Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0D00100na 1ON1881888671e-120
YEL028WsingletonOFF1531042455e-26
NDAI0G02090na 2ON2041302356e-24
Skud_12.78singletonOFF74741752e-16
KAFR0I02160singletonON1831371743e-15
KAFR0C01900singletonON2811371549e-12
KAFR0C01890singletonON2941401503e-11
Suva_2.521singletonOFF82751343e-10
KAFR0D00810singletonON298911213e-07
KAFR0H00780singletonON1971111184e-07
KAFR0B03000singletonON224671001e-04
KAFR0C06105singletonON14764971e-04
KAFR0B02990singletonON20567963e-04
KAFR0H03580singletonON279175880.005
KAFR0C05240singletonON278153810.042
KAFR0H03575singletonON16966780.069
Suva_7.2574.98ON71878740.41
Smik_7.2684.98ON71878720.71
YGL022W (STT3)4.98ON71878720.76
Skud_7.2654.98ON71878710.82
KAFR0D040801.54ON61381672.7
NOTE: 1 genes in the same pillar as NDAI0D00100 were not hit in these BLAST results
LIST: NCAS0B00320

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0D00100
         (188 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0D00100 Chr4 complement(5012..5578) [567 bp, 188 aa] {ON}         338   e-120
YEL028W Chr5 (98668..99129) [462 bp, 153 aa] {OFF} Dubious open ...    99   5e-26
NDAI0G02090 Chr7 complement(470955..471569) [615 bp, 204 aa] {ON}      95   6e-24
Skud_12.78 Chr12 (160111..160317,160324..160338) [222 bp, 74 aa]...    72   2e-16
KAFR0I02160 Chr9 (443701..444252) [552 bp, 183 aa] {ON}                72   3e-15
KAFR0C01900 Chr3 (378265..379110) [846 bp, 281 aa] {ON}                64   9e-12
KAFR0C01890 Chr3 (376624..377508) [885 bp, 294 aa] {ON}                62   3e-11
Suva_2.521 Chr2 (931884..931919,931923..931955,931959..932135) [...    56   3e-10
KAFR0D00810 Chr4 complement(174632..175528) [897 bp, 298 aa] {ON}      51   3e-07
KAFR0H00780 Chr8 (145265..145858) [594 bp, 197 aa] {ON}                50   4e-07
KAFR0B03000 Chr2 (626140..626814) [675 bp, 224 aa] {ON}                43   1e-04
KAFR0C06105 Chr3 complement(1213832..1214275) [444 bp, 147 aa] {...    42   1e-04
KAFR0B02990 Chr2 (625303..625920) [618 bp, 205 aa] {ON}                42   3e-04
KAFR0H03580 Chr8 (678010..678849) [840 bp, 279 aa] {ON}                39   0.005
KAFR0C05240 Chr3 complement(1049204..1050040) [837 bp, 278 aa] {...    36   0.042
KAFR0H03575 Chr8 (676359..676868) [510 bp, 169 aa] {ON}                35   0.069
Suva_7.257 Chr7 (443247..445403) [2157 bp, 718 aa] {ON} YGL022W ...    33   0.41 
Smik_7.268 Chr7 (444398..446554) [2157 bp, 718 aa] {ON} YGL022W ...    32   0.71 
YGL022W Chr7 (452404..454560) [2157 bp, 718 aa] {ON}  STT3Subuni...    32   0.76 
Skud_7.265 Chr7 (455547..457703) [2157 bp, 718 aa] {ON} YGL022W ...    32   0.82 
KAFR0D04080 Chr4 complement(804693..806534) [1842 bp, 613 aa] {O...    30   2.7  

>NDAI0D00100 Chr4 complement(5012..5578) [567 bp, 188 aa] {ON}
          Length = 188

 Score =  338 bits (867), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 173/188 (92%)

Query: 1   MVAISQXXXXXXXXXXXXXXXIRNGIIDSPLPRDNTTLVDALNLMRCAQVWGMPNDTIVA 60
           MVAISQ               IRNGIIDSPLPRDNTTLVDALNLMRCAQVWGMPNDTIVA
Sbjct: 1   MVAISQLLVFFLVVRTVLAVTIRNGIIDSPLPRDNTTLVDALNLMRCAQVWGMPNDTIVA 60

Query: 61  TDRTETLILFNNRTTTNTTHMKEIANHCFSRFGYTLAFTHYNYKYFPGELTHICTLDDAL 120
           TDRTETLILFNNRTTTNTTHMKEIANHCFSRFGYTLAFTHYNYKYFPGELTHICTLDDAL
Sbjct: 61  TDRTETLILFNNRTTTNTTHMKEIANHCFSRFGYTLAFTHYNYKYFPGELTHICTLDDAL 120

Query: 121 RNWDLLPTFARNELIAETQRGPTSTSTFISHKDTSEYYFMVMAVLFLVIIYSLLMRATAK 180
           RNWDLLPTFARNELIAETQRGPTSTSTFISHKDTSEYYFMVMAVLFLVIIYSLLMRATAK
Sbjct: 121 RNWDLLPTFARNELIAETQRGPTSTSTFISHKDTSEYYFMVMAVLFLVIIYSLLMRATAK 180

Query: 181 SVPSMATK 188
           SVPSMATK
Sbjct: 181 SVPSMATK 188

>YEL028W Chr5 (98668..99129) [462 bp, 153 aa] {OFF} Dubious open
           reading frame unlikely to encode a protein, based on
           available experimental and comparative sequence data
          Length = 153

 Score = 99.0 bits (245), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 65/104 (62%)

Query: 30  PLPRDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKEIANHCF 89
           P  RDNTTL DA N+++  QV G P++ I ATD   T I+F+NRT  NTT M +  ++C+
Sbjct: 32  PSLRDNTTLTDARNVLKYLQVLGFPSNKIAATDTVGTFIIFSNRTEANTTAMTKTVSYCY 91

Query: 90  SRFGYTLAFTHYNYKYFPGELTHICTLDDALRNWDLLPTFARNE 133
             +G++  FTHY Y YFP  ++++  L DA  N   LP F  N+
Sbjct: 92  RNYGHSFYFTHYKYDYFPSGISYMAKLGDATVNHTDLPHFRNNK 135

>NDAI0G02090 Chr7 complement(470955..471569) [615 bp, 204 aa] {ON}
          Length = 204

 Score = 95.1 bits (235), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 71/130 (54%), Gaps = 1/130 (0%)

Query: 29  SPLPRDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKEIANHC 88
            PLPRD TT  D  N++RC Q+ G+ N TI+AT     L++F+NRT  N T + ++ + C
Sbjct: 71  GPLPRDGTTKTDTYNVLRCMQLLGVSNTTIIATSEVNDLVVFHNRTIVNMTCVVKVTSRC 130

Query: 89  FSRFGYTLAFTHYNYKYFPGELTHICTLDDALRNWDLLPTFARNELIAETQRGPTSTSTF 148
           + R+GY +A  ++ Y  FP ELT + TL D L     LP F R + + +  R  T  +  
Sbjct: 131 YLRYGYEIAMENFFYAEFPSELTRLGTLGDVLDGNVDLPEFKRFDRMKD-PRNSTEAALA 189

Query: 149 ISHKDTSEYY 158
              +    YY
Sbjct: 190 TCGRTVGGYY 199

>Skud_12.78 Chr12 (160111..160317,160324..160338) [222 bp, 74 aa]
           {OFF} YEL028W (HSP)
          Length = 74

 Score = 72.0 bits (175), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 34  DNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKEIANHCFSRFG 93
           DNTTL DA +++RC Q++G  N TIVATD    L ++NNRTT NTT +K I   C   FG
Sbjct: 1   DNTTLTDARSILRCLQLFGFLNSTIVATDMGNGLAVYNNRTTINTTELKGITVRCHIFFG 60

Query: 94  YTLAFTHYNYKYFP 107
           Y L F  +  K FP
Sbjct: 61  YVLTF--HIIKLFP 72

>KAFR0I02160 Chr9 (443701..444252) [552 bp, 183 aa] {ON} 
          Length = 183

 Score = 71.6 bits (174), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 71/137 (51%), Gaps = 2/137 (1%)

Query: 28  DSPLPRDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNN-RTTTNTTHMKEIAN 86
           D PLPRD +T  DALN++RC QV G PN T +  ++   L+         NT++++ ++ 
Sbjct: 44  DVPLPRDKSTATDALNILRCVQVNGYPNATQIGKEQDGILVFLPGIYEVFNTSYVRNVS- 102

Query: 87  HCFSRFGYTLAFTHYNYKYFPGELTHICTLDDALRNWDLLPTFARNELIAETQRGPTSTS 146
            C + +G+ +  + ++   F  ++T I TL + + +   +    R   I E+  G T+  
Sbjct: 103 ACSTIYGFGVQVSIHSGSQFDDDVTFIGTLAELVADRTQITGLTRASYIVESDLGGTAVD 162

Query: 147 TFISHKDTSEYYFMVMA 163
           +    + TS YY+  MA
Sbjct: 163 SPYLQRRTSTYYYAYMA 179

>KAFR0C01900 Chr3 (378265..379110) [846 bp, 281 aa] {ON} 
          Length = 281

 Score = 63.9 bits (154), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 67/137 (48%), Gaps = 2/137 (1%)

Query: 28  DSPLPRDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNN-RTTTNTTHMKEIAN 86
           D PLPRDNTT +DALN++RC Q  G PN T+V  +    L          NT++++ ++ 
Sbjct: 28  DVPLPRDNTTSIDALNVLRCVQANGYPNSTLVGLEDGGFLAFLPGVEEAFNTSYVRNVS- 86

Query: 87  HCFSRFGYTLAFTHYNYKYFPGELTHICTLDDALRNWDLLPTFARNELIAETQRGPTSTS 146
            C S +G+ +  +  +   F  +   I TL D +     +   AR   I   Q    +TS
Sbjct: 87  ACNSIYGHHMLVSIQSGTNFEDDTHPIGTLADIISAQTRIDGIARATRIPRIQTDLQTTS 146

Query: 147 TFISHKDTSEYYFMVMA 163
           +    + TS YY+  MA
Sbjct: 147 SQRLERRTSSYYYSYMA 163

>KAFR0C01890 Chr3 (376624..377508) [885 bp, 294 aa] {ON} 
          Length = 294

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 66/140 (47%), Gaps = 8/140 (5%)

Query: 28  DSPLPRDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTT-NTTHMKEIAN 86
           D PLPRDNTT VDALN++RC QV G PN T++  D    L          NT++ + ++ 
Sbjct: 41  DVPLPRDNTTSVDALNVLRCVQVNGYPNSTLLGVDNDGFLAFLPGVNNIFNTSYARNVS- 99

Query: 87  HCFSRFGYTLAFTHYNYKYFPGELTHICTLDDALRNWDLLPTFARNELIAETQRGPTSTS 146
            C + +GY +  T ++   F   +  I TL D +     +    R    A  Q   T   
Sbjct: 100 ACAAIYGYRIVVTIHSGTEFEDGVHPIGTLADIISAQTRIGGIIRAARNAGIQ---TDLQ 156

Query: 147 TFIS---HKDTSEYYFMVMA 163
           T IS    +  + YY+  MA
Sbjct: 157 TMISPRLERRANSYYYTYMA 176

>Suva_2.521 Chr2 (931884..931919,931923..931955,931959..932135) [246
           bp, 82 aa] {OFF} YEL028W (HSP)
          Length = 82

 Score = 56.2 bits (134), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 33  RDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKEIANHCFSRF 92
           RDN T  DA++L  C  + G P D +VA D    LI+ + R  TNTT + +   HC+SR 
Sbjct: 1   RDNNTCADAVDLW-CLSICGHP-DNVVAIDDNNLLIVADYRLATNTTLLLKATFHCYSRS 58

Query: 93  GYTLAFTHYNYKYFP 107
            Y L+F   N+  FP
Sbjct: 59  AYGLSFPQCNHDMFP 73

>KAFR0D00810 Chr4 complement(174632..175528) [897 bp, 298 aa] {ON} 
          Length = 298

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 43/91 (47%)

Query: 28  DSPLPRDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKEIANH 87
           D PL RDNTT  D LN+ +C +  G P +T VA D++ TLI+    T    ++       
Sbjct: 44  DVPLSRDNTTATDVLNVQQCLRANGYPVNTTVAVDQSGTLIIHPGLTFNRPSNYITAVRR 103

Query: 88  CFSRFGYTLAFTHYNYKYFPGELTHICTLDD 118
           C   +GY LA           E T I TL D
Sbjct: 104 CRQLYGYGLATAVLEGPVLDPEDTPIGTLLD 134

>KAFR0H00780 Chr8 (145265..145858) [594 bp, 197 aa] {ON} 
          Length = 197

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 53/111 (47%)

Query: 26  IIDSPLPRDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKEIA 85
           +   P+  + TT   ALN ++C +V G  N+T V TD +  L+++ N T  N T +  + 
Sbjct: 23  VAQRPISGNLTTEARALNFLKCMEVNGFHNNTPVLTDTSGALVIYANSTFVNITAVNTVF 82

Query: 86  NHCFSRFGYTLAFTHYNYKYFPGELTHICTLDDALRNWDLLPTFARNELIA 136
           + C S +  TLA T    +      ++  +L D L     LP    N+ I+
Sbjct: 83  DMCTSYYSGTLAVTLAVAETLDPSESYYASLGDVLSGRVPLPALTVNQPIS 133

>KAFR0B03000 Chr2 (626140..626814) [675 bp, 224 aa] {ON} 
          Length = 224

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%)

Query: 30  PLPRDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKEIANHCF 89
           PLP + +    A NL++C +V G  N T V TD   +L ++ N T  N+T +  I   C 
Sbjct: 46  PLPLNGSLTNMAYNLLKCMEVEGFSNATSVITDEGSSLTIYANSTQVNSTAVSAIYMRCS 105

Query: 90  SRFGYTL 96
             +  TL
Sbjct: 106 RLYAGTL 112

>KAFR0C06105 Chr3 complement(1213832..1214275) [444 bp, 147 aa]
          {ON}
          Length = 147

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%)

Query: 29 SPLPRDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKEIANHC 88
           P+    +  + ALN ++C QV G  N T V  D + +LI++ N T  NT  +  + ++C
Sbjct: 26 GPIVNSTSPEIAALNYLKCLQVNGADNSTQVLIDGSSSLIVYFNTTQVNTAAVTAVTDYC 85

Query: 89 FSRF 92
            R+
Sbjct: 86 SIRY 89

>KAFR0B02990 Chr2 (625303..625920) [618 bp, 205 aa] {ON} 
          Length = 205

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%)

Query: 30  PLPRDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKEIANHCF 89
           PLP + +    A N ++C +V G  N T V TD   TL ++ N T  N+T +  I   C 
Sbjct: 46  PLPLNGSLTNMAYNYLKCMEVEGFSNATSVITDEASTLTIYANITQVNSTAVDRIYMKCG 105

Query: 90  SRFGYTL 96
             +  TL
Sbjct: 106 RLYAGTL 112

>KAFR0H03580 Chr8 (678010..678849) [840 bp, 279 aa] {ON} 
          Length = 279

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 70/175 (40%), Gaps = 23/175 (13%)

Query: 27  IDSPLP---RDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKE 83
           +D P P     N T   A N + C      P DT+V  D    L++  N +  NTT   +
Sbjct: 21  LDWPFPTMTEVNGTYWQAFNYLSCLNASHFPGDTLVGYDDAGILVVALNSSLVNTTAADQ 80

Query: 84  IANHCF----SRFGYTLAFTHYNYKYFPGELTHICTLDDALRNWDLLPTFARNELI--AE 137
           I   C+    SRF   L F    Y     EL    TL   L     L   +R E    A 
Sbjct: 81  IRTTCYIAFRSRFKNALEF----YDTEAPELEDATTLSAVLAQPQYL---SRTEPWPPAR 133

Query: 138 TQRGPTSTSTFIS-HKDTSEYYFMVM------AVLFLVIIYSLLMRATAKSVPSM 185
           ++R  +S S+  +  + T EYY M +      A   L++ Y L   + A S  S+
Sbjct: 134 SRRNHSSISSNTTLTRRTEEYYEMFLSEYSGCASSDLILTYPLECMSYASSFTSL 188

>KAFR0C05240 Chr3 complement(1049204..1050040) [837 bp, 278 aa] {ON}
           
          Length = 278

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 66/153 (43%), Gaps = 7/153 (4%)

Query: 31  LPRDNTTLVDA--LNLMRCAQVWGMPNDTIV--ATDRTETLILFNNRTTTNTTHMKEIAN 86
           +P  N T  DA   N++RC Q+ G+ N T+V  ATD    L  +NN +      ++ +  
Sbjct: 26  VPFGNGTRPDAAVYNVLRCLQIVGIANSTMVGMATDGFYHL-KYNNSSQAKDAMLQGLTG 84

Query: 87  HCFSRFGYTLAFTHYNYKYFPGELTHICTLDDALRNWDLLPTFARNELIAETQRGPT-ST 145
            C S +G    +      Y+  ++ +  T+ D + +   LP   R +    ++   T S 
Sbjct: 85  -CTSLYGPNDMWASTASDYYDNDVQYYGTIGDLITSTPGLPAPGRYQPSTLSKTEATISN 143

Query: 146 STFISHKDTSEYYFMVMAVLFLVIIYSLLMRAT 178
            T +       YY+ +MA       + L + AT
Sbjct: 144 DTVVRRGQVQGYYYGLMAEDKSCTNHELFVDAT 176

>KAFR0H03575 Chr8 (676359..676868) [510 bp, 169 aa] {ON}
          Length = 169

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 3/66 (4%)

Query: 27 IDSPLP---RDNTTLVDALNLMRCAQVWGMPNDTIVATDRTETLILFNNRTTTNTTHMKE 83
          +D P P     N T   A N + C      P DT+V  D    L++  N +  NTT   +
Sbjct: 21 LDWPFPTMTEVNGTYWQAFNYLSCLNASHFPGDTLVGYDDAGVLVVALNSSLVNTTMADQ 80

Query: 84 IANHCF 89
          I   C+
Sbjct: 81 IMTTCY 86

>Suva_7.257 Chr7 (443247..445403) [2157 bp, 718 aa] {ON} YGL022W
           (REAL)
          Length = 718

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 106 FPGELTHICTLDDALRNWDLLPTFARN--ELIAETQRGPTSTSTFISHKDTSEYYFMVMA 163
           +PG +T    +  ALRNW  LP   RN   L A    G T+ +T+   K+  +    ++A
Sbjct: 87  YPGLMTTSAFIWHALRNWFGLPIDIRNVCVLFAPLFSGVTAWATYEFTKEIKDASAGLLA 146

Query: 164 VLFLVIIYSLLMRATAKS 181
             F+ I+   + R+ A S
Sbjct: 147 AAFMAIVPGYISRSVAGS 164

>Smik_7.268 Chr7 (444398..446554) [2157 bp, 718 aa] {ON} YGL022W
           (REAL)
          Length = 718

 Score = 32.3 bits (72), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 106 FPGELTHICTLDDALRNWDLLPTFARN--ELIAETQRGPTSTSTFISHKDTSEYYFMVMA 163
           +PG +T    +  ALRNW  LP   RN   L A    G T+ +T+   K+  +    ++A
Sbjct: 87  YPGLMTTSAFIWHALRNWLGLPIDIRNVCVLFAPLFSGVTAWATYEFTKEIKDASAGLLA 146

Query: 164 VLFLVIIYSLLMRATAKS 181
             F+ I+   + R+ A S
Sbjct: 147 AGFIAIVPGYISRSVAGS 164

>YGL022W Chr7 (452404..454560) [2157 bp, 718 aa] {ON}  STT3Subunit
           of the oligosaccharyltransferase complex of the ER
           lumen, which catalyzes asparagine-linked glycosylation
           of newly synthesized proteins; forms a subcomplex with
           Ost3p and Ost4p and is directly involved in catalysis
          Length = 718

 Score = 32.3 bits (72), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 106 FPGELTHICTLDDALRNWDLLPTFARN--ELIAETQRGPTSTSTFISHKDTSEYYFMVMA 163
           +PG +T    +  ALRNW  LP   RN   L A    G T+ +T+   K+  +    ++A
Sbjct: 87  YPGLMTTSAFIWHALRNWLGLPIDIRNVCVLFAPLFSGVTAWATYEFTKEIKDASAGLLA 146

Query: 164 VLFLVIIYSLLMRATAKS 181
             F+ I+   + R+ A S
Sbjct: 147 AGFIAIVPGYISRSVAGS 164

>Skud_7.265 Chr7 (455547..457703) [2157 bp, 718 aa] {ON} YGL022W
           (REAL)
          Length = 718

 Score = 32.0 bits (71), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 106 FPGELTHICTLDDALRNWDLLPTFARN--ELIAETQRGPTSTSTFISHKDTSEYYFMVMA 163
           +PG +T    +  ALRNW  LP   RN   L A    G T+ +T+   K+  +    ++A
Sbjct: 87  YPGLMTTSAFIWHALRNWLGLPIDIRNICVLFAPLFSGVTAWATYEFTKEIKDASAGLLA 146

Query: 164 VLFLVIIYSLLMRATAKS 181
             F+ I+   + R+ A S
Sbjct: 147 AGFIAIVPGYISRSVAGS 164

>KAFR0D04080 Chr4 complement(804693..806534) [1842 bp, 613 aa] {ON}
           Anc_1.54 YDR506C
          Length = 613

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 7/81 (8%)

Query: 57  TIVATDRTETLILFNNRTTTNTTHMKEIANHCFSRFGYTLAFTHYNYKYFPGELTHICTL 116
           TI    R   +I  N R          + + C    GY     ++  KY  G+ +++   
Sbjct: 308 TIAVGQRYTIIIRLNERQ-----EQYRLISGCNKMMGYITKNYYFTRKYHRGKSSNVG-- 360

Query: 117 DDALRNWDLLPTFARNELIAE 137
           D  + N   LP F+RNEL+ E
Sbjct: 361 DKDIINIKELPNFSRNELLHE 381

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,865,776
Number of extensions: 725717
Number of successful extensions: 2498
Number of sequences better than 10.0: 26
Number of HSP's gapped: 2551
Number of HSP's successfully gapped: 26
Length of query: 188
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 85
Effective length of database: 41,670,801
Effective search space: 3542018085
Effective search space used: 3542018085
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)