 182 WGVNFLKLNRELLEIYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNV 241

Query: 304 NRLDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKELRYDNLGNVIXXXXXXXXXXXX 363
           NR+D +                           + ++E+ YDNLGN+I            
Sbjct: 242 NRIDESDEDNEDED-------------------SEDEEVTYDNLGNII--------ENEP 274

Query: 364 XXIRYDNLGN---XXXXXXXXXXXXXXXXXLRYDSLGNIIE 401
             +RYDNLGN                    ++YDSLGN+IE
Sbjct: 275 REVRYDNLGNIIEESSEESSGEEEEDEEEDVKYDSLGNVIE 315

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  294 bits (753), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 145/259 (55%), Positives = 179/259 (69%), Gaps = 28/259 (10%)

Query: 46  GKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSV 105
           GKG NK R      P     ++GH+S H H            S    N          S 
Sbjct: 7   GKGSNKQRGAHSSKP-----SSGHTSTHRH----------VESKHGAN---------KSG 42

Query: 106 KKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADI 165
           K  PVKL MWDFD CDPKRCSGKKLERLG+IKSL++GQ+FQG+++SPNGK VV P+D +I
Sbjct: 43  KNFPVKLAMWDFDQCDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNI 102

Query: 166 IKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALA 225
           ++E GAAVVECSWARLDE+PF+K+    GG+NERLLPYLVAANQVNYGRPW+LNCVEALA
Sbjct: 103 VEENGAAVVECSWARLDEVPFNKI----GGRNERLLPYLVAANQVNYGRPWRLNCVEALA 158

Query: 226 ACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQEA 285
           ACFAI+GR D A++LLS+FSWG             Y +CTD+DS+K A++ WL++IE+EA
Sbjct: 159 ACFAIVGRLDLATELLSHFSWGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEA 218

Query: 286 TERKLQAQETDIWMMGNTN 304
            ERK +    D+W+ GN N
Sbjct: 219 QERKARNPGDDLWLTGNVN 237

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  291 bits (746), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 197/305 (64%), Gaps = 34/305 (11%)

Query: 58  KNPRAHRGAN----GHSSRHNHKNMEMK--KHNDFTSTQMVNDNDDGIDEIHSVKKIPVK 111
           K  R+++G+N    GHS+R +   +E K   HN+                    +  PVK
Sbjct: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNG-------------------RNFPVK 43

Query: 112 LGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADIIKEFGA 171
           L MWDFD CDPKRCSGKKLERLG+IKSL++GQ+FQG+++SPNGK VV P+D  I++E GA
Sbjct: 44  LAMWDFDQCDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGA 103

Query: 172 AVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAII 231
           AVVECSWARL+EIPF+K+    GG+NERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+
Sbjct: 104 AVVECSWARLNEIPFNKI----GGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIV 159

Query: 232 GRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKIEQEATERKLQ 291
           GR D A++LL++FSWG             Y KCTD++SVK A+  WL+KIE+EA ER+  
Sbjct: 160 GRMDLATELLAHFSWGLGFLELNKELIEVYQKCTDAESVKEAEASWLEKIEREANERRNH 219

Query: 292 AQETDIWMMGNTNR---LDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKE--LRYDN 346
           +   D+WM GN NR   L  +  S                      + T N++  ++YDN
Sbjct: 220 SATDDLWMTGNVNRRSPLGNDTESSQEESENSVDTGDEEDDDNEDDYATGNRKRVVKYDN 279

Query: 347 LGNVI 351
           LGN I
Sbjct: 280 LGNEI 284

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  281 bits (719), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 164/360 (45%), Positives = 200/360 (55%), Gaps = 61/360 (16%)

Query: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104
           M KGKNK                GH  R N K+   +++    S             I S
Sbjct: 1   MAKGKNK----------------GHEERSNRKSNNSRRNESKHSLS-----------IKS 33

Query: 105 VKK-IPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDA 163
            K   PVKL MWDFDHCDPKRCSGKKLER GL +SL++GQRF G+++SPNGK+VVSP D 
Sbjct: 34  TKTNFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADR 93

Query: 164 DIIKEFGAAVVECSWARLDEIPFSKLNGGNGGK--NERLLPYLVAANQVNYGRPWKLNCV 221
           + I+++G AVVECSWARLDE+PF+KL    GGK  NE LLPYLVAAN VNYGRPW+LNCV
Sbjct: 94  ETIEQYGIAVVECSWARLDEVPFNKL----GGKPSNEVLLPYLVAANPVNYGRPWRLNCV 149

Query: 222 EALAACFAIIGRSDWASDLLSNFSWGXXXXXXXXXXXXXYSKCTDSDSVKAAQEEWLDKI 281
           EA AAC AI+G  ++AS +L  FSWG             Y  CTDS SV+ AQ+EWL+KI
Sbjct: 150 EAFAACLAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKI 209

Query: 282 EQEATERKLQAQETDIWMMGNTNRLDANLRSMNISXXXXXXXXXXXXXXXXXXHITRNKE 341
           E E  ERK +    D W++GNTNR   NL   + S                      + +
Sbjct: 210 ELENKERKEKMNSADAWLIGNTNR--KNLNDFDNSSESTEDNIS----------TVSSAD 257

Query: 342 LRYDNLGNVIXXXXXXXXXXXXXXIRYDNLGNXXXXXXXXXXXXXXXXXLRYDSLGNIIE 401
            RYD LGN+I              ++YD+LGN                  +YD LGNIIE
Sbjct: 258 ERYDALGNLISNDSHS--------LKYDSLGNVIESEGDALPP-------KYDKLGNIIE 302

>Suva_2.737 Chr2 (1282028..1283935) [1908 bp, 635 aa] {ON} YOR389W
           (REAL)
          Length = 635

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 188 KLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWASD 239
           KLN  + G+NER+   L AA    +G+P+ L+ +  +   F ++   D+ASD
Sbjct: 228 KLNLSDDGENERMAERLYAARICKWGKPFGLDGIIRVEVGFEVV-LCDFASD 278

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 43/106 (40%), Gaps = 29/106 (27%)

Query: 95  NDDGIDEIHSVKKIPVKLGMWDFDHCDPKRCSGKKLERLGL---------------IKSL 139
           ND G+      ++I V   +W   H DP       L+RLGL                +S+
Sbjct: 77  NDSGVPR----EEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSI 132

Query: 140 KIGQRFQGLIISPNGKKVVSPDDADIIKEFGAAVVECSWARLDEIP 185
           K G  F  + + P+GK+ V  D  D +K         +W  + E+P
Sbjct: 133 KDGN-FLSIPLLPDGKRDVEIDTWDYVK---------TWELMQELP 168

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,788,550
Number of extensions: 1632451
Number of successful extensions: 5505
Number of sequences better than 10.0: 47
Number of HSP's gapped: 5572
Number of HSP's successfully gapped: 47
Length of query: 401
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 289
Effective length of database: 40,638,807
Effective search space: 11744615223
Effective search space used: 11744615223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)