Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0D006107.342ON48648614820.0
NCAS0H006707.342ON4832647676e-96
Smik_12.2647.342ON6122666992e-84
Skud_12.2707.342ON6262706923e-83
YLR206W (ENT2)7.342ON6132676861e-82
Suva_10.3007.342ON6182706749e-81
CAGL0A03872g7.342ON5102656633e-80
Skud_4.947.342ON4472636575e-80
Smik_4.757.342ON4602686514e-79
YDL161W (ENT1)7.342ON4542636436e-78
TDEL0C020507.342ON5012636353e-76
KAFR0L014607.342ON5502636332e-75
Suva_4.837.342ON4622636245e-75
ZYRO0F11550g7.342ON5382636192e-73
KNAG0C038007.342ON4472596122e-73
Kwal_56.246107.342ON5082666121e-72
TBLA0E004807.342ON5992746153e-72
TPHA0D045607.342ON4872646013e-71
SAKL0F10934g7.342ON4982635865e-69
Kpol_2001.707.342ON5331875816e-68
KLLA0C16731g7.342ON4782635611e-65
KLTH0H01430g7.342ON5022635561e-64
KAFR0B008907.342ON4141755264e-61
Ecym_47317.342ON5142635178e-59
KNAG0B026507.342ON6462425231e-58
ACL157C7.342ON5151884417e-48
TBLA0E020407.342ON7011884471e-47
Kpol_1001.24.346ON4181432228e-19
KLTH0D16896g4.346ON4011432192e-18
NDAI0D032004.346ON4351432131e-17
Kwal_47.168574.346ON3821432102e-17
SAKL0G17952g4.346ON4151432077e-17
TDEL0D007104.346ON3751432058e-17
Suva_12.2164.346ON4101432041e-16
KLLA0B04587g4.346ON4001432042e-16
KNAG0M003804.346ON4031432032e-16
AER155C4.346ON3641432013e-16
SAKL0H25762g4.17ON2621471955e-16
TBLA0E047604.346ON4261431998e-16
KAFR0B067404.346ON3991431989e-16
TPHA0B004004.346ON3991431971e-15
Skud_10.3494.346ON4101431971e-15
YJR125C (ENT3)4.346ON4081431971e-15
Smik_10.4184.346ON4091431962e-15
NCAS0A062104.346ON4231431926e-15
ZYRO0B14784g4.346ON4241431918e-15
Kwal_55.206114.17ON2541461742e-13
Ecym_11334.346ON3921431782e-13
TDEL0G017404.17ON2571341691e-12
KLTH0E05874g4.17ON2551361654e-12
CAGL0H04323g4.346ON4121431694e-12
Kpol_388.54.17ON2681331584e-11
TBLA0B062204.346ON3391431604e-11
KLLA0D03949g4.17ON2251381404e-09
Ecym_84074.17ON2541471415e-09
Suva_10.354.17ON2471341398e-09
TBLA0G006504.17ON4231431402e-08
TPHA0F002304.17ON2801441311e-07
ZYRO0G07876g4.17ON2591361301e-07
Skud_12.304.17ON2471341263e-07
NCAS0C058404.17ON2671351255e-07
NDAI0H002804.17ON3101381222e-06
ACL061C4.17ON2341351183e-06
NCAS0B036608.335ON4161691091e-04
YLL038C (ENT4)4.17ON2471031061e-04
Smik_12.194.17ON2471031061e-04
CAGL0E03806g4.17ON2601121052e-04
YHR161C (YAP1801)5.84ON637911063e-04
KAFR0B058008.335ON3821721053e-04
KLLA0D16654g8.335ON3991671026e-04
Skud_8.2255.84ON621911010.001
SAKL0H02530g5.84ON669118990.002
CAGL0E01199g8.335ON412168970.002
KAFR0I014604.17ON275156950.003
ZYRO0F13684g8.335ON407170960.004
Smik_8.2455.84ON62791950.005
KLTH0G11902g8.335ON399167940.007
Kpol_344.88.335ON384172930.007
Kwal_YGOB_27.112618.335ON404167930.009
Suva_2.3158.335ON403171920.011
NDAI0J009308.335ON418166910.013
KNAG0J028704.17ON329142900.015
YDR153C (ENT5)8.335ON411171910.016
Smik_4.3988.335ON416171900.017
KNAG0A051008.335ON421173870.048
Kwal_27.11263singletonOFF275167850.057
TBLA0H012108.335ON49198850.071
TBLA0A040408.335ON415168830.15
TPHA0C007408.335ON38597741.6
KAFR0A083403.62ON48791723.3
Ecym_42648.335ON40870695.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0D00610
         (486 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   575   0.0  
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    300   6e-96
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   273   2e-84
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   271   3e-83
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   268   1e-82
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   264   9e-81
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   259   3e-80
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   257   5e-80
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   255   4e-79
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   252   6e-78
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   249   3e-76
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   248   2e-75
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   244   5e-75
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   243   2e-73
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   240   2e-73
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   240   1e-72
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   241   3e-72
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   236   3e-71
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   230   5e-69
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   228   6e-68
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   220   1e-65
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   218   1e-64
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   207   4e-61
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   203   8e-59
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   206   1e-58
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   174   7e-48
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   176   1e-47
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    90   8e-19
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    89   2e-18
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    87   1e-17
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    86   2e-17
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    84   7e-17
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    84   8e-17
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    83   1e-16
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    83   2e-16
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    83   2e-16
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    82   3e-16
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    80   5e-16
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    81   8e-16
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    81   9e-16
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    80   1e-15
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    80   1e-15
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    80   1e-15
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    80   2e-15
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    79   6e-15
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    78   8e-15
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    72   2e-13
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    73   2e-13
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    70   1e-12
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    68   4e-12
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    70   4e-12
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    65   4e-11
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    66   4e-11
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    59   4e-09
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    59   5e-09
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    58   8e-09
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    59   2e-08
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    55   1e-07
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    55   1e-07
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    53   3e-07
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    53   5e-07
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    52   2e-06
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    50   3e-06
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    47   1e-04
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    45   1e-04
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    45   1e-04
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    45   2e-04
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    45   3e-04
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    45   3e-04
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    44   6e-04
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    44   0.001
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    43   0.002
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    42   0.002
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    41   0.003
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    42   0.004
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    41   0.005
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    41   0.007
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    40   0.007
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    40   0.009
Suva_2.315 Chr2 complement(560767..560940,560968..561033,561037....    40   0.011
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    40   0.013
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    39   0.015
YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}  ...    40   0.016
Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON...    39   0.017
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    38   0.048
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    37   0.057
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    37   0.071
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    37   0.15 
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    33   1.6  
KAFR0A08340 Chr1 complement(1670622..1672085) [1464 bp, 487 aa] ...    32   3.3  
Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}...    31   5.8  

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/486 (63%), Positives = 311/486 (63%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120

Query: 121 IRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKALE 180
           IRVKAKELTALLQDDERLKEERSINL              GTNATRRGTKSDEDLQKALE
Sbjct: 121 IRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDEDLQKALE 180

Query: 181 ESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ESRITA         LAQYDNQDTDYQTA                               
Sbjct: 181 ESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQLQQQQQQQMQ 240

Query: 241 XXXXXXXXXXVYYDIFGNPISPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                     VYYDIFGNPISP                                      
Sbjct: 241 FQQQPQQQEQVYYDIFGNPISPEEYLQFQQQQQAFAQQQALQQQHLEQQRLAEEQYRLLQ 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXGSNNPFALNATINTSPIRXXXXXXXXXXXXXXXXXXX 360
                                  GSNNPFALNATINTSPIR                   
Sbjct: 301 QQQQQQQQQAYTQQQQSLQPLPTGSNNPFALNATINTSPIRPAEQQPQPQFTAPQQQQQP 360

Query: 361 XXXXXXXXRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTG 420
                   RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTG
Sbjct: 361 LQQPLKQTRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTG 420

Query: 421 YKQIVNDPVKKNPFLNNQYTGLPSSNIVPSHTGYGFXXXXXXXXXXXXXXXXXXXXXXXS 480
           YKQIVNDPVKKNPFLNNQYTGLPSSNIVPSHTGYGF                       S
Sbjct: 421 YKQIVNDPVKKNPFLNNQYTGLPSSNIVPSHTGYGFGNGPQQGQGQAPPPQQQQQQSQQS 480

Query: 481 FSLIDL 486
           FSLIDL
Sbjct: 481 FSLIDL 486

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  300 bits (767), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 159/264 (60%), Positives = 180/264 (68%), Gaps = 13/264 (4%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYSTTQVLVRDATSND+SNPSFE+LYE+++RSFDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCK+NLYIIKTL+EF+ EDD   D+  
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDED-LQKA 178
           IIRVKAKELT+LL D+ERLKEER+INL                    RG   D+D LQ+A
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQDELQRA 180

Query: 179 LEESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
           LEESR+TA         +AQYD+QD D QTA                             
Sbjct: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTALQLSKEEEELKKLQEMQRLQQQQGQMNQP 240

Query: 239 XXXXXXXXXXXXVYYDIFGNPISP 262
                        Y+DIFGNPISP
Sbjct: 241 QG-----------YFDIFGNPISP 253

 Score =  160 bits (404), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 93/135 (68%), Gaps = 3/135 (2%)

Query: 324 GSNNPFALNATINTSPIRXXXX--XXXXXXXXXXXXXXXXXXXXXXXRTGNQSISDKYNE 381
           GSNNPFA+N   N   +                              RTGNQSI+DKY++
Sbjct: 323 GSNNPFAMNNFNNKPAVESTQAYTASAPQLNQQPAQQQPQQQPLKQTRTGNQSITDKYSQ 382

Query: 382 LNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDPVKKNPFLNNQYTG 441
           LN LLA+GTGIDTFGNTG+QRIPAQHTQTGTFINSQGTGY+Q+ NDP K NPFLN+QYTG
Sbjct: 383 LNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDP-KNNPFLNSQYTG 441

Query: 442 LPSSNIVPSHTGYGF 456
           LPS+NIV + TGYGF
Sbjct: 442 LPSTNIVSTQTGYGF 456

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  273 bits (699), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 170/266 (63%), Gaps = 6/266 (2%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKNMMKGYS+TQVLVRDAT+NDS  PS + L ++++RS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC++N Y+IKTL+EF+ E+++  DE  
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXX----XXXXXXXXXXGTNATRRGTKSDEDL 175
           IIRVKAKEL +LL DDERL+EERS+N                    +N          DL
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 176 QKALEESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXX 235
           +KALEESRITA         LAQYD++D D+Q A                          
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAA-LQLSKEEEELKQLQELQRLQNQQQS 239

Query: 236 XXXXXXXXXXXXXXXVYYDIFGNPIS 261
                           YYDIFGNPIS
Sbjct: 240 LSQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  157 bits (398), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 72/88 (81%), Positives = 82/88 (93%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQSISDKYN+LN LLA+GTG DTFGNTG+ RIPAQHT+TGTFINSQGTGYKQ++N+P
Sbjct: 430 RTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVINEP 489

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFL+NQYTGLPS+NIVP+ TGYGF
Sbjct: 490 -KNNPFLSNQYTGLPSTNIVPTQTGYGF 516

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  271 bits (692), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 141/270 (52%), Positives = 170/270 (62%), Gaps = 9/270 (3%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           M KQFVRSAKNM+KGYS+TQVLVRDAT+NDS  PS + L ++++RS+DSVDFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC++N Y+IKTL+EF+ E+++  DE  
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINL----XXXXXXXXXXXXXXGTNATRRGTKSDEDL 175
           IIRVKAKEL +LL DDERL+EERS+N                   G+N         ++L
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 176 QKALEESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXX 235
           +K LEESRITA         LAQYD++D D+Q A                          
Sbjct: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQPL 240

Query: 236 XXXXXXXXXXXXXX----XVYYDIFGNPIS 261
                               YYDIFGNPIS
Sbjct: 241 SQMPVPVQQQQQQQQQQLPAYYDIFGNPIS 270

 Score =  154 bits (389), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 71/88 (80%), Positives = 82/88 (93%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQSISDKYN+LN LLA+GTG+DTFGNTG+ RIPAQHT+TGTFINSQGTGYKQ+ ++P
Sbjct: 455 RTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSEP 514

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFL+NQYTGLPS+NIVP+ TGYGF
Sbjct: 515 -KNNPFLSNQYTGLPSTNIVPTQTGYGF 541

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  268 bits (686), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 170/267 (63%), Gaps = 6/267 (2%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKNMMKGYS+TQVLVRDAT+NDS  PS + L ++++RS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC++N Y+IKTL+EF+ E+++  DE  
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSI----NLXXXXXXXXXXXXXXGTNATRRGTKSDEDL 175
           IIRVKAKEL +LL D+ERL+EERS+                     +N         +DL
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 176 QKALEESRITAXXXXXXXXXLAQYDNQDTDYQTA-XXXXXXXXXXXXXXXXXXXXXXXXX 234
           +KALEESRITA         LAQYD++D D+Q A                          
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQSL 240

Query: 235 XXXXXXXXXXXXXXXXVYYDIFGNPIS 261
                            YYDIFGNPIS
Sbjct: 241 SQFQAPLQQQQPQQQPAYYDIFGNPIS 267

 Score =  156 bits (394), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 72/88 (81%), Positives = 82/88 (93%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQSISDKY++LN LLA+GTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGYKQ+ N+P
Sbjct: 429 RTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNEP 488

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFL+NQYTGLPS+NIVP+ TGYGF
Sbjct: 489 -KNNPFLSNQYTGLPSTNIVPTQTGYGF 515

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  264 bits (674), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 140/270 (51%), Positives = 168/270 (62%), Gaps = 16/270 (5%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYS+TQVLVRDAT+ND   PS + L ++++RS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC++N Y+IKTL+EF+ E+++  DE  
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXX--------XXXXXXXGTNATRRGTKS 171
           IIRVKAKEL +LL DDERL+EER++N                        +N        
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 172 DEDLQKALEESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXX 231
             DL+KALEESRITA         +AQYD+ D D+Q A                      
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAA-------LQLSKEEEELKQLQE 233

Query: 232 XXXXXXXXXXXXXXXXXXXVYYDIFGNPIS 261
                               YYDIFGNPIS
Sbjct: 234 LQKQQQLQSQLQMPPQQQAAYYDIFGNPIS 263

 Score =  154 bits (390), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 72/88 (81%), Positives = 82/88 (93%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQSISDKYN+LN LLA+GTG DTFGNTG+ RIPAQHT+TGTFINSQGTGYKQ+VN+P
Sbjct: 438 RTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNEP 497

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFLN+QYTGLPS++IVP+ TGYGF
Sbjct: 498 -KNNPFLNSQYTGLPSTSIVPTQTGYGF 524

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  259 bits (663), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 140/265 (52%), Positives = 171/265 (64%), Gaps = 14/265 (5%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           M  Q VRSAKNM+KGYS+TQV+VRDAT+NDS++PS  +L +++ +++D+V+FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD--NVDES 118
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCK+NLYIIKTL+EF+ ED+    DE 
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 119 SIIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKS-DEDLQK 177
            IIRVKAKELT+LL DDERL+EER++N                 + +     + D+DLQK
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 178 ALEESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 237
           ALEESR+TA          AQY+NQD D   A                            
Sbjct: 181 ALEESRMTAEEEEARRREQAQYENQDPDLLAA-----------LQLSKEEEELKKLQDMQ 229

Query: 238 XXXXXXXXXXXXXVYYDIFGNPISP 262
                        VYYDIFGNPISP
Sbjct: 230 RMQELQAQQQQQNVYYDIFGNPISP 254

 Score =  164 bits (415), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQSISDKY+ELNNLLASGTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGYKQ+ N+P
Sbjct: 362 RTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNEP 421

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFL++QYTGLPS+NIVPSHTGYGF
Sbjct: 422 -KNNPFLSSQYTGLPSTNIVPSHTGYGF 448

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  257 bits (657), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 168/263 (63%), Gaps = 24/263 (9%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYS+TQVLVR+ATSND+   S + L E++++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCK+NLYIIKTLKEF+ EDD  VD+  
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKAL 179
           I+RVKAKELT LL DDERL EER++N+                  T R  + D+DLQ+A+
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRK------RRGTGRNDEDDDDLQRAI 174

Query: 180 EESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           + SR+TA               QD DY+TA                              
Sbjct: 175 DASRMTAEEDERRR-------KQDEDYETA----------LQLSKEEEELKRLQDLQRMQ 217

Query: 240 XXXXXXXXXXXVYYDIFGNPISP 262
                      +YYDIFGNPI+P
Sbjct: 218 QVHAQQQQQQPMYYDIFGNPITP 240

 Score =  155 bits (392), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQS++DKY +LN LLA+GTGIDTFGN GD R+PAQHT+TGTFINSQGTGY+Q+ NDP
Sbjct: 338 RTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSNDP 397

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K+NPFLN+QYTGLPS+NIVP+ TGYGF
Sbjct: 398 -KQNPFLNSQYTGLPSTNIVPTQTGYGF 424

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  255 bits (651), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 139/268 (51%), Positives = 170/268 (63%), Gaps = 34/268 (12%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYS+TQVLVR+ATSND+   S + L E++++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCK+NLYIIKTLKEF+ EDD  +D+  
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGT-----KSDED 174
           I+RVK+KELTALL DDERL EER++N+                  +RRGT      +D D
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRNRK----------GRSRRGTGRSSNDNDND 170

Query: 175 LQKALEESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXX 234
           LQ+AL+ SR+TA                D DY+TA                         
Sbjct: 171 LQRALDASRMTAEEDEKRRKM-------DEDYETA-----------LQLSKEEEELKRLQ 212

Query: 235 XXXXXXXXXXXXXXXXVYYDIFGNPISP 262
                           +YYDIFGNPI+P
Sbjct: 213 DLQRMQQLQTQQQQQPMYYDIFGNPITP 240

 Score =  154 bits (388), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 80/88 (90%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQS++DKYN+LN LLA+GTGIDTFGN GD R+PAQHT+TGTFINSQGTGYKQ+ NDP
Sbjct: 351 RTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDP 410

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFL+ QYTGLPS+N+VP+ TGYGF
Sbjct: 411 -KYNPFLSGQYTGLPSTNVVPTQTGYGF 437

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  252 bits (643), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 134/263 (50%), Positives = 169/263 (64%), Gaps = 24/263 (9%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYS+TQVLVR+ATSND+   S + L E++++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119
           KRLNDKGKYW+HIAK+LTV+DYL+RFGSENCVLWC++NLYIIKTLKEF+ EDD  +D+  
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKAL 179
           I+RVKAKELTALL DDERL EER++N+               ++      ++D+DLQ+A+
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRSD------ENDDDLQRAI 174

Query: 180 EESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
             SR+TA               QD DY+TA                              
Sbjct: 175 SASRLTAEEDERRR-------KQDEDYETA----------LQLSKEEEELKRLQDLQRMQ 217

Query: 240 XXXXXXXXXXXVYYDIFGNPISP 262
                      +YYDIFGNPI+P
Sbjct: 218 QQQGQQQLQQPMYYDIFGNPITP 240

 Score =  147 bits (371), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 65/88 (73%), Positives = 80/88 (90%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQS++DKY++LN LLA+GTGIDTFGN G+ RIPAQHT+TGTFINSQGTGY+Q+ +DP
Sbjct: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP 404

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
              NPFLN+QYTGLPS+++VP+ TGYGF
Sbjct: 405 -NHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  249 bits (635), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 165/263 (62%), Gaps = 21/263 (7%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYS+ QVLVR+AT+N+S  PS + L E++++++DSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119
           KRLNDKGKYW+HIAKSLTVLDYLVRFGSENCVLWC++NLY+IKTL EF+ +DD  VD+  
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKAL 179
           IIRVKAKELT LL DDERL+EER +N               G          D+DLQ+AL
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQ-----DGFDDDLQRAL 175

Query: 180 EESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           +ESR+TA         L    ++D D Q A                              
Sbjct: 176 DESRLTAEEDERRRKMLG---SEDDDLQAA------------LQLSKEEEELKRLQEMQK 220

Query: 240 XXXXXXXXXXXVYYDIFGNPISP 262
                       YYDIFGNPISP
Sbjct: 221 LQQQQTQQQPSQYYDIFGNPISP 243

 Score =  151 bits (381), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 80/88 (90%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTG+ ++++KY ELN LLA+GTGIDTFGNTGD RIPAQHT+TGTFINSQGTGY+Q+  +P
Sbjct: 390 RTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGEP 449

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            KKNPFL +QYTG+PSSNIVP+HTGYGF
Sbjct: 450 -KKNPFLQSQYTGIPSSNIVPAHTGYGF 476

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  248 bits (633), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 141/263 (53%), Positives = 170/263 (64%), Gaps = 9/263 (3%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQFVRSAKN+MKGYS+TQVLVRDATSND+   + + L +I+ RS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119
           KRLNDKGKYWKHI KSLTVLDYLVRFGSENCVLWCK+NLY+IKTL+EF+ EDD  +D+  
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGT-KSDEDLQKA 178
           IIRVKAKELT+LLQD+ERL+EER  N                T+ ++      D+DLQ+ 
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDDDDLQRV 180

Query: 179 LEESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
           +EES+ TA         LA+YD +D ++Q A                             
Sbjct: 181 IEESKKTAEEDERRRKELARYDEEDPEFQAA-------LQLSKEEEELKNLQDLQRQQQQ 233

Query: 239 XXXXXXXXXXXXVYYDIFGNPIS 261
                       VYYD+FGNPIS
Sbjct: 234 LQMLQQQQTSANVYYDVFGNPIS 256

 Score =  156 bits (394), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 70/88 (79%), Positives = 79/88 (89%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGN+ I++KY+ELNNLLA GTG+DTFGNTG +RIPAQHT+TGTFINSQGTGYKQ+ N+ 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFLN QYTGLPSSNIVPS TGYGF
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGF 476

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  244 bits (624), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 133/263 (50%), Positives = 168/263 (63%), Gaps = 24/263 (9%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQ VRSAKN++KGYS+TQVLVR+ATSND++  S + L E++++S+DS DFFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCK+NLYIIKTLKEF+ +DD   D+  
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKAL 179
           I+RVKAKELT+LL D+ERL EER++N+                  T R ++ D+DLQ+A+
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRR------RRRTNRSSEDDDDLQRAI 174

Query: 180 EESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           + SR+TA               QD DY+TA                              
Sbjct: 175 DASRMTADEDERRRK-------QDEDYETA----------LQLSKEEEELKRLQDLQRIQ 217

Query: 240 XXXXXXXXXXXVYYDIFGNPISP 262
                      +Y DIFGNPI+P
Sbjct: 218 AQQQQQQQQQPMYCDIFGNPITP 240

 Score =  151 bits (381), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 80/88 (90%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQS++DKY++LN LL +GTGIDTFGN GD R+PAQHT+TGTFINSQGTGY+Q+ NDP
Sbjct: 353 RTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDP 412

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFLN+QYTGLPS+N+VP+ TGYGF
Sbjct: 413 -KHNPFLNSQYTGLPSTNVVPAQTGYGF 439

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  243 bits (619), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 160/263 (60%), Gaps = 19/263 (7%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           M  QFVRSAKN +KGY++ QVLVRDAT+N+   PS ++L E++ RS+DSV+FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNV-DESS 119
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC++NLYIIKTL+EF+ +DD   D   
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKAL 179
           IIRVKAKELT LL DDERL+ ER  +                +  T R    D ++Q+AL
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERGED------KGAPPRMMSPSPPTPRRNSYDSEMQRAL 174

Query: 180 EESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           + SR+TA         L   +N+D D +TA                              
Sbjct: 175 DASRLTAEEDERRRKTL---NNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQ 231

Query: 240 XXXXXXXXXXXVYYDIFGNPISP 262
                       YYDIFGNPISP
Sbjct: 232 PQG---------YYDIFGNPISP 245

 Score =  149 bits (375), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (88%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQSISDKYN+LN LLA  TG+DTFGN GD RIPAQHT+TGTFINSQGTG+KQ  N+P
Sbjct: 424 RTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYSNEP 483

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            KKNPFL  Q+TG+P+S++VPSHTGYGF
Sbjct: 484 -KKNPFLPTQFTGIPTSSVVPSHTGYGF 510

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  240 bits (612), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 126/259 (48%), Positives = 165/259 (63%), Gaps = 19/259 (7%)

Query: 5   FVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLN 64
            +RSAKN++KGYS T+VLVRDAT+N+S+NPS E+L +++ +S++SV+FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLED-DNVDESSIIRV 123
           DKGKYW+H+AK+LTVLDYLVRFGSENCV+WC++NLYIIKTL+EF  ED    DE  IIRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 124 KAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKALEESR 183
           KAKELT+LL D+ERLKEER++N+                 +  R  +SDEDLQ+A+EES+
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSG-----GSRERNNRSDEDLQRAIEESK 175

Query: 184 ITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 243
            TA          A   + + D Q A                                  
Sbjct: 176 RTAEEEERRRRNGA---SSEADRQAA----------LQLSREEEDLRRLQEQARLAQQQQ 222

Query: 244 XXXXXXXVYYDIFGNPISP 262
                  +YYD+FGNPI+P
Sbjct: 223 QQQQQQPMYYDVFGNPITP 241

 Score =  162 bits (410), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 84/134 (62%), Positives = 95/134 (70%), Gaps = 7/134 (5%)

Query: 324 GSNNPFALN-ATINTSPIRXXXXXXXXXXXXXXXXXXXXXXXXXXXRTGNQSISDKYNEL 382
           GSNNPFALN AT  ++P                             R+GNQ+ISDKY+ L
Sbjct: 298 GSNNPFALNNATQPSAP-----ASTTAARPAAIETPATQTKPLTQTRSGNQAISDKYSAL 352

Query: 383 NNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDPVKKNPFLNNQYTGL 442
           NNLLASGTGIDTFGNTG+QRIPAQHTQTGTFINSQGTGY+Q+ ND  K NPFLN QYTGL
Sbjct: 353 NNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDD-KPNPFLNGQYTGL 411

Query: 443 PSSNIVPSHTGYGF 456
           PS+NIVP+ TG+GF
Sbjct: 412 PSTNIVPTQTGFGF 425

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  240 bits (612), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 161/266 (60%), Gaps = 18/266 (6%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSK  +R AKN++ GYSTTQVL+R+ATSND   PS +I+ EI++RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W K+NLY+IKTL+EF  ED+  +D+  
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKS--DEDLQK 177
           I+RVKA+ELTALL DDERL+EERS+                     RR T    DEDLQ+
Sbjct: 121 IVRVKARELTALLLDDERLREERSLR-------------TKNRKPRRRPTAGSEDEDLQR 167

Query: 178 ALEESRITAXXXXXX-XXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXX 236
           A+EESR+TA          L  YDN   D QTA                           
Sbjct: 168 AMEESRLTAEQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQ 227

Query: 237 XX-XXXXXXXXXXXXVYYDIFGNPIS 261
                          +YYD+FGNPIS
Sbjct: 228 QMFGLSQQQTQAQQPMYYDVFGNPIS 253

 Score =  149 bits (375), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (89%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQSI++K++ELNNLLASGTG+DTFGNTG  RIPAQHT+TG FINSQGTGYKQ+ + P
Sbjct: 396 RTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSSTP 455

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFL  QYTGLPS+N+VPS+TGYGF
Sbjct: 456 -KHNPFLGQQYTGLPSTNVVPSYTGYGF 482

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  241 bits (615), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 132/274 (48%), Positives = 166/274 (60%), Gaps = 18/274 (6%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQF+RS KNM+KGYS+TQ+LVRDAT+ND + PS +IL +I+++++DSVDFFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLED-----DNV 115
           KRLNDKGKYWKH+AKSLTVLDYL+RFGSENCV WCK+NLY+IKTLKEF+++D        
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 116 DESSIIRVKAKELTALLQDDERLKEERSIN--------LXXXXXXXXXXXXXXGTNATRR 167
           D+  I+RV+A ELT+LL DDERL+EERS++                         N  R 
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 168 GTKSDEDLQKALEESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXX 227
               D+DLQKA+EES+ TA              +Q+ D++TA                  
Sbjct: 181 DDHYDDDLQKAIEESKRTAEEDERRRRNRE--GDQEDDFETA---LQLSKEEEELKKLQE 235

Query: 228 XXXXXXXXXXXXXXXXXXXXXXXVYYDIFGNPIS 261
                                  VY DIFGNPIS
Sbjct: 236 LHAQQIALQNQQNATPTTQNVANVYTDIFGNPIS 269

 Score =  158 bits (399), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 73/88 (82%), Positives = 80/88 (90%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQ ISDKYN LN LLA+GTGIDTFGNTGD RIPAQHT TGTFINSQGTGYKQ +NDP
Sbjct: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYINDP 530

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPF++NQYTGLPS+N+VPS+TGYGF
Sbjct: 531 -KNNPFMSNQYTGLPSTNVVPSYTGYGF 557

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  236 bits (601), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 166/264 (62%), Gaps = 30/264 (11%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MS QFVRS KN++KGYS+TQVLVR+AT+N+ + P+ ++L +I+++++DS DFFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN---VDE 117
           KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCK+NLY+IKTL EF+ ED+N   VD+
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 118 SSIIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQK 177
             IIRVKAKELTALL DDERL+EER +N               G         SDEDLQ+
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRRPPARNG---------SDEDLQR 171

Query: 178 ALEESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 237
           ALEESR TA           + +  D+D Q A                            
Sbjct: 172 ALEESRRTAEEDERKR----RLNQDDSDLQAA--------------LQLSKEEEELKRLQ 213

Query: 238 XXXXXXXXXXXXXVYYDIFGNPIS 261
                        VYYD+FGNPIS
Sbjct: 214 ELQSSMHMQQQQPVYYDVFGNPIS 237

 Score =  146 bits (368), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (88%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGN+ +++KYNELN LLASGTGIDTFGNTG+ RIPAQHTQTGTFINSQGTGY+Q   + 
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFL+NQYTGLPSSNI+P+ TGYGF
Sbjct: 435 -KVNPFLSNQYTGLPSSNIIPTQTGYGF 461

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  230 bits (586), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 125/263 (47%), Positives = 165/263 (62%), Gaps = 17/263 (6%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSK  +R+AKN++ GYS+ QVLVR+ATSN+ + P+ + L E++++++D+V+FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119
           KRLNDKGK W+H+AKSLTVLDYLVR+GSENCVLW ++NLYIIKTL+EF  ED+  VD   
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKAL 179
           IIRVKAKELT+LL+D+ERL EER++                    +R G + D+DLQ+AL
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRR-------PERSRGGEEYDDDLQRAL 173

Query: 180 EESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           EESR+TA          +   N D D+QTA                              
Sbjct: 174 EESRLTAEEEERRRRTDSG-SNDDDDFQTA--------LQLSKEEEELRRLRNLQMQQQQ 224

Query: 240 XXXXXXXXXXXVYYDIFGNPISP 262
                      +YYD+FGNPI+P
Sbjct: 225 TAMFQQQQQQPMYYDVFGNPITP 247

 Score =  152 bits (384), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 70/88 (79%), Positives = 78/88 (88%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQSIS KYN+LNNLLASGTG+DTFGNTG  RIPAQHT+TG FINSQGTGYKQ+ ND 
Sbjct: 375 RTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQ 434

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFL  QYTGLPS+++VPS+TGYGF
Sbjct: 435 PKNNPFLAAQYTGLPSTSVVPSYTGYGF 462

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  228 bits (581), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 117/187 (62%), Positives = 146/187 (78%), Gaps = 10/187 (5%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           M KQFVRSAKN++KGYS+TQV+VR+ATSNDS  P  + L  ++++++DSV+FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFK-LEDDNVDESS 119
           KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCK+NLYII+TLKEF  ++D + D+  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKAL 179
           IIRVKAKELT+LL D+ERL++ER +N                    RR    D++LQ+A+
Sbjct: 121 IIRVKAKELTSLLNDEERLRDERGMNRRGGRRE---------RARPRRRPSDDDELQRAI 171

Query: 180 EESRITA 186
           EES+ TA
Sbjct: 172 EESKRTA 178

 Score =  159 bits (402), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 73/88 (82%), Positives = 81/88 (92%), Gaps = 1/88 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQ I+DK+ ELN LLASGTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGY+Q+ NDP
Sbjct: 384 RTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTNDP 443

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFLN+QYTGLPS+NIVPSHTGYGF
Sbjct: 444 -KNNPFLNSQYTGLPSTNIVPSHTGYGF 470

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  220 bits (561), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 128/263 (48%), Positives = 156/263 (59%), Gaps = 19/263 (7%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSK F+RSAKN++ GYS  QVLVR ATSND   PS + L E+++R+FD+V+FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD--NVDES 118
           KRLNDKG+ W+H+AKSLT LD+LVR GSENCV WCK+NLYIIKTL+EF   D+   +D  
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 119 SIIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKA 178
            I+RVKAKELTALL+D+ERLKEER + L                   R   + D+DLQ+A
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGG--------RKNRRDDNEDDDDLQRA 172

Query: 179 LEESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
           LEESRITA         L    + D+  Q A                             
Sbjct: 173 LEESRITAEEEERRRKQLMMQGD-DSSLQAA--------LELSKEEEELRRLQQLQAQQQ 223

Query: 239 XXXXXXXXXXXXVYYDIFGNPIS 261
                       +YYDIFGNPIS
Sbjct: 224 AALWQQQQQQQPMYYDIFGNPIS 246

 Score =  158 bits (399), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 72/88 (81%), Positives = 80/88 (90%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQSISDK++ELNNLLASGTGIDTFGNTG+ R+PAQHT+TGTFINSQGTGYKQI ND 
Sbjct: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFL +QYTG+PSS I PS+TGYGF
Sbjct: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGF 447

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  218 bits (556), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 159/263 (60%), Gaps = 14/263 (5%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSK  +R AKN++ GYSTTQVL+R+ATSND   PS +++ EI++RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W K+NLYIIKTL+EF  ED+  VD+  
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKAL 179
           I+RVKA+ELTALLQD+ERL+EER +                     +     D+D+Q+AL
Sbjct: 121 IVRVKARELTALLQDEERLREERELK-----------GRNRRPRRRKNSDSYDDDMQRAL 169

Query: 180 EESRITAXXXXXX-XXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
           EESR+TA          L  YDN   D QTA                             
Sbjct: 170 EESRMTAEQEEAERRRKLEMYDNSADDLQTA-LQLSKEEEELRRLRELQMQQQMQQAQQQ 228

Query: 239 XXXXXXXXXXXXVYYDIFGNPIS 261
                       +YYD+FGNPIS
Sbjct: 229 MFGLQQQQTQQPMYYDVFGNPIS 251

 Score =  149 bits (376), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 80/89 (89%), Gaps = 1/89 (1%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQS++DK+++LNNLLASGTG+DTFGNTG  RIPAQHT+TGTFINSQGTGYKQ+ N P
Sbjct: 388 RTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMP 447

Query: 429 V-KKNPFLNNQYTGLPSSNIVPSHTGYGF 456
             K NPFL  QYTGLPS+++VPS+TGYGF
Sbjct: 448 QGKHNPFLGQQYTGLPSTSVVPSYTGYGF 476

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  207 bits (526), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 132/175 (75%), Gaps = 10/175 (5%)

Query: 5   FVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLN 64
            +RSAKN++KGYS+TQ LVRDATSN   NP  + L E+++ ++++++FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESSIIRV 123
            KGKYWKH+ KSL VLDYLVRFGSENCV+WCK+NLYIIKTL+EF  ED++ +D+  ++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 124 KAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKA 178
           +AKELT+LL D+ERL+EER++                   A  R +  D+DL++A
Sbjct: 121 RAKELTSLLMDEERLREERAL---------NRRGGGNRRRAKSRNSDDDDDLERA 166

 Score =  146 bits (368), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 87/133 (65%), Gaps = 10/133 (7%)

Query: 324 GSNNPFALNATINTSPIRXXXXXXXXXXXXXXXXXXXXXXXXXXXRTGNQSISDKYNELN 383
           GSNNPFALN                                    RTG+QSISDKY+ LN
Sbjct: 279 GSNNPFALN---------NKKLQQHTPEPSVIDTTLNTQAPLKQTRTGSQSISDKYSALN 329

Query: 384 NLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDPVKKNPFLNNQYTGLP 443
            LLA+GTGIDTFGNTG+QRIPAQHT+TGTFINSQGTGYKQ+  +    N FLN+QYTGLP
Sbjct: 330 TLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTNGF-NNVFLNSQYTGLP 388

Query: 444 SSNIVPSHTGYGF 456
           SSNIVPS TGYGF
Sbjct: 389 SSNIVPSQTGYGF 401

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  203 bits (517), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 147/263 (55%), Gaps = 10/263 (3%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQ +RSAKN+M GYS  QVLVR+ATSND   PS + + E+++R++ +V+FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN--VDES 118
           +RLNDK K W+H+AKSLTV DYLVR G+E CV W ++N++II+ L EF   D++   D  
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 119 SIIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKA 178
            +IRVKAKEL ALL+DDERLKEER++ L                         D DL++A
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGV-------DPDLKRA 173

Query: 179 LEESRITAXXXXXXXXXLAQYDNQDTDYQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
           LEESRITA         LA+      + Q A                             
Sbjct: 174 LEESRITA-EEEERRRKLAEKTEDAEELQAALQLSKEEEELRKLRELQQQREQQMAFWQQ 232

Query: 239 XXXXXXXXXXXXVYYDIFGNPIS 261
                       +YYDIFGNPI+
Sbjct: 233 QQVQQVQYQQQPMYYDIFGNPIT 255

 Score =  152 bits (383), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 76/88 (86%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQSISDKY ELN LLA+GTGIDTFGNTG  RI +QHT+T TFINS GTG+KQ+ N+P
Sbjct: 404 RTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNEP 463

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPFL  QYTGLPS+NIVPSHTGYGF
Sbjct: 464 PKHNPFLTTQYTGLPSTNIVPSHTGYGF 491

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  206 bits (523), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 145/242 (59%), Gaps = 33/242 (13%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MS+QFVRSAKN+MKGYS+TQVLVRDAT+ND   P  + L +I+  SFDSVDFFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNV--DES 118
           KRLND GKYW+HI KSLTVLDYLVRFGSE+C  W + +L+++K L+ F+  DD +  D+ 
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 119 SIIRVKAKELTALLQDDERL---KEERSINLXXXXXXXXX-------------------- 155
            I+RVKA++L  LLQ  E+L   K +R+                                
Sbjct: 121 QIVRVKARDLVELLQSGEQLGGRKAKRARGASRRDRGRRRGGDRGGGEYRQRGDDPEDEY 180

Query: 156 -XXXXXGTNATRRGTKS-------DEDLQKALEESRITAXXXXXXXXXLAQYDNQDTDYQ 207
                 G    R+G +S       D+DLQ+A+EES+ T          L+ YD +D ++Q
Sbjct: 181 YPRPAGGPPPQRQGYESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240

Query: 208 TA 209
            A
Sbjct: 241 AA 242

 Score =  139 bits (350), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (85%), Gaps = 4/90 (4%)

Query: 370 TGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQI---VN 426
           TGNQ +++KY+ELNNLLA GTG+DTFGN G QRIPAQHTQTGTFINSQGTG+KQ+     
Sbjct: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555

Query: 427 DPVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
           DP   NPFLN+QYTGLPS+ IVP++TGYGF
Sbjct: 556 DP-NSNPFLNSQYTGLPSTGIVPAYTGYGF 584

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  174 bits (441), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 97/188 (51%), Positives = 132/188 (70%), Gaps = 9/188 (4%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MSKQ +RSAKN++ GYS  Q+LVR+ATSN+   PS + + E+++RS+ +V+FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN--VDES 118
           KRL+DK K+W+H+AKSLTV D+LVR G+E CV W ++NLY+ + L EF   D++  VD  
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 119 SIIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATRRGTKSDEDLQKA 178
            IIRVKA+EL ALL+D+ERL+EER++ L                +        D DLQ+A
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVPPPAEDL-------DPDLQRA 173

Query: 179 LEESRITA 186
           LEESRITA
Sbjct: 174 LEESRITA 181

 Score =  157 bits (398), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 71/88 (80%), Positives = 80/88 (90%)

Query: 369 RTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDP 428
           RTGNQSI+DKY+ELN LLASGTG+DTFGNTG  RIPAQHT+TGTFINSQGTGYKQ+ N+P
Sbjct: 402 RTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNEP 461

Query: 429 VKKNPFLNNQYTGLPSSNIVPSHTGYGF 456
            K NPF+  QYTGLPS+N+VPSHTGYGF
Sbjct: 462 PKHNPFIATQYTGLPSTNMVPSHTGYGF 489

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 124/188 (65%), Gaps = 2/188 (1%)

Query: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60
           MS QFVRS KNM KGYS TQVLVRDAT+N+ S  S ++L ++ + S+D+ +F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119
           +R++DK KYW+H+AKSLTV+DYLVRFGSE CV W + N   ++ L++F   D   +D+  
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 120 IIRVKAKELTALLQDDERLKEERSINLXXXXXXXXXXXXXXGTNATR-RGTKSDEDLQKA 178
           +IRVKA EL  LL+D ERL  ER +N+                  +  R  + +ED+ +A
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180

Query: 179 LEESRITA 186
           LEES+ TA
Sbjct: 181 LEESKKTA 188

 Score =  106 bits (264), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 59/81 (72%), Gaps = 5/81 (6%)

Query: 370 TGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIV--ND 427
           TGN  IS KY+ LN LLA GTGIDTFGN G  RIPAQHT+TGTFINSQGTGYKQ+   + 
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSS 655

Query: 428 PVKKNPFLNNQYTGLPSSNIV 448
           P+   P L  QYTGLP+   V
Sbjct: 656 PI---PLLPTQYTGLPAQTAV 673

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 90.1 bits (222), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 89/143 (62%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+M  Y+  +  VR+AT+N+    S  ++ +IS+ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K    W+ I K+L +L+YL++ GSE  +   + +L +IK L+ F   D    +  I
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R KA+ LTALL+DDE+++ ER
Sbjct: 135 NVRNKAQSLTALLKDDEQIRAER 157

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 85/143 (59%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+NM+  Y+  +  VR+AT+N+    S  ++ +IS+ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K    W+ I K+L +LDYL+R G+E  +   + NL +IK L+ F   D    +  I
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R +A EL  LL DD +++ ER
Sbjct: 135 NVRNRAHELVLLLDDDGKIRTER 157

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 90/143 (62%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +I++ +++  + +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFK-LEDDNVDESS 119
           R  +K G  W+ I K+L +LDYL++ GSE  +   + +L +I+ L+ F  ++ +  D+  
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 120 IIRVKAKELTALLQDDERLKEER 142
            +R +AK L  LLQDD  +++ER
Sbjct: 135 NVRNRAKLLVELLQDDSNIRQER 157

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 85/143 (59%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +I++ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K    W+ I K+L +LDYL+R G+E  +   + NL +IK L+ F   D    +  I
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R +A EL  LL DD +++ ER
Sbjct: 135 NVRNRAHELALLLDDDAKVRAER 157

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 84.3 bits (207), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 86/143 (60%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +IS  +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K    W+ I K+L +L+YL++ GSE  +   + NL +IK L+ F   D    +  I
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R +A+EL  LL +D++++ ER
Sbjct: 135 NVRNRAQELVKLLNNDDQIRAER 157

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 85/143 (59%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +IS+ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           RL +K    W+ I K+L +LDYL+R  SE  +   + ++ +IK L+ F   D    +  I
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R +AK L  LL DDE ++ ER
Sbjct: 135 NVRNRAKALAELLSDDETIRAER 157

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 85/143 (59%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +IS+ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K G  W+ I K+L +LDYL++ GSE  +   + ++ +IK L+ F   D    +  I
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R + K L  LL DD +++ ER
Sbjct: 135 NVRTRVKALVELLSDDSKIRAER 157

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 86/143 (60%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++  I++ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K    W+ I K+L +L+YLV+ GSE  +   + NL ++K L+ F   D    +  I
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R +A +L  LL+ DE++++ER
Sbjct: 135 NVRNRASQLVKLLESDEQIRQER 157

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 87/143 (60%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  ++  +  VR+AT+N+    S  ++ +I++ +++  +  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFK-LEDDNVDESS 119
           R  +K G  W+ I K+L +LDYL+R GSE  +   +  L I++ L+ F  ++    D+  
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 120 IIRVKAKELTALLQDDERLKEER 142
            +R +AK++  LLQDD  +++ R
Sbjct: 135 NVRNRAKQIVELLQDDAAVRDAR 157

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 85/143 (59%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+M  Y+  +  VR+AT+N+    S  ++ +I++ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K    W+ I KS+ +L+YLV+ GSE  +   + NL +I+ L+ F   D    +  I
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R + K L  LL+DDE ++ ER
Sbjct: 135 NVRNRTKALVKLLEDDELIRAER 157

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 79.7 bits (195), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 86/147 (58%), Gaps = 13/147 (8%)

Query: 5   FVRSAKNMMKGYSTTQVLVRDATSNDS-SNPSFEILYEISKRSFDSVDFFEIMDMLDKRL 63
           F+RS +NM  G STT+V V+ AT +D  S  +  ++ EIS  ++ +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWK-------HIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLE-DDNV 115
           +  G Y K       HI K+LT++ YL+  GS + V W +Q  Y++ TL+EF +  D + 
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 116 DESSIIRVKAKELTALLQDDERLKEER 142
             +  +R+ + +L+ LL+DD  L+E R
Sbjct: 119 KMAEQVRMLSIKLSKLLKDDLMLQERR 145

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 81.3 bits (199), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 88/143 (61%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +I++ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFK-LEDDNVDESS 119
           R  +K G  W+ I K+L +L+YL+  G+E  +   + +L +I+ L+ F  ++ +  D+ +
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 120 IIRVKAKELTALLQDDERLKEER 142
            +R +A+ +T+LL  D+ ++  R
Sbjct: 135 NVRSRAQAMTSLLSSDDAIRSAR 157

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 87/143 (60%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +I++ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K G  W+ I KSL +LDYL+R GSE  +   + ++ +I+ L+ F   D    +  I
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R +AK L  LL DD ++++ER
Sbjct: 135 NVRNRAKALGELLSDDTKIRQER 157

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 85/143 (59%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N+M  Y+  +  VR+AT+N+    S  ++ +I++ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K    W+ I KSL + DYL++ GSE  +   + ++ +IK L+ F   D    +  I
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R KA+ L A L+DD+ ++ ER
Sbjct: 135 NVRNKAQSLVAFLKDDDLIRAER 157

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 85/143 (59%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +IS+ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K G  W+ I K+L +LDYL++ GSE  +   + ++ +IK L+ F   D    +  I
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R + K L  LL DD +++ ER
Sbjct: 135 NVRTRVKTLIELLSDDNKIRAER 157

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 85/143 (59%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +IS+ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K G  W+ I K+L +LDYL++ GSE  +   + ++ +I+ L+ F   D    +  I
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R + K L  LL DD +++ ER
Sbjct: 135 NVRTRVKALIELLSDDNKIRAER 157

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 85/143 (59%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +IS+ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K G  W+ I K+L +LDYL++ GSE  +   + ++ +I+ L+ F   D    +  I
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R + K L  LL DD +++ ER
Sbjct: 135 NVRTRVKALIDLLSDDNKIRAER 157

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 87/143 (60%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +I++ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFK-LEDDNVDESS 119
           R  +K G  W+ I K+L +LDYL++ GSE  +   + ++ ++K L+ F  ++ +  D+  
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 120 IIRVKAKELTALLQDDERLKEER 142
            +R +   L  LL+DD  +++ER
Sbjct: 135 NVRNRVTTLIELLRDDNSIRQER 157

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 78.2 bits (191), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 85/143 (59%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++  I++ +++  +  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K    W+ I K+L +L+YL++ GSE  +   + ++ ++K L+ F   D    +  I
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R +AK LT LL DD +++ ER
Sbjct: 170 NVRTRAKALTELLGDDNKIRAER 192

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 83/146 (56%), Gaps = 9/146 (6%)

Query: 5   FVRSAKNMMKGYSTTQVLVRDATSNDSSN-PSFEILYEISKRSFDSVDFFEIMDMLDKRL 63
            +++ +N+  G S+T+V  R+AT++D  N  +  ++ E+S  ++      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  NDKGKYWKH-----IAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDE- 117
           +   +   H     + K+LT++ YL+  GS+  V+W +  LY+I TLKEF       +  
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 118 SSIIRVKAKELTALLQDDERLKEERS 143
           +S IR  A  L A+L+D+E L++ RS
Sbjct: 121 ASQIRNLASSLAAILRDEELLRQRRS 146

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 83/143 (58%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+S      ++ +I++ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI 120
           R  +K    W+ I KS+ +L+YL+  GSE  +   +  L +IK L+ F   D    +  I
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 -IRVKAKELTALLQDDERLKEER 142
            +R + + L  LL +DE+++ ER
Sbjct: 135 NVRNRTQALVQLLNNDEQIRIER 157

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 78/134 (58%), Gaps = 7/134 (5%)

Query: 17  STTQVLVRDAT-SNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDKG-----KYW 70
           STT++ V+ AT  N+SS  +  ++ EIS  ++      EI+ ++ KRL   G     K  
Sbjct: 13  STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGHGRRNSHKIC 72

Query: 71  KHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDE-SSIIRVKAKELT 129
            H+ K+LT++ YL+  GS + + W + N+ ++  LKEF ++D N ++    IR  +++L 
Sbjct: 73  IHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKIGQQIRAMSQDLC 132

Query: 130 ALLQDDERLKEERS 143
            L++DD+ L+  R+
Sbjct: 133 TLIKDDDLLENRRA 146

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 77/136 (56%), Gaps = 7/136 (5%)

Query: 15  GYSTTQVLVRDATSNDS-SNPSFEILYEISKRSFDSVDFFEIMDMLDKRL--NDKGKYWK 71
           G S T++  ++AT++D  S  +  ++ EIS  ++ S    EI  ++ KRL  N++    K
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 72  ---HIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSI-IRVKAKE 127
              HI K+LT+  YL+  GS   V W +  +Y+I +LKEF +     +  ++ IR  A  
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERMAVQIRSLAST 130

Query: 128 LTALLQDDERLKEERS 143
           L+ +L+DDE L++ RS
Sbjct: 131 LSVILRDDELLRQRRS 146

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 87/143 (60%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT+N+    S  ++ +I++ +++  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFK-LEDDNVDESS 119
           R  +K G  W+ I K+L +L+YL++ GSE  +   + ++ I+K L+ F  ++    D+  
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 120 IIRVKAKELTALLQDDERLKEER 142
            +R +A  LTALL DD  ++ ER
Sbjct: 135 NVRNRAAALTALLADDSSIRAER 157

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 73/133 (54%), Gaps = 7/133 (5%)

Query: 17  STTQVLVRDATS-NDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDKGKY-----W 70
           S T+  V++AT  N++S  +  ++ EIS  ++      EI+ +L KRL    K       
Sbjct: 13  SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGSSKKSSHRNC 72

Query: 71  KHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFK-LEDDNVDESSIIRVKAKELT 129
            HI K++T++ YL+  GS + + W + N+ I + LK+F+ + +D+   +  IR  A +L 
Sbjct: 73  VHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEKMAEQIRYIAGDLC 132

Query: 130 ALLQDDERLKEER 142
            L+ DDE L+  R
Sbjct: 133 ILINDDELLEARR 145

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 77/143 (53%), Gaps = 2/143 (1%)

Query: 2   SKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDK 61
           +K+F R A+N +   +  +  VR+AT+ND    S  ++ +I+  +F+     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119
           R  +K G  W+ I KS+ +L YL+  GS   V   K NL +IK L  F+  DD   ++SS
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 120 IIRVKAKELTALLQDDERLKEER 142
            I    + L  L+ DD  L + R
Sbjct: 135 KISKATERLIELMTDDHLLNDLR 157

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 82/138 (59%), Gaps = 11/138 (7%)

Query: 15  GYSTTQVLVRDAT-SNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDKGKYWK-- 71
           G STTQ+ V+ AT SN+S   +  ++ E+S  ++      EI +++ KRL +     K  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSIIRVK-- 124
                 + K+LT+++YL+  GSE  VLW +++L  I+ LK++   +D  D+S + ++K  
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDK-DKSKVKQIKSL 129

Query: 125 AKELTALLQDDERLKEER 142
           +++++  L++D+ L++ R
Sbjct: 130 SEDISKNLKEDDFLEKRR 147

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 81/147 (55%), Gaps = 13/147 (8%)

Query: 5   FVRSAKNMMKGYSTTQVLVRDATSNDSSNPSF-EILYEISKRSFDSVDFFEIMDMLDKRL 63
           F+ S +++  G S+T V V+ AT +   N ++  ++ EI+  ++      EI  +L KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  NDKGKYWK-------HIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVD 116
              G Y K       ++ K+LT++ +LV  GSE C+ W +++L +I++ ++F L D    
Sbjct: 61  --VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKK 118

Query: 117 ES-SIIRVKAKELTALLQDDERLKEER 142
           +  + I++ + +L  LL D   L++ R
Sbjct: 119 QMVNQIQLLSCKLCQLLTDSNLLEDMR 145

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 73/134 (54%), Gaps = 8/134 (5%)

Query: 17  STTQVLVRDATSND-SSNPSFEILYEISKRSFDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D +S  +  ++ EIS  ++      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDES-SIIRVKAKEL 128
              + K+LT++ YL+  GS   + W K N+ +I+ L++F+ +D   D +   IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNL 132

Query: 129 TALLQDDERLKEER 142
             LLQDDE L+ +R
Sbjct: 133 HELLQDDELLERQR 146

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 79/143 (55%), Gaps = 10/143 (6%)

Query: 8   SAKNMMKGYSTTQVLVRDATS-NDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDK 66
           S +N ++  S T++ VR AT  N++S  +  ++ EIS  ++ +    EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGY 63

Query: 67  GKYWKH-----IAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSII 121
           GK   H     I K+LT++ YL+  GS   + W  +N  + + +K F++ D   DE   I
Sbjct: 64  GKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSDTIHDEKFAI 123

Query: 122 RVK--AKELTALLQDDERLKEER 142
           +++  ++ +  L+ + E L+++R
Sbjct: 124 QIRDLSERILELINNRELLEQKR 146

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 78/144 (54%), Gaps = 13/144 (9%)

Query: 8   SAKNMMKGYSTTQVLVRDATSND-SSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLN-- 64
           S +N ++  S T+  VR AT +D +S  +  ++ EIS  ++      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 65  ---DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFK---LEDDNVDES 118
              +  K   HI K+LT++ YL+  GS + + W + N+ + + LK F+   LED+ + + 
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMGQQ 123

Query: 119 SIIRVKAKELTALLQDDERLKEER 142
             I     ++  ++ DD+ L+++R
Sbjct: 124 --IVFICNDICNIINDDDMLEQKR 145

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 72/136 (52%), Gaps = 9/136 (6%)

Query: 15  GYSTTQVLVRDATSNDS-SNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDKGKYWKH- 72
           G S+T++ VR AT+ D  +  +  ++ EIS  ++      EI  +L +RL+  G+   H 
Sbjct: 11  GPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTSHK 70

Query: 73  ----IAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDE--SSIIRVKAK 126
               I K+LT++ YL+  GSE  V W + NL   + LK  ++     DE  +  IR  + 
Sbjct: 71  NSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKR-DEPLAKQIRSMSN 129

Query: 127 ELTALLQDDERLKEER 142
           ++   ++DDE L+ ++
Sbjct: 130 QICDCVKDDELLENKK 145

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 72/134 (53%), Gaps = 8/134 (5%)

Query: 17  STTQVLVRDATSND-SSNPSFEILYEISKRSFDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D +S  +  ++ EIS  ++      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLED-DNVDESSIIRVKAKEL 128
              + K+LT++ YL+  GS   + W K N+ +I+ L+ F ++D  +  +   IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNL 132

Query: 129 TALLQDDERLKEER 142
             LLQDD  L+++R
Sbjct: 133 LELLQDDGLLEKQR 146

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 69/135 (51%), Gaps = 11/135 (8%)

Query: 17  STTQVLVRDATSNDSS-NPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDKGKYWKH--- 72
           S T+  V+ AT+ D +   +  ++ EIS  ++      EI+ +L KRL+   +   H   
Sbjct: 13  SPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRKTSHKNC 72

Query: 73  --IAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLE---DDNVDESSIIRVKAKE 127
             I K+LT++ YL+  GS   V W + N  +I  L   K+E   DD +     I+  A +
Sbjct: 73  IFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPE--IKSIAAD 130

Query: 128 LTALLQDDERLKEER 142
           L  L+QDD+ L+E R
Sbjct: 131 LMELIQDDDLLEERR 145

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 76/138 (55%), Gaps = 14/138 (10%)

Query: 19  TQVLVRDATS-NDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND---KGKYWKH-- 72
           T+  V+ AT  N+++  +  ++ EIS  ++      +I+ ++ KRL+      K   H  
Sbjct: 15  TESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSATSSNKKLSHKT 74

Query: 73  ---IAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKE---FKLEDDNVDESSI--IRVK 124
              I K+LT++ YL+  GS   + W + N Y+++ + +   F+L+D++ D   I  I+V 
Sbjct: 75  SVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDNSADSKMIGQIKVI 134

Query: 125 AKELTALLQDDERLKEER 142
           A+++T L+ ++  L++ R
Sbjct: 135 AEDMTNLINNENLLEQRR 152

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 68/135 (50%), Gaps = 7/135 (5%)

Query: 15  GYSTTQVLVRDATS-NDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT  N+    S  ++ EI+  ++      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESSIIRVKAKE 127
              HI K+LT+ +YL+  GSE+ V W +    +++ LK+F   ++ +   +S IR  +  
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIRSFSLS 130

Query: 128 LTALLQDDERLKEER 142
           L  L+Q+   L++ R
Sbjct: 131 LLELMQNPALLEDHR 145

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 77/169 (45%), Gaps = 30/169 (17%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D+  P+ + L ++ +  +  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLVRFGSE----NCVLWC--KQNLY 100
                               G  W+ + K L V+D+L+   SE    N VL C       
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSCLTTHKHI 138

Query: 101 IIKTLKEFKLEDDNVDESSI----IRVKAKELTALLQDDERLKEERSIN 145
           + + +  FK++  N  +  I    IR K +++   ++D   LK+ERS N
Sbjct: 139 LTREIPNFKVKFSNDGKMEIHERGIRKKGEDILQYMEDPHFLKKERSKN 187

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 57/103 (55%), Gaps = 7/103 (6%)

Query: 17  STTQVLVRDATSND-SSNPSFEILYEISKRSFDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D +S  +  ++ EIS  ++      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLED 112
              + K+LT++ YL+  GS   + W K N+ +I+ L++F+++D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 57/103 (55%), Gaps = 7/103 (6%)

Query: 17  STTQVLVRDATSND-SSNPSFEILYEISKRSFDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D +S  +  ++ EIS  ++      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLED 112
              + K+LT++ YL+  GS   + W K N+ +++ L++F+++D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 61/112 (54%), Gaps = 8/112 (7%)

Query: 8   SAKNMMKGY--STTQVLVRDATS-NDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLN 64
           S  +  KG+  S T++ VR AT  N+ +  +  ++ EIS  ++      +++ ++ KRL+
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 65  -----DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLE 111
                +  +   H+ K+LT++ YL+  GS + + W K + Y+I+ L  F+ +
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSFEAQ 113

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 7/91 (7%)

Query: 22  LVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
           LV+ AT   S+ P  + L  I   + +  DF+EI+  LD R+ND    W  + KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVLWCKQNLYIIKTLKEFKLED 112
            ++R GS++  L      Y  + L+ F +E+
Sbjct: 65  LMIREGSKDVALR-----YYSRNLEFFDIEN 90

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 79/172 (45%), Gaps = 36/172 (20%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ VR AT+ D+  P+ + L ++ +  F  V  + + + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLID 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKQN 98
                               G  W+ + K LTV++YL   V  G E     +C+L  K  
Sbjct: 79  HIATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLLLNVNDGDELNQIKSCLLTHKH- 137

Query: 99  LYIIKTLKEFKLEDDN-----VDESSIIRVKAKELTALLQDDERLKEERSIN 145
             + + +  FK++  N     V E S IR K +++  +L D   LK+ER  N
Sbjct: 138 -ILTREVLNFKIKFSNDGKMEVHERS-IRKKGEKILQMLDDSRFLKQERLAN 187

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 72/167 (43%), Gaps = 30/167 (17%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT+ DS  P+ + L ++ +  ++ V  F + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLV----RFGSENCVLWCKQNLYII 102
                               G  W+ + K L +L+YL+    R    + VL C Q    I
Sbjct: 79  HMAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHI 138

Query: 103 KTLKEFKLEDDNVDESSI------IRVKAKELTALLQDDERLKEERS 143
            T +  +   D   +  +      I+ K + +  L++D   LK ERS
Sbjct: 139 LTKETMQYRVDFSSDGKMELHERGIKKKCEHIIQLIEDTSYLKRERS 185

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 22  LVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
           LV+ AT   S+ P  + L  I   +    DF+EI+  LD R+ND    W  + K+L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  YLVRFGSENCVLWCKQNLYIIKTLKEFKLED 112
            ++R G ++  L      Y  + L+ F +E+
Sbjct: 65  LMMREGKKDVALR-----YYSRNLEFFSIEN 90

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 59/118 (50%), Gaps = 12/118 (10%)

Query: 22  LVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
           LV+ AT    + P  + +  I   + DS +F EIM  L+ R+ND    W  + KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDNVDESSIIRVKAKELTALLQDDERLK 139
            ++R G  +  +      Y+   L+ F+L D  V  S   ++ + +L AL + +E LK
Sbjct: 65  LMMRDGDRDVTIK-----YLSHHLEFFQLRD--VFHS---KLSSGDLQALKRYNEYLK 112

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 76/168 (45%), Gaps = 34/168 (20%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT+ DS  P+ + L ++ +  +  V  + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKQN 98
                               G  W+ + K L V++YL   V  G E     +C+L  K  
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLLMNVDDGDEINQVRSCLLTHKH- 137

Query: 99  LYIIKTLKEFKLEDDNVDESSI----IRVKAKELTALLQDDERLKEER 142
             I K +  FK++  N  +  +    IR K + +   ++D + LK+ER
Sbjct: 138 -LISKEVLNFKIKFSNDGKMEVHERGIRKKGELIMQFIEDSKFLKQER 184

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 80/156 (51%), Gaps = 22/156 (14%)

Query: 5   FVRSAKNMMKGYSTTQVLVRDAT-SNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRL 63
           F  S +N++  YS T++ VR AT  N+    +  ++ EIS  ++ +    EI+ +L K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLED 112
                  N  G    K    + K+ T++ YL+  GS + + W K N  +++ L   K++ 
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILA--KVDS 118

Query: 113 DNV---DESSIIRVKAKELTA---LLQDDERLKEER 142
           +N    DE   I  +A+++T    LL +D +L E+R
Sbjct: 119 NNHITDDEDLHILNQAQKITKDIILLINDNKLLEKR 154

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 75/170 (44%), Gaps = 38/170 (22%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   QV VR AT+ DS  P+ + L ++ +  +  V  + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKQN 98
                               G  W+ + K LTV++YL   V  G E     +C+   K  
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLLLNVSDGDELNQVRSCLTTHKHI 138

Query: 99  L------YIIKTLKEFKLEDDNVDESSIIRVKAKELTALLQDDERLKEER 142
           L      Y +K   + K+E   V E   I+ K + +  +L+D + LK ER
Sbjct: 139 LSREVLEYRVKFSNDGKME---VHERG-IKKKCEFIIQMLEDSQFLKRER 184

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 7/91 (7%)

Query: 22  LVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
           LV+ AT   S+ P  + L  I   +    DF+EI+  L+ R+ND    W  + KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVLWCKQNLYIIKTLKEFKLED 112
            ++R G+++  L      Y  + L+ F +E+
Sbjct: 65  LMIREGAKDVALR-----YYSRNLEFFDIEN 90

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 73/167 (43%), Gaps = 30/167 (17%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ DS  P+ + L+++ +  +  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKQN 98
                               G  W+ + K L VL+YL   V  GSE     +C+L  K  
Sbjct: 79  HIASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCLLTHKHI 138

Query: 99  LY--IIKTLKEFKLEDDNVDESSIIRVKAKELTALLQDDERLKEERS 143
           L   +++   +F  +         I+ K +++   ++D   LK ER+
Sbjct: 139 LTRDVMQFRVDFSADGKMEVHERGIKKKCEQMIQYIEDPAYLKRERA 185

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 79/172 (45%), Gaps = 38/172 (22%)

Query: 7   RSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFF--------EIMDM 58
           R  +NM+  Y   Q+ +R AT+ D+  P+ + L ++ +  + SV  +         I+D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 59  LDKR---LNDK--------GKYWKHIAKSLTVLDYLVRFGSE----NCVLWCKQNL---- 99
           L KR   L +K        G  W+ I K L V++YL+   SE    N V  C +N     
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLENHKQIF 139

Query: 100 ------YIIKTLKEFKLEDDNVDESSIIRVKAKELTALLQDDERLKEERSIN 145
                 Y I+   + K+E   V E  I + K + +  L+ D E L+EERS N
Sbjct: 140 NSNILNYKIEFCNDGKME---VHERGIQK-KCEVIINLVDDPEFLREERSKN 187

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 76/167 (45%), Gaps = 30/167 (17%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ DS  P+ + L+++ +  +  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-NCVLWC--KQNLY 100
                               G  W+ + K L VL+YL   V  GSE + V+ C       
Sbjct: 79  HIASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTTHKRI 138

Query: 101 IIKTLKEFKLE---DDNVD-ESSIIRVKAKELTALLQDDERLKEERS 143
           + + + +F+++   D  ++     I+ K +++   L+D   LK ER+
Sbjct: 139 LSRDVMQFRVDFSADGKMEVHERGIKKKCEQILQYLEDPSYLKRERA 185

>Suva_2.315 Chr2
           complement(560767..560940,560968..561033,561037..562005)
           [1209 bp, 403 aa] {ON} YDR153C (REAL)
          Length = 403

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 78/171 (45%), Gaps = 34/171 (19%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D+  P+ + L ++ +  +  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKQN 98
                               G  W+ + K L V+++L   V  G E     +C+L  K  
Sbjct: 79  HIATRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLLLNVDTGDELNQIRSCLLTHKHI 138

Query: 99  LYIIKTLKEFKLEDDNVDESSI----IRVKAKELTALLQDDERLKEERSIN 145
           L   + + +FKL+  N  +  +    IR K + +   L+D + LK+ER+ N
Sbjct: 139 L--TREIAQFKLKFSNDGKMEVHERGIRKKGELILQYLEDPQFLKKERAKN 187

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 75/166 (45%), Gaps = 30/166 (18%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D+  P+ + L ++ +  +  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-NCVLWC--KQNLY 100
                               G  W+ + K LTV++YL   V  G E N V+ C       
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRCLDTHKHI 138

Query: 101 IIKTLKEFKLEDDNVDESSI----IRVKAKELTALLQDDERLKEER 142
           + + +  +K+   N  +  I    IR K +++   L+D   LK+ER
Sbjct: 139 LTREIPMYKVGFSNDGKMEIHERGIRKKGEDILQYLEDPSFLKQER 184

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 66/142 (46%), Gaps = 16/142 (11%)

Query: 17  STTQVLVRDATSNDS--SNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDKGKYWKHIA 74
           STT++ V+ AT +    S+ +  ++ EIS  ++      EI  +L KR +      + + 
Sbjct: 13  STTELKVKQATDDSEVLSSSTGTVMNEISVLTYSPKTLKEIQSVLRKRFHLMSTLPRKVL 72

Query: 75  --------KSLTVLDYLVRFGSENCVLWCKQNLYIIKTLK-----EFKLEDD-NVDESSI 120
                   K+LT++ +L+  GS   V W K N+   + L+     EF   D  ++     
Sbjct: 73  HRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITEFSFTDKADLPMYEQ 132

Query: 121 IRVKAKELTALLQDDERLKEER 142
           IR  A ++  L+ DD  L+E R
Sbjct: 133 IRQSASDILQLIGDDNLLEERR 154

>YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}
           ENT5Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p, clathrin adaptor complex AP-1, and
           clathrin
          Length = 411

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 78/171 (45%), Gaps = 34/171 (19%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT+ D+  P+ + L ++ +  +  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKQN 98
                               G  W+ + K L V+++L   V  G E     +C+L  K  
Sbjct: 79  HIATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLLLNVDTGDELNQIRSCLLTHKH- 137

Query: 99  LYIIKTLKEFKLEDDNVDESSI----IRVKAKELTALLQDDERLKEERSIN 145
             + + + +FK++  N  +  I    IR K + +   L+D + LK+ER+ N
Sbjct: 138 -ILTREIAQFKVKFSNDGKMEIHERGIRKKGELILQYLEDSQFLKKERAKN 187

>Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON}
           YDR153C (REAL)
          Length = 416

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 78/171 (45%), Gaps = 34/171 (19%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT+ D+  P+ + L ++ +  +  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKQN 98
                               G  W+ + K L V+++L   V  G E     +C+L  K  
Sbjct: 79  HIATRPKNFYEKARKDYVNYGSEWRVVLKCLAVIEFLLLNVDTGDELNQIRSCLLTHKH- 137

Query: 99  LYIIKTLKEFKLEDDNVDESSI----IRVKAKELTALLQDDERLKEERSIN 145
             + + + +FK++  N  +  I    IR K + +   L+D + LK+ER+ N
Sbjct: 138 -ILTREIAQFKVKFSNDGKMEIHERGIRKKGELILQYLEDAQFLKKERAKN 187

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 73/173 (42%), Gaps = 38/173 (21%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D+  P+ + L ++ +  +  V  + + + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLV--------------RFGSENCV 92
                               G  W+ + K LTV+++L+                 +   +
Sbjct: 79  HIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLMLNVDEGDELNQIRSSLQTHKHI 138

Query: 93  LWCKQNLYIIKTLKEFKLEDDNVDESSIIRVKAKELTALLQDDERLKEERSIN 145
           L  +   Y +K   + K+E   V E   IR K + +   ++D   LK ER+ N
Sbjct: 139 LTREVAQYRVKFSNDGKME---VHERG-IRKKGETIVQFMEDPHFLKRERNKN 187

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 75/167 (44%), Gaps = 32/167 (19%)

Query: 7   RSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ DS  P+ + L+++ +  +  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKYWKHIAKSLTVLDYL---VRFGSE-NCVLWC--KQNLYI 101
                              G  W+ + K L VL+YL   V  GSE + V+ C       +
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTTHKRIL 139

Query: 102 IKTLKEFKLE-----DDNVDESSIIRVKAKELTALLQDDERLKEERS 143
            + + +F+++        V E   I+ K +++   L+D   LK ER+
Sbjct: 140 SRDVMQFRVDFSADGKMEVHERG-IKKKCEQILQYLEDPSYLKRERA 185

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   Q+ +R AT+ DS  P+ + L +I     + V   +I+D + KRL D
Sbjct: 20  ARYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQI-LLDRNKVPLRKIVDYIMKRLMD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLV 84
                               G  W+ + KSL VL +L+
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLL 116

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 73/168 (43%), Gaps = 34/168 (20%)

Query: 6   VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT+ D+  P+ + L ++ +  +  V  + + + + KR+ D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKQN 98
                               G  W+ + K L V+D+L   V  G E     +C+L  K  
Sbjct: 79  HIAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSCMLTHKHI 138

Query: 99  LYIIKTLKEFKLEDDNVDESSI----IRVKAKELTALLQDDERLKEER 142
           L     +  +K+   N  +  I    IR K++ +   + D   L+EER
Sbjct: 139 L--TSQVASYKIPFSNDGKMEIHERGIRKKSELILQYMDDPRFLREER 184

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ VR A++ D+  P+ + L ++ +  + SV  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWKHIAKSLTVLDYLV 84
                              G  W+ + K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>KAFR0A08340 Chr1 complement(1670622..1672085) [1464 bp, 487 aa]
           {ON} Anc_3.62 YNL295W
          Length = 487

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 5/91 (5%)

Query: 48  DSVDFFEIMDMLDKRLNDKGKYWKHIAKSLTVLDYL--VRFGSENCVLWCKQNLYIIKTL 105
           D VD F+I  + +KRL  +GKY    + SL    YL   +   E      ++N +II+  
Sbjct: 239 DMVDLFDIHTLRNKRLETRGKYPIQ-STSLQDKYYLEAKQKYEEEIRFLARRNTFIIE-- 295

Query: 106 KEFKLEDDNVDESSIIRVKAKELTALLQDDE 136
            + KL++D  + S+ I  +  ELT L  +D+
Sbjct: 296 DQLKLKNDINNLSAFISERFHELTKLTINDD 326

>Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}
          similar to Ashbya gossypii AGR046C
          Length = 408

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 6  VRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLDKRLND 65
           R A+NM+  Y   QV +R AT+ DS  P+ + L ++ +  +  V  + I +   KRL D
Sbjct: 20 ARFAQNMIIQYEPYQVDIRRATNTDSWGPTPKQLAKVMRNRY-QVPMYLITEYTMKRLVD 78

Query: 66 KGKYWKHIAK 75
                H+AK
Sbjct: 79 ------HMAK 82

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,705,456
Number of extensions: 1387143
Number of successful extensions: 3685
Number of sequences better than 10.0: 98
Number of HSP's gapped: 3690
Number of HSP's successfully gapped: 128
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)