Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C043205.352ON70670632020.0
KNAG0C055005.352ON58571411171e-144
Skud_4.5865.352ON64272011091e-142
ZYRO0D10186g5.352ON63571211021e-141
TDEL0E027505.352ON56471710871e-140
Kpol_339.135.352ON68676110871e-138
NCAS0F028705.352ON70031010381e-131
YDR320C (SWA2)5.352ON6683199481e-118
Suva_2.4895.352ON6593059101e-112
Smik_4.5795.352ON6673079101e-112
KAFR0C018505.352ON6463039031e-111
Kwal_34.159775.352ON5977208651e-106
TBLA0H019705.352ON8403098441e-101
CAGL0H07095g5.352ON6613128301e-100
TPHA0E011105.352ON6933938242e-99
KLTH0H14872g5.352ON6236377678e-92
SAKL0G08822g5.352ON5823137561e-90
KLLA0B10197g5.352ON6213006631e-76
Ecym_81815.352ON6613136581e-75
AGR352C5.352ON6483086239e-71
Kpol_1028.516.328ON117641064e-05
TDEL0B051402.152ON5991301065e-04
KAFR0J025706.328ON12172976e-04
TPHA0D038606.328ON12068976e-04
CAGL0H07425g8.506ON380681037e-04
Kpol_513.28.506ON374751038e-04
TBLA0H033808.506ON375721000.002
NCAS0B070102.152ON6251271010.002
Skud_2.2828.506ON385751000.002
YCR060W (TAH1)6.328ON11162920.002
Suva_3.956.328ON11164920.002
YBR155W (CNS1)8.506ON38568980.003
KAFR0F007202.152ON608115990.003
KNAG0H035302.152ON614132990.003
Skud_3.1356.328ON11862910.004
NCAS0H008306.21ON33881950.007
TPHA0I015102.152ON603132950.008
KLTH0H02068g7.313ON370122940.008
ZYRO0G06512g2.152ON604130950.008
NCAS0F034903.481ON51270930.016
Kwal_55.199355.617ON59377920.021
Smik_3.1596.328ON11562850.021
Smik_2.2958.506ON38568910.023
ZYRO0A05676g5.617ON57268910.024
Suva_4.4058.506ON38568910.025
KAFR0E029808.506ON38086890.035
TBLA0I023106.328ON11669830.046
Kpol_1048.212.152ON597125890.047
Ecym_20906.328ON17264850.048
KLLA0C08910g6.328ON11564820.060
NCAS0B024008.506ON38068860.079
TDEL0B013108.506ON38075860.083
NDAI0F028102.152ON609119870.089
Suva_15.1826.21ON34668860.093
Kpol_505.413.481ON51372860.098
NDAI0B043402.152ON664118860.099
Kwal_27.118908.506ON33467850.12
KLTH0B05170g2.152ON593115850.13
SAKL0G07084g5.617ON58568850.14
TPHA0D032203.481ON51375840.16
CAGL0D05060g3.481ON51070840.18
TBLA0C039503.481ON51273840.19
YOR007C (SGT2)6.21ON34668830.19
Skud_15.1686.21ON34881830.19
SAKL0A01672g6.328ON12866780.20
NDAI0D008106.21ON349135830.20
NCAS0G024802.152ON596115830.22
CAGL0L12936g2.152ON600132820.30
TPHA0L014208.506ON37467810.31
KLTH0E02178g5.617ON59368820.34
CAGL0K09240g6.328ON14264770.37
TBLA0A072706.21ON373121810.39
NCAS0D045006.328ON12164760.39
Skud_10.2511.456ON393125800.44
Ecym_55825.617ON58463800.48
NDAI0B057903.481ON52370800.57
CAGL0L04048g2.152ON587114790.63
NDAI0I004406.328ON12864740.75
TBLA0C055302.152ON610125780.84
Smik_15.1766.21ON34568770.89
Smik_14.2072.152ON617132780.99
AEL224W5.617ON58068771.1
KLLA0B09966g8.506ON37065761.2
KLLA0F24046g2.152ON604115771.2
ACR005W6.21ON327115761.4
Kwal_33.147672.152ON594113761.4
ZYRO0F05874g7.313ON370102761.5
Suva_14.2192.152ON617132761.5
Skud_14.2112.152ON617132761.6
KLLA0F05093g7.313ON372122751.6
KLTH0F14542g3.481ON51370761.7
Kwal_56.244877.313ON370122751.9
KLTH0E11748g8.506ON37863752.0
ZYRO0C07788g6.21ON334129742.1
KLLA0B10912g3.481ON51267752.2
KNAG0B032005.617ON57968752.3
YPL045W (VPS16)8.493ON79877752.4
CAGL0H08195g5.617ON58368752.4
Smik_10.3061.456ON39432742.5
SAKL0F10450g7.313ON370118742.5
AGL268C8.506ON37968742.5
SAKL0E10956g2.152ON600113742.6
TBLA0E019907.313ON37470733.4
KLTH0B02442g5.174ON104847743.4
NDAI0F009105.617ON58368733.8
KNAG0B027707.313ON377126724.0
Ecym_25598.506ON37065724.0
YNL121C (TOM70)2.152ON617132734.2
SAKL0H10934g8.506ON38068724.6
SAKL0F03102g3.481ON51370724.7
Kwal_55.211753.481ON51170724.8
ABR131W2.152ON594115724.8
SAKL0B01078g8.28ON1302105725.0
Kpol_1009.176.100ON151595725.8
YJR032W (CPR7)1.456ON39332706.6
NDAI0C052908.506ON37970707.1
ZYRO0B04224g3.481ON51376707.3
KNAG0A039508.506ON38667708.0
Kpol_1018.695.617ON59068708.2
SAKL0E01210g6.21ON32368698.4
TBLA0E033005.617ON58289709.1
NCAS0G008105.617ON584131709.2
KNAG0A079003.481ON51267699.6
TDEL0A048405.617ON57668699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C04320
         (706 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...  1238   0.0  
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...   434   e-144
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...   431   e-142
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...   429   e-141
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...   423   e-140
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...   423   e-138
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...   404   e-131
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...   369   e-118
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...   355   e-112
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...   355   e-112
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...   352   e-111
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...   337   e-106
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...   329   e-101
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...   324   e-100
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...   322   2e-99
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...   300   8e-92
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...   295   1e-90
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...   259   1e-76
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...   258   1e-75
AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}...   244   9e-71
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    45   4e-05
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    45   5e-04
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    42   6e-04
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    42   6e-04
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    44   7e-04
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    44   8e-04
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    43   0.002
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    44   0.002
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    43   0.002
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    40   0.002
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    40   0.002
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    42   0.003
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    43   0.003
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    43   0.003
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    40   0.004
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    41   0.007
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    41   0.008
KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {...    41   0.008
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    41   0.008
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    40   0.016
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    40   0.021
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    37   0.021
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.023
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    40   0.024
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.025
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    39   0.035
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    37   0.046
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    39   0.047
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    37   0.048
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    36   0.060
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    38   0.079
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    38   0.083
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    38   0.089
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    38   0.093
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    38   0.098
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    38   0.099
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    37   0.12 
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    37   0.13 
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    37   0.14 
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    37   0.16 
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    37   0.18 
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    37   0.19 
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    37   0.19 
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    37   0.19 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    35   0.20 
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    37   0.20 
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    37   0.22 
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    36   0.30 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    36   0.31 
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    36   0.34 
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    34   0.37 
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    36   0.39 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    34   0.39 
Skud_10.251 Chr10 (447070..448251) [1182 bp, 393 aa] {ON} YJR032...    35   0.44 
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    35   0.48 
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    35   0.57 
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    35   0.63 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    33   0.75 
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    35   0.84 
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    34   0.89 
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    35   0.99 
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    34   1.1  
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    34   1.2  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    34   1.2  
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    34   1.4  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    34   1.4  
ZYRO0F05874g Chr6 (485184..486296) [1113 bp, 370 aa] {ON} highly...    34   1.5  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    34   1.5  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    34   1.6  
KLLA0F05093g Chr6 complement(502635..503753) [1119 bp, 372 aa] {...    33   1.6  
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    34   1.7  
Kwal_56.24487 s56 (1016327..1017439) [1113 bp, 370 aa] {ON} YLR2...    33   1.9  
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    33   2.0  
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    33   2.1  
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    33   2.2  
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    33   2.3  
YPL045W Chr16 (467260..469656) [2397 bp, 798 aa] {ON}  VPS16Subu...    33   2.4  
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    33   2.4  
Smik_10.306 Chr10 (476484..477668) [1185 bp, 394 aa] {ON} YJR032...    33   2.5  
SAKL0F10450g Chr6 (806524..807636) [1113 bp, 370 aa] {ON} simila...    33   2.5  
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    33   2.5  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    33   2.6  
TBLA0E01990 Chr5 (483675..484799) [1125 bp, 374 aa] {ON} Anc_7.3...    33   3.4  
KLTH0B02442g Chr2 (193387..196533) [3147 bp, 1048 aa] {ON} simil...    33   3.4  
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     33   3.8  
KNAG0B02770 Chr2 complement(535162..536295) [1134 bp, 377 aa] {O...    32   4.0  
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    32   4.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    33   4.2  
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    32   4.6  
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    32   4.7  
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    32   4.8  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    32   4.8  
SAKL0B01078g Chr2 (97198..101106) [3909 bp, 1302 aa] {ON} simila...    32   5.0  
Kpol_1009.17 s1009 (37274..41821) [4548 bp, 1515 aa] {ON} (37274...    32   5.8  
YJR032W Chr10 (491081..492262) [1182 bp, 393 aa] {ON}  CPR7Pepti...    32   6.6  
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    32   7.1  
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    32   7.3  
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    32   8.0  
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    32   8.2  
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    31   8.4  
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    32   9.1  
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    32   9.2  
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    31   9.6  
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    31   9.6  

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/706 (87%), Positives = 619/706 (87%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60
           MSDPFASLLTSFKNGQ             KKLSATTPSQSSIQFNLNKASTPSLDTFALA
Sbjct: 1   MSDPFASLLTSFKNGQNTTNNNTTTDTDTKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60

Query: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAFDIFTSTP 120
           PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAFDIFTSTP
Sbjct: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAFDIFTSTP 120

Query: 121 PLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDII 180
           PLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDII
Sbjct: 121 PLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDII 180

Query: 181 RKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSMATDILY 240
           RKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSMATDILY
Sbjct: 181 RKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSMATDILY 240

Query: 241 KGKELVDQLTAYPEENNRLYKYREPIDNEENPFLQEXXXXXXXXXXXXXXXXHVXXXXXX 300
           KGKELVDQLTAYPEENNRLYKYREPIDNEENPFLQE                HV      
Sbjct: 241 KGKELVDQLTAYPEENNRLYKYREPIDNEENPFLQEGSRSPASARSPSLSGSHVASASAK 300

Query: 301 XXXXXXYVERNSLKYEDNNTTLIDDFDYKLTINSKEPSMAKNIPPSITPDTTETNNNNAL 360
                 YVERNSLKYEDNNTTLIDDFDYKLTINSKEPSMAKNIPPSITPDTTETNNNNAL
Sbjct: 301 PSSKPSYVERNSLKYEDNNTTLIDDFDYKLTINSKEPSMAKNIPPSITPDTTETNNNNAL 360

Query: 361 LDFDGLSTVTAPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVPISHIELSGHIEFKTR 420
           LDFDGLSTVTAPG                             TVPISHIELSGHIEFKTR
Sbjct: 361 LDFDGLSTVTAPGSSNISVNKKNTSSSSATSPSPSPASITIATVPISHIELSGHIEFKTR 420

Query: 421 GSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIALS 480
           GSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIALS
Sbjct: 421 GSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIALS 480

Query: 481 LFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLIENGF 540
           LFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLIENGF
Sbjct: 481 LFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLIENGF 540

Query: 541 TNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDTTTASVQRLQDENAKSRE 600
           TNSKIMDGKRRCQKILN                 ILKHKEKDTTTASVQRLQDENAKSRE
Sbjct: 541 TNSKIMDGKRRCQKILNPPPPPQTSKSPTPTPVSILKHKEKDTTTASVQRLQDENAKSRE 600

Query: 601 IENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQADLVMPKKVKIT 660
           IENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQADLVMPKKVKIT
Sbjct: 601 IENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQADLVMPKKVKIT 660

Query: 661 YLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706
           YLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN
Sbjct: 661 YLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score =  434 bits (1117), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 270/714 (37%), Positives = 367/714 (51%), Gaps = 137/714 (19%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQF-NLNKASTPSLDTFAL 59
           M+DPFASLLTSFK                KK +A + S   +      + +T S     +
Sbjct: 1   MADPFASLLTSFKESS-------------KKPAAKSESPEPVTVKGGGEPATASTHAVFM 47

Query: 60  APLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAFDIFTST 119
            PLIPS                             Q +    PA   D  D  FD+F S 
Sbjct: 48  EPLIPSG--------------------------GGQGSFQQKPAGSDDKFDDVFDLFNSE 81

Query: 120 PPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDI 179
           P  E ++     V   E  +E   +VDEV+DMEVA++MSLG  ID+A ++YD G+LY+++
Sbjct: 82  PAAEVKEPDR--VPSDESVHENVAVVDEVRDMEVAKIMSLGFGIDKAVEFYDSGVLYDEL 139

Query: 180 IRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGN-LFSMATDI 238
           + ++  + ++    R                     ++ +   E   +TGN  FS A  +
Sbjct: 140 VERRDRRHIRHTHTR---------------------HSVREVTEVPKHTGNSFFSAAVGL 178

Query: 239 LYKGKELVDQLTAYP-EENNRLYKYREPIDNEENPFLQEXXXXXXXXXXXXXXXXHVXXX 297
           L KGK+ VD LTAYP EE +RL +YR+                            H    
Sbjct: 179 LNKGKDFVDHLTAYPDEEGDRLARYRQ----------------------EHADAAHFGDF 216

Query: 298 XXXXXXXXXYVERNSLKYEDNNTTLIDDFDYKLTINSKEPSMAKNIPPSITPDTTETNNN 357
                             E     LIDDF+ K++I  K      N P + TPD T     
Sbjct: 217 TPG---------------EREQDLLIDDFESKVSITDKH-----NPPLAQTPDET----- 251

Query: 358 NALLDFDGLSTVTAPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVPISHIELSGHIEF 417
             LLDF G    +  G                              VPIS +ELSG+ EF
Sbjct: 252 --LLDF-GEDDSSKSGSRTHVNNSPSIELP---------------IVPISTMELSGYNEF 293

Query: 418 KTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKI 477
           + +G+ELFK GDY +A+ EYEKSLNTLP+ HPLRII+ SN++   LKIGEY+K ++   +
Sbjct: 294 RAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLAPL 353

Query: 478 ALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLIE 537
           AL L P+ +  S W  +I  S P+R+++DIWSKL+MR AE+ EH ENY  A D+YQ L+ 
Sbjct: 354 ALELIPEDR--STWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVA 411

Query: 538 NGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDTTTA-----SVQRLQ 592
           NG TN K+MDGKRRCQK+LN                 +   +  D  T+     + +R++
Sbjct: 412 NGITNEKVMDGKRRCQKVLNPPSKVERKGTPTPTPQVVTPARTPDPATSKTVYENAERVK 471

Query: 593 DENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQADLV 652
             NAKS + E  K+  YD VE+K+N WK DK+ DIR+LLS+L+ ++TW +W S+SQADLV
Sbjct: 472 RANAKSEQEEAAKMEFYDVVETKVNNWKGDKEGDIRYLLSHLTEIVTWVEWNSVSQADLV 531

Query: 653 MPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706
           MPK+VKITYLKAI K HPDKIP  L LE +MIA+ VFS+L+ AW+KFKLDNN+N
Sbjct: 532 MPKRVKITYLKAIAKIHPDKIPADLPLEYRMIADTVFSVLNNAWEKFKLDNNIN 585

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score =  431 bits (1109), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 293/720 (40%), Positives = 391/720 (54%), Gaps = 92/720 (12%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60
           MSDPFA LL S KN +               L +++ S        +K +  SL + +  
Sbjct: 1   MSDPFAHLLASLKN-KDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSAW 59

Query: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITS-PPAPKKDDIDSAFD-IFTS 118
           PLIP S+ +       ++ PL+        NS    N  S  P+P   +ID  FD IF S
Sbjct: 60  PLIPPSKVS------FSAAPLVPS------NSTSSANTASNTPSPAPVNIDDDFDEIFGS 107

Query: 119 TPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYED 178
                    Q      H+ D  ++ +VDEVKDME+ARLMSLGLS+ +A ++Y+  I YE 
Sbjct: 108 DAIAATGGLQQVDQDSHDDDDGDDALVDEVKDMEIARLMSLGLSVQKATEFYNDDITYER 167

Query: 179 I--IRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSMAT 236
              I K ++KK + +  R K+N    +   K   LF+NT       +S NN  NL S+AT
Sbjct: 168 YLEILKSKQKKHRDRIAREKSN----DIKIKKPGLFNNT-------DSDNN--NLLSIAT 214

Query: 237 DILYKGKELVDQLTAYP-EENNRLYKYREPIDNEENPFLQEXXXXXXXXXXXXXXXXHVX 295
           D   KGKEL+DQ T++P EENNRL  +   +++E N +                      
Sbjct: 215 DFFNKGKELMDQWTSFPPEENNRLKSHLN-LEDESNDY---------------------- 251

Query: 296 XXXXXXXXXXXYVERNSLKYEDNNTT--LIDDFDYKLTINSK-------EPSMAKNIPPS 346
                       +E N      +N    L+ DF+ K+ I  +        PS + +IP  
Sbjct: 252 ---------DLSLEENPCNSGGDNLDEDLLTDFEAKIDITKRASKNVASSPSPSFDIPID 302

Query: 347 ITPDTTETNNNNALLDFDGLSTVTAPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVPI 406
                 E++ +++LLDF                                        VPI
Sbjct: 303 EDSGKKESSMDDSLLDF--------------SPENFTKSDSTENNTLFGESSNAVSVVPI 348

Query: 407 SHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIG 466
           S IELSG+ EFK +G+ LFKNGDYV++LQEYEK+LN+LP  HPLRII  SNIIA+QLK+G
Sbjct: 349 SDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVG 408

Query: 467 EYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYK 526
           EYSKSI +  +AL+LFP  K  ++WN  I +S PQRSF DIW K+++R+AES+EHLE++K
Sbjct: 409 EYSKSIVNSDLALALFPPAK--ASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFK 466

Query: 527 LALDSYQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDTTTA 586
            AL++YQ+LI   F + KIM GKRRCQ  ++                  LK    D + A
Sbjct: 467 NALETYQELISRNFFDDKIMQGKRRCQNFISPPLVRKSTPVKKTTPT--LKKPAPDPSPA 524

Query: 587 SVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSI 646
            +        K +E+EN K+ALYDKV  KI  WK  K+ DIRHLLSNLS +LTWC+W  +
Sbjct: 525 PIDI--PSKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDV 582

Query: 647 SQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706
           S  DLVMPKKVKI Y+KA+ KTHPDKIPESL LENKMIAEN+FS LS+AWDKFK  N++N
Sbjct: 583 SMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score =  429 bits (1102), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 273/712 (38%), Positives = 386/712 (54%), Gaps = 83/712 (11%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60
           M DPFA LLT FK G+             K L+A        Q++ N     S  + +L 
Sbjct: 1   MGDPFADLLTQFKGGESKPQNQGN-----KPLAA--------QYSENNTRETS-SSLSLQ 46

Query: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLF------NSNEQKNITSPPAPKKDDIDSAFD 114
           P   ++    K          I+DDF  LF      N+N       P    +++ DSA D
Sbjct: 47  PEPVTTASNYK----------IDDDFEQLFGIKSNTNTNNSDVNNRPNTTNQNEFDSAID 96

Query: 115 IFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGI 174
           +   TP  E+Q+Q          + E E +VDEV+DMEVA+LMSLG SID AN  Y++G+
Sbjct: 97  LLQITP--EKQRQ--------SAEREPEQLVDEVRDMEVAKLMSLGYSIDGANTSYEQGM 146

Query: 175 LYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSM 234
           LY+D+I ++++KKL +   R       + N ++ +   +N       +ES  N  +LFS+
Sbjct: 147 LYDDVIEERKKKKLHR---RELQRLMAETNWERETPETNN-------DESGKNNVDLFSI 196

Query: 235 ATDILYKGKELVDQLTAYPEENNRLYKYREPIDNEENPFLQEXXXXXXXXXXXXXXXXHV 294
           A+ I  KGK++VD L+ +P+E N L  YR     +   F  E                  
Sbjct: 197 ASGIFNKGKKIVDHLSLFPDEENDLLPYRSERLKQRQTFEPELPRRPRKDPTPNP---RT 253

Query: 295 XXXXXXXXXXXXYVERNSLKYEDNNTTLIDDFDYKLTINSKEPSMAKNIPPSITPDTTET 354
                         ++ +++ ++ +  L+ DF  KL++ S+     K+   S +P     
Sbjct: 254 QGTPQVEYESTLQYQQPTIQAQEGD--LLGDFQDKLSLRSQ---GNKSTSASQSP----- 303

Query: 355 NNNNALLDFDGLSTVTAPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVPISHIELSGH 414
            +N  LLDFD  S  +                                TVPI+ IELSG+
Sbjct: 304 -SNETLLDFDAPSANSTSASVSVSRQGSVVP-----------------TVPITEIELSGY 345

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
            EFK R  ELFK GDYV+ALQEYEKS NTLP  HPLRIISYSN++A+QLK G+Y +S+  
Sbjct: 346 NEFKDRAGELFKTGDYVAALQEYEKSANTLPHGHPLRIISYSNLMASQLKTGQYKESLHV 405

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534
             +AL LFP+   T+ W Q+I +S P ++++D+W K++ R+AE++EH EN++ A ++YQ 
Sbjct: 406 ASMALKLFPED--TTQWTQLIQNSEPSKTYRDMWPKIVQRRAEAFEHSENFQEAFNAYQS 463

Query: 535 LIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDTTTASVQRLQDE 594
           LIE  F  +KIMDGKRRCQK+LN                        D    ++Q+++++
Sbjct: 464 LIEKNFCTNKIMDGKRRCQKVLNPEKPKVVQKKPASSKSPSPSPNHSDKKYKNLQKVKED 523

Query: 595 NAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQADLVMP 654
           N K  E + Q+ ALYD+V  +I  W+  K  DIRHLLSNL TVLTW DW  +S ADLVMP
Sbjct: 524 NRKQAEEDTQRHALYDRVYDQIKLWESGKANDIRHLLSNLQTVLTWVDWKPVSPADLVMP 583

Query: 655 KKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706
           KKVKITYL+A+ KTHPDKI +SL L+ KMIAE+VFS LS AW+KFK +N++N
Sbjct: 584 KKVKITYLRAVAKTHPDKISDSLPLDKKMIAESVFSSLSSAWEKFKSENDIN 635

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score =  423 bits (1087), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 264/717 (36%), Positives = 375/717 (52%), Gaps = 164/717 (22%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60
           MSDPFA LL+SF++G                             +++K +TP +    L 
Sbjct: 1   MSDPFADLLSSFRSGGSD--------------------------SVSKEATPEVKQEKL- 33

Query: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAFDIFTSTP 120
              P     +           + DD  +LF   ++           D  D+AF+ F    
Sbjct: 34  ---PGRNQIN-----------VHDDLDELFGLKKRDETVVKNQVVGDSFDAAFEAFDRPQ 79

Query: 121 PLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDII 180
            +E+  ++             E++VDEVKDMEVA+LMSL L IDQA  YY++G+LYE + 
Sbjct: 80  KVEKSLEESP-----------EMVVDEVKDMEVAKLMSLNLDIDQATDYYERGVLYEQLS 128

Query: 181 RKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSMATDILY 240
           R++RE++L ++  +     Q +  T                 E + ++G+ FS+A+ IL 
Sbjct: 129 RQRREQELIRRREQMLRQQQQQQQTP----------------EEKFDSGSFFSLASGILE 172

Query: 241 KGKELVDQLTAYPEENNRLYKYRE----PIDNEENPFLQEXXXXXXXXXXXXXXXXHVXX 296
           KG++ VDQ + +P+E +RL + R     P++  ++                         
Sbjct: 173 KGRQFVDQFSGFPQEQDRLTRVRVEQDLPVERPKS------------------------- 207

Query: 297 XXXXXXXXXXYVERNSLKYEDNNTTLIDDFDYKLTINSKEPSMAKNIPPSITPDTTETNN 356
                      VE  +++ E+ N  L+ +F  K  IN +EP  +   PP  T        
Sbjct: 208 -----------VEPPTVEVEEGN--LLGEFQEK--INLEEPKRSPTPPPQAT-------- 244

Query: 357 NNALLDFDG------LSTVTAPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVPISHIE 410
              LLDFD       + T+T                                 VPISH+E
Sbjct: 245 ---LLDFDNGTPPERIKTITP--------------------------------VPISHLE 269

Query: 411 LSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSK 470
           +SG+ E+K RG+E FK GDYVSA QEYEKSLN+LPQ H LRI++YSN+ A   K+GEY +
Sbjct: 270 ISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKR 329

Query: 471 SIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALD 530
            + D + AL +FPK    + W++ I DS P R+FK++W K++ R+AE++EH+ENY+ AL 
Sbjct: 330 CLSDIESALEMFPKD--PNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQ 387

Query: 531 SYQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDTTT-ASVQ 589
            YQ LIE    N KIM GKRRCQK+LN                  +    K   T A+V+
Sbjct: 388 DYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTPVPKVSEDTKQPKTYANVE 447

Query: 590 RLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQA 649
           R++ EN ++   E +K ALYD V  +I +WK  K  DIRHLL+NLSTVLTWCDW  +S +
Sbjct: 448 RVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKPVSTS 507

Query: 650 DLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706
           DLVMPKKVKITY+KA+ KTHPDKIP SL+LE +MIAE+VFS LS+AW+KFKL N++N
Sbjct: 508 DLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDIN 564

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score =  423 bits (1087), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 288/761 (37%), Positives = 396/761 (52%), Gaps = 130/761 (17%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60
           M+DPFA LL+SFK+G                 S T   Q+  + N+  A+ P      +A
Sbjct: 1   MADPFADLLSSFKSG-----------------STTKNEQADKKVNI--ATKP------MA 35

Query: 61  PLIPSSRDASK----SNSRVTSPPLIEDDFSDLFN-SNEQKNI-------------TSPP 102
            L+ + +  +      N    S   I DD +DLF  S+E K I             TS P
Sbjct: 36  ELLTAQKPVNNVTLIENEVSISSNGIHDDIADLFGLSSESKPINASKPINASKPINTSKP 95

Query: 103 APKKDDIDSAFDIFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLS 162
           +   DD+D+A + F  +P   Q+  +   VT   +   ++I+VDEVKDME+A+LMSLGL 
Sbjct: 96  SEGIDDLDAAMNFFNDSP---QESLRGSTVTTSPE--VQDIVVDEVKDMEIAKLMSLGLD 150

Query: 163 IDQANKYYDKGILYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFN 222
           ID+A  +YD GILYE ++ K R    +  + RN              D   N    +   
Sbjct: 151 IDEATTHYDNGILYETLVSKIRTSNSRITAQRN--------------DSGRNDIRAEPMR 196

Query: 223 ESQNNTGNLFSMATDILYKGKELVDQLTAYPEENNRLYK------------YREPID--- 267
           + + + G+     T +  KGK+LVDQ T Y EE++RL++            Y+   D   
Sbjct: 197 KPRTSNGSF--TFTGLFDKGKQLVDQWTVYHEEDDRLFRNTNFKVDPSTNTYQPSGDYDT 254

Query: 268 NEENPFLQEXXXXXXXXXXXXXXXXHVXXXXXXXXXXXXYVERNSLKYEDNNT-----TL 322
           ++ENPF Q+                                ER + +   NN       L
Sbjct: 255 SDENPFNQQSRYDIASSKTTSTDSQTRNYHDKKTSINNKAHERIAKETPINNQPANLDLL 314

Query: 323 IDDF-DYKLT-------------INSKEPSMAKNIPPSITPDTTETNNNNALLDFDGLST 368
            DDF   KL+               SK+ +  + I   I         NN LLDFD  +T
Sbjct: 315 NDDFISIKLSSENVSTNLTNLEQAKSKQATSKQAISKPIV--NVAPKANNTLLDFDSPTT 372

Query: 369 -VTAPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVPISHIELSGHIEFKTRGSELFKN 427
            V +P                               VPIS IEL G+ EFK RG+E FK 
Sbjct: 373 AVHSPAASLPK-------------------------VPISEIELLGYKEFKERGTENFKT 407

Query: 428 GDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIALSLFPKGKV 487
           GDYV+AL+ Y+KSLNTLP  HPLRII+ SNI+A+  K GEY KSIE    AL  FP  + 
Sbjct: 408 GDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEISTSALEQFPGDQ- 466

Query: 488 TSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLIENGFTNSKIMD 547
              WN+ I DS PQR++KDIW K+++++AE++EH+E+Y+ AL++YQ++IE  F N K+M 
Sbjct: 467 -KQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENALETYQQMIEKNFFNDKVMS 525

Query: 548 GKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDTTTA--SVQRLQDENAKSREIENQK 605
           GKRRCQ ++N                     KE +   A  +V++L+ +N    EIE+Q+
Sbjct: 526 GKRRCQHVINPVKPTKSNSSALPRQTNTKPKKESNQNKAYENVEKLKQKNKLEAEIESQR 585

Query: 606 VALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQADLVMPKKVKITYLKAI 665
           +ALYD VE++IN WK +KD DIRHLLSNL  +LTW +W  +  +DLVMPKKVKITY+KA+
Sbjct: 586 LALYDSVEAQINKWKANKDDDIRHLLSNLQLILTWGNWNPVPPSDLVMPKKVKITYMKAV 645

Query: 666 TKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706
            +THPDKIP  L+LE KMIAEN+FS+LS AW+KFK DNNMN
Sbjct: 646 ARTHPDKIPSDLELEKKMIAENIFSVLSKAWEKFKKDNNMN 686

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score =  404 bits (1038), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 191/310 (61%), Positives = 235/310 (75%), Gaps = 9/310 (2%)

Query: 403 TVPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462
            +PISHIELSG+ EF+ RG++ FKNGDYVS+ QEYEKSLNTLP  HPLRII+YSNIIA++
Sbjct: 392 VIPISHIELSGYAEFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASE 451

Query: 463 LKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHL 522
           LKIGEYSKS+++   AL +FP    T+ W  +I DS PQR++KDIW K+ +RQAE+ EH+
Sbjct: 452 LKIGEYSKSLKNSSSALEMFPDD--TAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHI 509

Query: 523 ENYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXI------- 575
           E++K AL SYQ+LIE GF N KIMDGKRRCQK+LN                         
Sbjct: 510 ESFKAALSSYQELIEKGFANDKIMDGKRRCQKVLNPTPPPVVKTPRISTPKQSPSPVPRK 569

Query: 576 LKHKEKDTTTASVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLS 635
                KD    SV+RL+ ENA S+E+E QK+ALYDKV +K+  WK  KDTDIRHLL+NLS
Sbjct: 570 ATSNSKDAVYESVERLKKENATSQEVEKQKLALYDKVFAKVETWKNRKDTDIRHLLANLS 629

Query: 636 TVLTWCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLA 695
            VLTWCDW  ++ +DLVMPKKVKITY+KA+ KTHPDK+PESL+LENKMIAENVFS+LS+A
Sbjct: 630 IVLTWCDWKPVAASDLVMPKKVKITYMKAVAKTHPDKVPESLELENKMIAENVFSVLSVA 689

Query: 696 WDKFKLDNNM 705
           WDKFK++NNM
Sbjct: 690 WDKFKIENNM 699

 Score =  199 bits (505), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 126/279 (45%), Positives = 171/279 (61%), Gaps = 46/279 (16%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKAS-TPSLDTFAL 59
           MSDPFA LLTSFKNG              K  + + P++S+I      AS +P++   ++
Sbjct: 1   MSDPFADLLTSFKNG--------------KDNAKSEPTKSNISATQKPASASPNISQLSI 46

Query: 60  APLIPSSRDASKSNSRVTSPPL-IEDDFSDLFNSNEQKNITSPPAPKK------DDIDSA 112
            PL+PS            SP + I DDF DLF  +  +N T+   PK+      DDID+A
Sbjct: 47  TPLVPSP-----------SPNVSIHDDFDDLFGVSLGQNGTNTIVPKQTVKTETDDIDAA 95

Query: 113 FDIFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDK 172
           F++F +TP  +  + +     + ++D EEE +VDEVKDMEVARLMSLGLSID+AN +YDK
Sbjct: 96  FNVFQATPS-QSIKPEASAPNDIDRD-EEEYVVDEVKDMEVARLMSLGLSIDEANDHYDK 153

Query: 173 GILYEDII-------RKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQ 225
           GILYE+++       R++  +K++ Q  +  +N    NN  + +D FDNTYAN R  +S+
Sbjct: 154 GILYENLLAKMKQNQRQKERRKVETQPTKRNSNPPSANN--RLNDRFDNTYANIR--DSR 209

Query: 226 NNTGNLFSMATDILYKGKELVDQLTAYPEENNRLYKYRE 264
              G+LFSMATD LYKGKE VDQL AYPEENNRL  YR+
Sbjct: 210 TRGGDLFSMATDFLYKGKEFVDQLIAYPEENNRLLNYRD 248

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score =  369 bits (948), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 184/319 (57%), Positives = 232/319 (72%), Gaps = 28/319 (8%)

Query: 403 TVPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462
           T+PIS IELSG+ EFK +G+ LFKNGDY+++LQEYEKSLNTLP  HPLRII+ SNIIA+Q
Sbjct: 363 TIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQ 422

Query: 463 LKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHL 522
           LKIGEYSKSIE+  +AL LFP  K  + W   I +S P+RSF DIW K+++R+AES+EHL
Sbjct: 423 LKIGEYSKSIENSSMALELFPSSK--AKWKNKISNSDPERSFNDIWPKIMIRRAESFEHL 480

Query: 523 ENYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKD 582
           E++K AL++YQ+LI+  F + KIM GKRRCQ  +N                  +  K+K 
Sbjct: 481 ESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINPPPVKKS-----------MPVKKKT 529

Query: 583 TTTASVQRLQDENA---------------KSREIENQKVALYDKVESKINAWKLDKDTDI 627
           TTT+   + Q+  A               K RE+EN K+ALYDKV  KI++WK  KD DI
Sbjct: 530 TTTSPATKKQNLTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDI 589

Query: 628 RHLLSNLSTVLTWCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAEN 687
           RHLL+NLS++LTWC+W  +S  DLVMPK+VKITY+KA+ KTHPDKIPESL LENKMIAEN
Sbjct: 590 RHLLANLSSLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAEN 649

Query: 688 VFSILSLAWDKFKLDNNMN 706
           +FS LS+AWDKFKL N++N
Sbjct: 650 IFSTLSIAWDKFKLQNDIN 668

 Score =  102 bits (255), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 134/279 (48%), Gaps = 32/279 (11%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60
           MSDPFA LLTS KN                  S T  + + +    +K+   SL + +  
Sbjct: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVA-RTDKSPNDSLHSISAP 59

Query: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNIT--SPP---APKKDDIDSAFDI 115
           PLIPS +         ++PPL+        NS  + N    +PP   A   DD +  F +
Sbjct: 60  PLIPSPK------VDFSAPPLVPT------NSTTKSNTANNTPPSALANTDDDFNQLFGM 107

Query: 116 --FTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKG 173
              T+T  +++  + +    E      ++ +VDEVKDME+ARLMSLGLSI++A ++Y+  
Sbjct: 108 GTVTTTDTIQKPDEDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYEND 167

Query: 174 ILYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFS 233
           + YE  +   + K    Q  RN    + K +  K          +   N    ++ NLFS
Sbjct: 168 VTYERYLEILKSK----QKERNDLAIRKKESGIKME-------KSGLSNIVGTDSNNLFS 216

Query: 234 MATDILYKGKELVDQLTAY-PEENNRLYKYREPIDNEEN 271
           MATD   KGK+LVDQ T++ PE N+RL  Y +  D  E+
Sbjct: 217 MATDFFNKGKKLVDQWTSFPPEANDRLNNYSKTHDKVED 255

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score =  355 bits (910), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 221/305 (72%), Gaps = 5/305 (1%)

Query: 403 TVPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462
             PIS IELSG+ EFK +G+ LFKNGDYV++LQEYEKSLN+LP  HPLRII+ SNIIA+Q
Sbjct: 359 VAPISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQ 418

Query: 463 LKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHL 522
           LKIGEYSKSIE+   AL+LFP  K  S+WN  I  S PQRS+ DIW K+++R+AES+EHL
Sbjct: 419 LKIGEYSKSIENSDTALALFPANK--SSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHL 476

Query: 523 ENYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKD 582
           E++K AL++YQ+L+   F + KIM GKRRCQ  +N                      +K 
Sbjct: 477 ESFKNALETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARKPSPVKKTTPTPA--PMKKP 534

Query: 583 TTTASVQRLQDEN-AKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWC 641
           T+T S   + + +  K +E+EN K+ALYD V  KI  WK  KD DIRHLL+NLS +LTWC
Sbjct: 535 TSTPSPAPVDNASRVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWC 594

Query: 642 DWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKL 701
           +W  +S  +LVMPKKVKITY+KA+ KTHPDKIP+SL LENKMIAENVF+ LS AWDKFK 
Sbjct: 595 NWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQ 654

Query: 702 DNNMN 706
            N++N
Sbjct: 655 QNDIN 659

 Score =  108 bits (269), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 131/281 (46%), Gaps = 55/281 (19%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60
           MSDPFA LLTS KN +             K  +AT+ +  +      + +   L +F+ +
Sbjct: 1   MSDPFAHLLTSLKN-KDSGTESKKTTPQTKDFTATSATVVASAATTTQGNNDGLHSFSAS 59

Query: 61  PLIPSSR----------------DASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAP 104
           P+IP+S                   S SN+   SP  IEDDF++LF SN           
Sbjct: 60  PMIPASNVSFSVAPLVPSNSNSNANSASNTPTPSPANIEDDFNELFGSN----------- 108

Query: 105 KKDDIDSAFDIFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSID 164
                        +   L+Q  Q +   ++   D  + ++VDEVKDME+ARLMSLGLSI+
Sbjct: 109 ----------TMATANELQQVDQNYYGNSDGSHD-GDGVLVDEVKDMEIARLMSLGLSIE 157

Query: 165 QANKYYDKGILYEDI--IRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFN 222
           +A  +Y+  + YE    I K ++KK K +   ++       N                FN
Sbjct: 158 KATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGSSSKNAS-------------LFN 204

Query: 223 ESQNNTGNLFSMATDILYKGKELVDQLTAY-PEENNRLYKY 262
            +  N  NLFSMATD   KGKELVDQ T++ PE N+RL  Y
Sbjct: 205 NASPNNNNLFSMATDFFNKGKELVDQWTSFPPEANDRLSNY 245

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score =  355 bits (910), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 177/307 (57%), Positives = 222/307 (72%), Gaps = 5/307 (1%)

Query: 403 TVPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462
            +PIS IELSG+ EFK +GS  FKNGDYV++LQEYEKSLN+LP  HPLRII+ SNIIA+Q
Sbjct: 363 AIPISDIELSGYNEFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQ 422

Query: 463 LKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHL 522
           LK+GEYSKSIE+  +AL+LFP  K    W+ +I DS PQRSF DIW K+++R+AES+EHL
Sbjct: 423 LKVGEYSKSIENSSMALALFPPTKAN--WSNMISDSDPQRSFNDIWPKIMIRRAESFEHL 480

Query: 523 ENYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKD 582
           E++  AL++YQ+LI   F + KIM GKRRCQ  +N                     K   
Sbjct: 481 ESFSNALETYQELINKNFFDEKIMQGKRRCQNFINPPPVKKFSPVKKATSTQSPTEKSTP 540

Query: 583 TTTASVQRLQDENA---KSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLT 639
           T+++S      +     K +E+EN K+ALYDKV  +I++WK DK  DIRHLL+NLS +LT
Sbjct: 541 TSSSSTSSNSPDTTSKIKKQELENAKLALYDKVFERISSWKNDKGDDIRHLLANLSGLLT 600

Query: 640 WCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKF 699
           WC+W  I   DLVMPK+VKITY+KA+ KTHPDKIPESL LENKMIAENVFS LS+AWDKF
Sbjct: 601 WCNWKDIPMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENVFSSLSIAWDKF 660

Query: 700 KLDNNMN 706
           K  N++N
Sbjct: 661 KQQNDIN 667

 Score =  117 bits (293), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 100/272 (36%), Positives = 143/272 (52%), Gaps = 42/272 (15%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPS-QSSIQFNLNKAS---TPSLDT 56
           MSDPFA LLTSFKN                  S+ +PS   S+  +++K       SL +
Sbjct: 1   MSDPFAHLLTSFKNKDSAAESKKETLR-----SSNSPSLPDSVVADISKTDKTINDSLHS 55

Query: 57  FALAPLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAF-DI 115
            + +PLIPSS+         + PPL+  +     N+    +  S P P  D ID  F ++
Sbjct: 56  ISASPLIPSSKVG------FSVPPLVSSN-----NTISANSTNSSPRPPLDHIDDDFNEL 104

Query: 116 F-----TSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYY 170
           F      +T  L++    +    E  K   +E +VDEVKDME+ARLMSLGLSI++A K+Y
Sbjct: 105 FGNGTTAATDTLQKVNDDYCRNNEGRKSNGDEALVDEVKDMEIARLMSLGLSIEKATKFY 164

Query: 171 DKGILYEDIIR--KQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNT 228
           +  I YE  ++  K  +KK K ++ R   +  D N        F+ +  +  F  S+NN 
Sbjct: 165 NDDITYERYLKVLKSNQKKSKDRTAR--ESPGDVN--------FERSELSNNFG-SENN- 212

Query: 229 GNLFSMATDILYKGKELVDQLTAY-PEENNRL 259
            NLFS+AT+   KGKELVDQ T++ PEEN+RL
Sbjct: 213 -NLFSIATNFFNKGKELVDQWTSFPPEENDRL 243

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score =  352 bits (903), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 179/303 (59%), Positives = 219/303 (72%), Gaps = 3/303 (0%)

Query: 404 VPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQL 463
           +PIS IELSG+ E+ +RGS  FKNGDY+SAL+EYEKSLNTLPQ HPLRII+YSNI A +L
Sbjct: 347 IPISSIELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAEL 406

Query: 464 KIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLE 523
           KIGEYS  ++    AL LFPK  +   WN II DS P +S+KDIWSKL++R+AE+ EHLE
Sbjct: 407 KIGEYSNLVKKADKALKLFPKENL--KWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLE 464

Query: 524 NYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDT 583
           N++LA   Y  LIEN   + KIMDGKRRCQK+LN                  +       
Sbjct: 465 NFELAYKQYHSLIENNVFSDKIMDGKRRCQKVLNPEIAKKTQQKPSSSKPAAVPTPSTQK 524

Query: 584 TTASVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDW 643
              SV+R++++N +  E E +K+ LYD VE+KINAWK +K  DIRHLL+NL T+LTW +W
Sbjct: 525 Y-ESVERIKEQNRQEEENEAEKLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEW 583

Query: 644 PSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDN 703
             IS  DLVMPKKVK+TYLKAI KTHPDKI  SL+LE+KMIAEN FS LS+AWDKFK +N
Sbjct: 584 KPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEEN 643

Query: 704 NMN 706
           NMN
Sbjct: 644 NMN 646

 Score =  130 bits (328), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 139/270 (51%), Gaps = 41/270 (15%)

Query: 1   MSDPFASLLTSFK-NGQXXXXXXXXXXXXXKKLSATTPSQSSIQ-FNLN----KASTPSL 54
           MSDPFA+LL SFK NG+                 ++    S++Q   LN    K ST S 
Sbjct: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST 60

Query: 55  DTFALAPLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAFD 114
           ++      +P+  + S  NS  T+P  I DDF +LF S+   N +  P P  +     F 
Sbjct: 61  NS------VPTFANVSSLNSLQTTP--IHDDFEELFGSSTSNNFSVSPEPTNN-----FK 107

Query: 115 IFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGI 174
             T  P +  + +Q               +VDEVKDME+A+LMSLGLSI++AN YY KGI
Sbjct: 108 TVTDVPNVTYEAKQDS-------------VVDEVKDMEIAQLMSLGLSIEKANSYYSKGI 154

Query: 175 LYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSM 234
            Y+ +++K   ++   +  R+        N        D  YA K F+ S+N   NLFSM
Sbjct: 155 SYDTLLKKLERRRYGSRKGRDTPTFGGNTNKD------DKAYA-KLFDSSENT--NLFSM 205

Query: 235 ATDILYKGKELVDQLTAYPEENNRLYKYRE 264
           A+ +  KGKE +DQ+TAYPEE +RL +YR+
Sbjct: 206 ASGLFNKGKEFIDQMTAYPEETDRLSRYRD 235

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score =  337 bits (865), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 231/720 (32%), Positives = 353/720 (49%), Gaps = 137/720 (19%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60
           MS  F  L ++FK G                      +QSS Q  + KA +P ++T   +
Sbjct: 1   MSSAFDDLFSTFKGG----------------------NQSS-QNGIAKAKSPRIET---S 34

Query: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAFDIFTSTP 120
           P I  S D+               D  ++F   +Q N  S PA  KD+ D AFD F +  
Sbjct: 35  PGINYSDDSRNGT-----------DLDEIFGFEKQAN--SAPA-VKDEFDLAFDAFDAPA 80

Query: 121 PLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDII 180
            L Q             D E + +VDE+KDME+ARLMSLGLS  +A  YY++G+LY+D++
Sbjct: 81  KLPQNHM----------DPEPQPLVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLL 130

Query: 181 RKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSMATDILY 240
            ++R+++ ++++P            QK SD         RF  +Q +  +L S+A+  L 
Sbjct: 131 ERKRQQRTREEAP------------QKTSD-------EGRF--TQGSEPDLLSVASSWLN 169

Query: 241 KGKELVDQLTAYPEENNRLYKYREPIDNEENPFLQEXXXXXXXXXXXXXXXXHVXXXXXX 300
           +G+  +D      + +N    Y + I +                        H       
Sbjct: 170 RGRTFLDSKLKQIQNDNGTQSYSDYISSR------------------MESSAHTGSRLRP 211

Query: 301 XXXXXXYVERNSLKYEDNNTTLIDDFDYKLTINSKEPSMAKNIPP------SITPDTTET 354
                  ++R S+ ++D   +L D  +         P  ++ +PP       +     E 
Sbjct: 212 TSDIPTNIDR-SISFQD--LSLADQPNESSVPAQVSPMNSEILPPLVNIGDDVPVSGPEE 268

Query: 355 NNNNALLDFD---GLSTVTAPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVPISHIEL 411
            + + L+DFD   G   V++P                              ++ +S +E 
Sbjct: 269 ASADLLVDFDAPSGHDAVSSP---------------------------VAASIAMSALEF 301

Query: 412 SGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKS 471
             + EFK +G+  F  GDY +A Q +EKS+N+LP  HPLR IS SN+I  +LK+GEY K+
Sbjct: 302 HSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKA 361

Query: 472 IEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDS 531
           IED  +AL L    K+    + +IP S P ++FK+IW K++  +AE+YEH+E+Y  AL  
Sbjct: 362 IEDSSVALKLISCAKL----DDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKE 417

Query: 532 YQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDTTTASV--- 588
           YQ LI+ G  + K+M+G+RRCQKI+                  + +       T+ V   
Sbjct: 418 YQLLIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLSTSPSVSRKDVAVAATSQVPSE 477

Query: 589 --QRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSI 646
             +R+Q+ N K +E+E QK  L+DKV+ ++  W  + + D+R LLS    ++ W DW ++
Sbjct: 478 KLERVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNV 537

Query: 647 SQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706
           S ADLVMPK+VKI YLKA+TKTHPDKI +S  LE KM+AENVF ILS AW+ FK  N ++
Sbjct: 538 STADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score =  329 bits (844), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 166/309 (53%), Positives = 218/309 (70%), Gaps = 11/309 (3%)

Query: 404 VPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQL 463
           VPIS IELSG+ EF+  G+E FK GDY SAL EY+KSLNTLPQ HPLR+ISYSNI+A QL
Sbjct: 536 VPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQL 595

Query: 464 KIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLE 523
           K+GEYS+S++DC +AL LFPK      W Q I DS PQ+++K+IW K+++R+AE+ EH+E
Sbjct: 596 KVGEYSQSVKDCDVALELFPKND--KQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHME 653

Query: 524 NYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDT 583
            Y++A DSYQ L+     N KIM GKRRCQK+LN                 I   K+   
Sbjct: 654 KYQIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSR---ISSAKQSTA 710

Query: 584 TTAS------VQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTV 637
           +T+S      V+RL++   K RE E +++ L D V +KI  W  +K+ DIR+LLSN+  V
Sbjct: 711 STSSINVNKNVERLKETRKKEREEEEERLRLLDSVNAKIQKWTNNKEDDIRYLLSNVHIV 770

Query: 638 LTWCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWD 697
           LTW +W +I+ +DLVMPKKVK+ Y+KA+ KTHPDKI + L +ENKMIAE++FSILS+AW+
Sbjct: 771 LTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830

Query: 698 KFKLDNNMN 706
           KFK  N MN
Sbjct: 831 KFKTANKMN 839

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 81/127 (63%), Gaps = 19/127 (14%)

Query: 140 EEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDIIRKQREKKLKQQSPRNKNNA 199
           +++ +VDEVKDME+A+LMSLGLSID+A+ YY+KG L +D++RK + +K K+QS       
Sbjct: 212 DQQSVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKHKRQS------- 264

Query: 200 QDKNNTQKYSDLFDNTYANK---RFNESQNNTGN--LFSMATDILYKGKELVDQLTAYPE 254
                   YS  +D+T       + N S +  GN  LFS+A+D L KGK +VDQ + Y E
Sbjct: 265 -------NYSTKYDDTKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHE 317

Query: 255 ENNRLYK 261
           E+ R ++
Sbjct: 318 EDYRPFR 324

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score =  324 bits (830), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 159/312 (50%), Positives = 216/312 (69%), Gaps = 11/312 (3%)

Query: 404 VPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQL 463
           +PISHIE+SG+ EFK RG++ FKNGDY SA++EYEKSLNTLP  HPLRII+YSNIIA+++
Sbjct: 352 IPISHIEISGYNEFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRI 411

Query: 464 KIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLE 523
           KIG++S+S+ D + A+ L P+ K  S W   I +S P RS+ DIW K+I+RQAESYE +E
Sbjct: 412 KIGQHSQSVVDAQEAMKLLPEEK--SLWTAAIQNSDPVRSYNDIWPKIILRQAESYEAIE 469

Query: 524 NYKLALDSYQKLIENGFTNSKIMDGKRRCQKIL--------NXXXXXXXXXXXXXXXXXI 575
            YKLALD+YQ L+E    + K++ GKRRCQ  L        N                 +
Sbjct: 470 KYKLALDAYQTLLEKNLFSEKVIAGKRRCQHALGLDSKPKSNPPSKSATPAPAPRRAPTV 529

Query: 576 LKHKE-KDTTTASVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNL 634
            +  E  +  + + ++L+ EN +  ++E+QKVALYDKVE  IN+WK  K  DIR+LLSNL
Sbjct: 530 NRQTEVVNKKSVNAEKLKKENERLAKLEDQKVALYDKVEGIINSWKNGKQDDIRYLLSNL 589

Query: 635 STVLTWCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSL 694
             V+TW  W  +  ++LV+P+KVKITY+KA+ K HPDK+P SL LE +MIAE+VFS LS 
Sbjct: 590 QAVITWTQWKPVQSSELVLPRKVKITYMKAVAKLHPDKLPSSLTLEQQMIAESVFSTLSD 649

Query: 695 AWDKFKLDNNMN 706
           +W+ FK  N++N
Sbjct: 650 SWENFKKSNDIN 661

 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 89/280 (31%), Positives = 129/280 (46%), Gaps = 61/280 (21%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60
           MSDPF  LL S K G               K ++ TP           A TP      L 
Sbjct: 1   MSDPFGHLLASLKEGNVPSSKPGS------KENSVTPG----------ALTPQKK--KLT 42

Query: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDS-------AF 113
           PL   +      N  V S   I DD  DLF S           PKK+D+           
Sbjct: 43  PL--HTESIVHGNGNVVSNTNIHDDLDDLFGS----------IPKKEDVVQDNHTSIDGL 90

Query: 114 DIFTS-------TPPLEQQQQ--QHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSID 164
           D+F S       T P  Q+     +   TEH+ +   E ++DEV+DME+A+LMSLGL+ID
Sbjct: 91  DLFQSSSHVVSKTEPDNQEINPFDNPFETEHKSESPTEEVIDEVRDMELAKLMSLGLNID 150

Query: 165 QANKYYDKGILYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNES 224
           +A+ YY++GI +ED++RK+++K       + ++N   K    +  ++FD   +       
Sbjct: 151 KASSYYERGITFEDVLRKRKQK--ASNGYQQRSNIDRKQGGGEIRNIFDTRGSGSE---- 204

Query: 225 QNNTGNLFSMATDILYKGKELVDQLTAYP-EENNRLYKYR 263
                   S+ + IL KGKELV+QL+ Y  EEN R+ K++
Sbjct: 205 --------SLFSGILNKGKELVNQLSTYTEEENERMNKFK 236

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score =  322 bits (824), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 173/393 (44%), Positives = 240/393 (61%), Gaps = 32/393 (8%)

Query: 322 LIDDFDYKLTINSKEPSMAKNIPPSITPD---TTETNNNNALLDFDGLSTVTAPGXXXXX 378
           L+D F+  + I         NIPP IT       E   +N LLDF G   +++P      
Sbjct: 323 LLDSFEENIVIGES----FTNIPPRITERQKPNDERIQDNTLLDF-GNEDLSSPANVSIS 377

Query: 379 XXXXXXXXXXXXXXXXXXXXXXXXTVPISHIELSGHIEFKTRGSELFKNGDYVSALQEYE 438
                                    + I+ IELSG+ EFK RG+E FK GDYVSA ++YE
Sbjct: 378 SSGQECIP----------------VISINQIELSGYNEFKDRGTEYFKKGDYVSATEQYE 421

Query: 439 KSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDS 498
           KSLN+L + HPLRII+ SN++A+ LK G+Y+  I     AL LFPK   +  W+ +I +S
Sbjct: 422 KSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITISTSALDLFPKE--SKLWDNVIQNS 479

Query: 499 TPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNX 558
            P +++K+IWSKL+ R+AE++E +ENY+ A DSYQ LIEN   N KIM GK RCQK+LN 
Sbjct: 480 EPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIENNIFNEKIMAGKLRCQKVLNP 539

Query: 559 XXXXXXXXXXXXXXXXILKHKEKD------TTTASVQRLQDENAKSREIENQKVALYDKV 612
                               + K+      T++ +++++Q++N ++ + E +K ALYD V
Sbjct: 540 ETHNKPLKKLVATTAETKTSQTKNIVNTQSTSSGNLKKIQEQNKRTEKYEEEKEALYDVV 599

Query: 613 ESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQADLVMPKKVKITYLKAITKTHPDK 672
           E K+NAW   KD DIRHLLS L  ++TW  W  ++ +DLVMPKKVKITYLKA+ KTHPDK
Sbjct: 600 EQKVNAWIAGKDDDIRHLLSRLQRIITWTQWNEVASSDLVMPKKVKITYLKAVAKTHPDK 659

Query: 673 IPESLDLENKMIAENVFSILSLAWDKFKLDNNM 705
           +P +LD E++M+AEN+FSILS  W+KFK+DNN+
Sbjct: 660 LPSNLDTESRMLAENIFSILSKNWEKFKVDNNI 692

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 85/284 (29%), Positives = 132/284 (46%), Gaps = 61/284 (21%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSS---IQFNLNKASTPSLDTF 57
           M+DPFA LLTSFK G              ++ S T  S ++   +  N    S+ ++   
Sbjct: 1   MADPFADLLTSFKTG-----------PNERENSGTAQSNTTSRNLSMNELLNSSSNVKNS 49

Query: 58  ALAPLIPSSRDASKSNSRVTSPPLI-------EDDFSDLFNSNEQKNIT----SPPAPKK 106
            L  L P +++    N   + P  +        DDF DLF  ++    T         ++
Sbjct: 50  NLDVLQPKAKNVDMLNKSTSVPSNVINNNKNLLDDFDDLFGPSKPSVTTNTFKGTDQGER 109

Query: 107 DDIDSAFDIFTSTPP---LEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSI 163
           DD+D   D+F  TP      Q+        E +   + E+IVDEVKDME+A+LMSLGLSI
Sbjct: 110 DDLDDIMDMFDFTPSPSHCNQEVMPSKTNAEAQSSSKNEVIVDEVKDMEIAKLMSLGLSI 169

Query: 164 DQANKYYDKGILYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKR--- 220
           D+A K ++ GILY+ +  +Q+                     Q++S     + +N+R   
Sbjct: 170 DEAIKSFEHGILYDTVASRQQA-------------------AQRFS-----SSSNRRGTP 205

Query: 221 -FNESQNNT--GNLFSMATDILYKGKELVDQLTAYPEENNRLYK 261
             N   NN+  G LFS    I+ K K+L+D  T   +E++RL++
Sbjct: 206 IANSGTNNSSGGGLFS---SIIGKSKQLIDDWTVNHDEDDRLFR 246

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score =  300 bits (767), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 196/637 (30%), Positives = 309/637 (48%), Gaps = 81/637 (12%)

Query: 88  DLFNSNEQKNITSPPAPKKDDIDSAFDIFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDE 147
           D F  ++  N TS  A  +D+ D AFD+               LV     + + + +VDE
Sbjct: 50  DAFFGSKTSNATSGTA--RDEFDLAFDMLNGPVASRLAAPDVDLV-----EPKPQPVVDE 102

Query: 148 VKDMEVARLMSLGLSIDQANKYYDKGILYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQK 207
           VKDME+ARLMSLGL  D+A +YY++GILYE ++ +Q+ +  + + P  + + Q     ++
Sbjct: 103 VKDMEIARLMSLGLDWDKAAEYYERGILYEQVVDRQKRRTARTERPL-RTSPQSSQLREE 161

Query: 208 YSDLFDNTYANKRFNESQNNTGNLFSMATDILYKGKELVDQ-----LTAYPEENNRLYKY 262
            SDLF                    S+A++ L KG+  +D       T Y + +   Y  
Sbjct: 162 ESDLF--------------------SVASNWLNKGRTFLDSKLKQVQTEYSDRSFSDYIS 201

Query: 263 REPIDNEENPFLQEXXX-XXXXXXXXXXXXXHVXXXXXXXXXXXXYVERNSLKYEDNNTT 321
                N   P+L+E                               +  R +       + 
Sbjct: 202 SRSGSNASPPWLKESGSYHLQVSSDRGKQKVTTQFKDLKIEEETHFGPRANSPVPSTKSP 261

Query: 322 LIDDFDYKLTINSKEPSMAKNIPPSITPDTTETNNNNALLDFDG--LSTVTAPGXXXXXX 379
            +        + S+ P      PP+ +P      +N+ L+DF+   L T   P       
Sbjct: 262 AVSVASASHPVYSETPGDKSEAPPNPSP----VQDNDLLIDFEAPALKTSNVPATYSPN- 316

Query: 380 XXXXXXXXXXXXXXXXXXXXXXXTVPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEK 439
                                     ++ +E     EFK +G+  F+ GDY +A Q YEK
Sbjct: 317 --------------------------LTELERHSFEEFKEKGANSFRTGDYHAAFQNYEK 350

Query: 440 SLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDST 499
           SLN+LP  HPLR++S+SNII  +LK+GEY +++ D   AL L P+G +    N  IP+  
Sbjct: 351 SLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSM----NSNIPNLN 406

Query: 500 PQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNXX 559
           P +++K+ WSK++  +A ++E +ENY+ AL++YQ+LIE G T+SK+++ +R+CQK +   
Sbjct: 407 PPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALE 466

Query: 560 XXXXXXXXXXXXXXXILKHKEK----------DTTTASVQRLQDENAKSREIENQKVALY 609
                               +K          +  +  + R+QD N K +++E Q+  L+
Sbjct: 467 KKPVSVARKSETSIPKAAVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLH 526

Query: 610 DKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQADLVMPKKVKITYLKAITKTH 669
           D+V S I  W    D ++R LL+   T++ W +W  +S ADLV+PKK K+ YLKA+ KTH
Sbjct: 527 DEVSSLIQEWCEGHDDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTH 586

Query: 670 PDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706
           PDKI +S  L+ KMIAENVF +LS AW+ FK  N ++
Sbjct: 587 PDKIQDSWPLKRKMIAENVFIVLSKAWETFKEKNQLS 623

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score =  295 bits (756), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 215/313 (68%), Gaps = 19/313 (6%)

Query: 404 VPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQL 463
           + IS +ELSG  EFK++G ELF +G+Y SAL EYEKSLNTLP  HPLRIIS SNII TQL
Sbjct: 279 ISISAMELSGFGEFKSKGGELFAHGNYSSALLEYEKSLNTLPSGHPLRIISLSNIITTQL 338

Query: 464 KIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLE 523
           K+GE S ++++ + AL L  + ++       IP S P +S+++ W K+ MR+AE+ EH+E
Sbjct: 339 KLGESSSALQNIETALRLIGEDEL----QLTIPASNPPKSYREFWGKITMRKAEALEHVE 394

Query: 524 NYKLALDSYQKLIENGFTNSKIMDGKRRCQKILN--XXXXXXXXXXXXXXXXXILKHKEK 581
           NY  AL+ Y+ LI+ GF  SK+MDGKRRCQK+L+                   +L     
Sbjct: 395 NYVSALECYKALIDKGFVTSKVMDGKRRCQKVLSPPKPQSGIPPVARKKPSPNVL----- 449

Query: 582 DTTTAS-------VQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNL 634
           DT++++       ++++Q  N ++ ++EN+K  L DKV+ +I +W   K+ D+R LL++L
Sbjct: 450 DTSSSTLPKRSDNLEKIQRINREAEQLENKKFLLRDKVDEQIKSWSQGKENDLRQLLADL 509

Query: 635 STVLTWC-DWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILS 693
             VLTW  DW  ++ +DLVMPKKVKITYLKAI KTHPDK+ +SLD+E+KM+AE++FSILS
Sbjct: 510 PKVLTWSNDWKPVTTSDLVMPKKVKITYLKAIAKTHPDKLNDSLDVEHKMLAEDIFSILS 569

Query: 694 LAWDKFKLDNNMN 706
            AW+ FK +NN++
Sbjct: 570 KAWEAFKEENNIS 582

 Score = 99.0 bits (245), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 60/167 (35%), Positives = 98/167 (58%), Gaps = 30/167 (17%)

Query: 89  LFNSNEQKNITSPPAPKK------DDIDSAFDIFTSTPPLEQQQQQHGLVTEHEKDYEEE 142
           LF+ ++  +I+SP AP K      DD+D+AFD+F S      +Q                
Sbjct: 29  LFDKHDGPSISSP-APSKPLQTINDDLDAAFDVFNSATNTPAKQGSP------------- 74

Query: 143 IIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDIIRKQREKKLKQQSPRNKNNAQDK 202
            +VDEVKDME+ARLMSLG+S+++A +YY++GILY+D++R++ EK        ++   Q  
Sbjct: 75  -VVDEVKDMEIARLMSLGVSLERALQYYERGILYDDVLRRRHEK--------HEAKRQAA 125

Query: 203 NNTQKYSDLFDNTYANKRFNE-SQNNTGNLFSMATDILYKGKELVDQ 248
             ++ ++ LFDN  +N   ++ S +   +LFSMAT +  KGK  +++
Sbjct: 126 AASRDFTKLFDNGSSNILGSDGSDDKQQDLFSMATGLFNKGKSFMEE 172

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score =  259 bits (663), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 188/300 (62%), Gaps = 3/300 (1%)

Query: 406 ISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKI 465
           IS  EL+   EFK  G + F +GDY +AL E+EKS NTLP  HPLRIIS SNI++ QLK+
Sbjct: 325 ISDFELTSFNEFKNNGVKYFSSGDYHNALLEFEKSFNTLPFKHPLRIISLSNIVSCQLKL 384

Query: 466 GEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENY 525
           GE SK++E  K+AL L     +    + II  S P+R+FK + +K+ ++ AE  EHLENY
Sbjct: 385 GENSKALESVKLALDL---SDLAPNASDIIEHSVPERTFKQMINKIQLKHAEIQEHLENY 441

Query: 526 KLALDSYQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDTTT 585
           + AL  Y  LI NG T  K+MDGKRRC+KI+N                 +         T
Sbjct: 442 EKALSLYANLISNGITEQKVMDGKRRCEKIVNPEKFKPAKEKISSPTIPVRSKTSISADT 501

Query: 586 ASVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPS 645
            +V R+++EN K  E E +++ L DKV+ KI+ W  + + D+R+LL+NL  +L W  W  
Sbjct: 502 VAVNRVKEENKKQEEEEEERLRLRDKVDEKISEWTKNNENDLRYLLANLEPLLWWASWKE 561

Query: 646 ISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNM 705
           +S  DLVM KKVKI YLKAI KTHPDKIP    LE  MIAENV++IL+ AW+ FK  NN+
Sbjct: 562 VSPQDLVMTKKVKICYLKAIAKTHPDKIPADASLETIMIAENVYTILNKAWEYFKSQNNI 621

 Score =  102 bits (255), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 123/255 (48%), Gaps = 44/255 (17%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60
           MSDPFA LL+SFK G                L+    S S++   L++ S  +       
Sbjct: 1   MSDPFADLLSSFK-GVNSSTGNNSSANKNASLNDLLSSHSALTSPLSRKSPSN------- 52

Query: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQ--------KNITSPPAPKKDDIDSA 112
             +PS    S S   +TS    +D F DL  +  Q          +    A +KDD D A
Sbjct: 53  --VPSKTPESIS---ITSMTASQDFFDDLLAAPSQVTPLRESPSQVAPSTATEKDDFDLA 107

Query: 113 FDIFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDK 172
           F+ F STP ++  Q Q   + E +       +VDEVKDME+ARLMSLGLS D+A  YYDK
Sbjct: 108 FESFNSTPHVDLVQPQPDPIPEPQP------LVDEVKDMEIARLMSLGLSFDKAVHYYDK 161

Query: 173 GILYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLF 232
           GI+YE++I  Q+++K   QS  N NN              D      R  ES++++    
Sbjct: 162 GIMYEELIESQKKRK---QSRSNVNN--------------DFGQQQLRKQESRDSSPAFI 204

Query: 233 SMATDILYKGKELVD 247
           S+A+++   GKE ++
Sbjct: 205 SVASNLFNMGKEFIE 219

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score =  258 bits (658), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 206/313 (65%), Gaps = 17/313 (5%)

Query: 404 VPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQL 463
           VPIS IE+SG+ EF   G + F+NGDY +A Q+Y KSLNTLP  HPLRI++YSNII TQL
Sbjct: 356 VPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQL 415

Query: 464 KIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLE 523
           KIGE+++S+++ + A  L       S+ + II  + P +++K+ W+K+I ++AE  E+LE
Sbjct: 416 KIGEHTESLKNIEKACDLLD----GSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLE 471

Query: 524 NYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDT 583
           +Y  AL  Y+ LI  G  + KI++GK RCQK                    + K K   +
Sbjct: 472 HYDEALAVYRCLISKGVFDKKIIEGKTRCQK---HSKITSEPATEDSALAPVQKDKVPKS 528

Query: 584 TTASV--QRLQDENAKS--------REIENQKVALYDKVESKINAWKLDKDTDIRHLLSN 633
             +S+  +R++ + A+         +E+E QK  L+DKV SKI +W   K+TD+RHLLS 
Sbjct: 529 NNSSIPERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDLRHLLSR 588

Query: 634 LSTVLTWCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILS 693
           LS VLTW +W  I   DLV+PKKVKI Y+KAI+K HPDK+P +LDLE+KM+AE++FS+L 
Sbjct: 589 LSLVLTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLG 648

Query: 694 LAWDKFKLDNNMN 706
            AW+ FKL+N++N
Sbjct: 649 NAWNVFKLNNDIN 661

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 116/260 (44%), Gaps = 53/260 (20%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNL-NKASTPSLDTFAL 59
           M DPFA+LL++FK                K+L  ++P  +S+   L   +S     + AL
Sbjct: 1   MGDPFATLLSNFKG-------------EKKELVQSSPRNASLNAILCESSSKSFESSSAL 47

Query: 60  APLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQ-------KNITSP-PAPKKDDIDS 111
             L    +D SK+   V   P  E+ FS+  ++++        ++  SP P P+K+ I  
Sbjct: 48  DKL--QVQDTSKNAKTVQYDP--ENAFSERNSADDSLNELFCLRDSASPLPPPEKESI-- 101

Query: 112 AFDIFTSTP---PLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANK 168
           AFD  T+     P    +   GL         E  +++ V  ME   + + G+S + AN 
Sbjct: 102 AFDFDTTVRDLNPANLNEAMWGL---------EGPLLEGVHGMESEPINARGISTEDANS 152

Query: 169 YYDKGILYEDIIRK-QREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNN 227
            YD+G+ Y D     Q  KK +Q++        D +N        D  +  ++ NE +  
Sbjct: 153 CYDQGLFYIDAQEVLQNGKKFQQRNGFTAGQRSDSDN--------DRVFTFRKDNEEE-- 202

Query: 228 TGNLFSMATDILYKGKELVD 247
             NL S A+++  KG++LV+
Sbjct: 203 --NLISFASNLFTKGRDLVE 220

>AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR320C
           (SWA2)
          Length = 648

 Score =  244 bits (623), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 196/308 (63%), Gaps = 10/308 (3%)

Query: 404 VPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQL 463
           V I+ +ELSG+ +F    +E +K GDY +A Q+Y KSLNTLP  HPLRII+ SNII TQL
Sbjct: 346 VSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQL 405

Query: 464 KIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLE 523
           KIGE+++S+++   A+ L         ++  I D++P R++K+ W K++ ++AE  E  +
Sbjct: 406 KIGEHTESMKNINSAVELLQD----VPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQD 461

Query: 524 NYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNXXXXXXXXXXXXXXXXXILKHKEKDT 583
           NY+ AL  YQ+LI  G+T   I++GK RCQK  N                   K+  K T
Sbjct: 462 NYEAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGNVSSNPTATTQGD-RKNPRKQT 520

Query: 584 TTA-----SVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVL 638
            TA      V+RL+ +N    + EN++  L+DKVES+I  W   K TD+RHLL  L  +L
Sbjct: 521 ATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDLRHLLLGLPALL 580

Query: 639 TWCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDK 698
            W +   +  +DLVMPK+VK++YLKA++KTHPDK+P++L+LE KM+AE+VF  L+ AW  
Sbjct: 581 PWLNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGV 640

Query: 699 FKLDNNMN 706
           FK +N+++
Sbjct: 641 FKEENSLS 648

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 76/185 (41%), Gaps = 25/185 (13%)

Query: 1   MSDPFASLLTSFKNGQXXXXXXXXXXXXXKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60
           MSDPFA+LLT FK  +               L A   S SS+        TP  DT   A
Sbjct: 1   MSDPFANLLTKFKGKEKPADAQTSKNRSLNDLLAQH-SVSSLSEPPATLYTPR-DTRPAA 58

Query: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAFDIFTSTP 120
            L+   R++          P +  + S ++ S         P+ +     S  D+  + P
Sbjct: 59  GLVDLGRES----------PNLPGETSGIYQSGRGN-----PSTEGYKSQSLIDLEDAQP 103

Query: 121 PLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDII 180
                   H   +    + +   I DE +D E+A+LMSLGL I  AN YY +G  YE + 
Sbjct: 104 --------HPAASVSSFEDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLR 155

Query: 181 RKQRE 185
            ++ E
Sbjct: 156 MRRAE 160

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E+KT G+  FK+G+Y+ A++ Y+K +   P+ +P   I YSN   + +K+ +Y++++E C
Sbjct: 5   EYKTTGNTYFKDGNYLKAVEYYKKCIEVEPE-NP---IGYSNSAMSLIKLTKYTEALESC 60

Query: 476 KIAL 479
              L
Sbjct: 61  GTGL 64

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 59/130 (45%), Gaps = 29/130 (22%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
            K RG+E FK  DY +AL+ Y  +L  + +  P   + YSNI A  + +G+  K +E+  
Sbjct: 104 LKDRGNEFFKKKDYDNALKYYNYAL--VVKKDP---VFYSNISACYVSLGQLDKVVENST 158

Query: 477 IALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLI 536
            AL L P                        +SK ++R+A + E LENY  A+     L 
Sbjct: 159 KALELKPD-----------------------YSKALLRRASANESLENYADAMFDLSVLS 195

Query: 537 ENG-FTNSKI 545
            NG F  S I
Sbjct: 196 LNGDFNGSSI 205

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FKT G++ FK G+Y SA++ YEK +   P+ +P   I YSN     +K  +  +++  C+
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPE-NP---IGYSNKAMALIKANKNQEAVRTCQ 61

Query: 477 IALSLFPKGKVT 488
             L    K   T
Sbjct: 62  DGLKRVSKNDAT 73

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           ++K  G+  FK G Y  A + Y+K ++  P+ +P   I YSN     +K+G Y++ +E C
Sbjct: 5   QYKEEGNRNFKEGSYKVAAELYQKCVDIEPE-NP---IGYSNKAMALIKLGRYTEVVELC 60

Query: 476 KIALSLFP 483
           +  L+  P
Sbjct: 61  RKGLTFTP 68

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (55%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G++L+K   +  A + Y K ++   Q + +    Y+N  A +L+I  Y + I DCK
Sbjct: 84  FKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCK 143

Query: 477 IALSLFPK 484
            AL L PK
Sbjct: 144 QALQLNPK 151

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%), Gaps = 2/75 (2%)

Query: 410 ELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYS 469
           E++G+  FK +G++L+K   +  A + Y K+++       +    Y+N  A +L++  Y 
Sbjct: 72  EIAGN--FKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYR 129

Query: 470 KSIEDCKIALSLFPK 484
           + I DCK+ALSL PK
Sbjct: 130 RCINDCKMALSLNPK 144

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 410 ELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYS 469
           E++G+  FK RG+E +K   Y  A + Y K ++       +    Y+N  A +L++  + 
Sbjct: 72  EIAGN--FKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFR 129

Query: 470 KSIEDCKIALSL 481
           K IEDCK ALS 
Sbjct: 130 KCIEDCKKALSF 141

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 56/127 (44%), Gaps = 32/127 (25%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSL--NTLPQYHPLRIISYSNIIATQLKIGEYSKSI 472
           ++ K +G++ FK  DY +A++ Y  +L  N  P       I YSNI A  + +G+  K I
Sbjct: 123 MQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP-------IFYSNISACYVSLGQLDKVI 175

Query: 473 EDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSY 532
           E    AL L P                        +SK ++R+A + E LENY  AL   
Sbjct: 176 ESSTKALELNPN-----------------------YSKALLRRASANESLENYSDALFDL 212

Query: 533 QKLIENG 539
             L  NG
Sbjct: 213 SVLSLNG 219

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 410 ELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYS 469
           E++G   FK +G+EL+K   +  A + Y K LN   +   +    ++N  A +L++  Y 
Sbjct: 81  EIAGG--FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYR 138

Query: 470 KSIEDCKIALSLFPK 484
           + IEDC  ALS+ PK
Sbjct: 139 RCIEDCSKALSINPK 153

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 37/62 (59%), Gaps = 4/62 (6%)

Query: 418 KTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKI 477
           K +G+ LFK G Y  A+  Y++ +   PQ +P   + YSN     +K+GEY+++I+ C+ 
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQ-NP---VGYSNKAMALIKLGEYTQAIQMCQQ 63

Query: 478 AL 479
            L
Sbjct: 64  GL 65

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 418 KTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKI 477
           K  G+EL+K G Y  A+  Y++ +   PQ +P   + +SN     +K+GE++++IE C+ 
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQ-NP---VGHSNKAMALIKLGEHAQAIEACQQ 63

Query: 478 ALSL 481
            L L
Sbjct: 64  GLQL 67

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G+EL+K   +  A + Y K L    +   +    Y+N  A +L++  Y + IEDC 
Sbjct: 86  FKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCS 145

Query: 477 IALSLFPK 484
            AL++ PK
Sbjct: 146 KALTINPK 153

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 54/115 (46%), Gaps = 28/115 (24%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           IE K +G+E FK  DY +AL+ Y+ +L  + +  P   + YSN+ A  + + E  K IE 
Sbjct: 109 IELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEM 163

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529
              AL L P                        +SK ++R+A + E LENY  A+
Sbjct: 164 STKALELKPD-----------------------YSKALLRRATANEQLENYSDAM 195

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 63/132 (47%), Gaps = 29/132 (21%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +  K +G+ELFK      A++ Y+ +L    +  P   + Y+NI A  + + ++ K +E+
Sbjct: 107 LALKDKGNELFKEKAVEEAIKYYQWALEF--KKDP---VFYANISACYVSLNDFEKVLEN 161

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534
           C  AL L P                        +SK+++R+A +YE++EN+  A+     
Sbjct: 162 CNKALELKPD-----------------------YSKVLLRRANTYENMENFADAMFDLSV 198

Query: 535 L-IENGFTNSKI 545
           L + N F+ + I
Sbjct: 199 LSLNNDFSGASI 210

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 39.7 bits (91), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 38/62 (61%), Gaps = 4/62 (6%)

Query: 418 KTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKI 477
           K +G+ LFK G Y+ A+  Y++ +   PQ +P   + YSN     +K+GE++++I+ C+ 
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQ-NP---VGYSNKAMALIKLGEHAQAIQACQQ 67

Query: 478 AL 479
            L
Sbjct: 68  GL 69

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 404 VPISHIELSGHIE-FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462
           +P+   E+    E FK  G++     DY  A+++Y +++ TLP      +I Y+N  A  
Sbjct: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPT----NVIYYANRAAAY 143

Query: 463 LKIGEYSKSIEDCKIALSLFP 483
             + EY  +I+D + A+ + P
Sbjct: 144 SSVKEYDNAIKDAEKAIEIDP 164

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 60/132 (45%), Gaps = 29/132 (21%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +  K +G++ FK  D+ +AL+ Y  +L TL Q  P   + YSNI A  + +G+  K +E 
Sbjct: 106 MALKDKGNDYFKKQDFENALKYYNYAL-TLKQ-DP---VFYSNISACYVSLGQLEKVVES 160

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534
              AL L                       K  +SK ++R+A +YE L NY  A+     
Sbjct: 161 STEALKL-----------------------KHDYSKALLRRASAYESLANYVDAMVDLSV 197

Query: 535 LIENG-FTNSKI 545
           L  NG F  + I
Sbjct: 198 LSLNGDFNGASI 209

>KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 370

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 32/122 (26%)

Query: 421 GSELFKNGDYVSALQEYEKSLNTLPQYHP-------------LRIISYSNIIATQLKIGE 467
           G+ LFK   +  AL +YEKS + L QY P             LRI  + NI    +K G+
Sbjct: 225 GTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFLNIALCAIKTGD 284

Query: 468 YSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKL 527
           Y K++                ++  +++ D+      K   +K + R+  +Y HL++ ++
Sbjct: 285 YQKAL----------------TSTTEVVHDAAADDKSK---AKALYRRGLAYYHLKDPEM 325

Query: 528 AL 529
           A+
Sbjct: 326 AI 327

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 60/130 (46%), Gaps = 29/130 (22%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
            K +G+E FK  DY +AL+ Y+ +L TL +  P   + YSNI A  + + +  K +E+  
Sbjct: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKK-DP---VFYSNISACYVSMNQLDKVVENST 163

Query: 477 IALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLI 536
            AL L P                        +SK ++R+A + E LENY  A+     L 
Sbjct: 164 KALELKPD-----------------------YSKALLRRASANESLENYPDAMFDLSVLS 200

Query: 537 ENG-FTNSKI 545
            NG F  S I
Sbjct: 201 LNGDFGGSSI 210

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           + FK  G+   K  +Y+ A++ Y +++    +  P + I +SN    QLK+  +   + D
Sbjct: 13  VAFKNEGNTYIKEQNYMKAIELYSQAI----ELDPTQSIFFSNRALAQLKLDNFQSCMND 68

Query: 475 CKIALSLFPK 484
           C +AL L PK
Sbjct: 69  CDVALRLDPK 78

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 407 SHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIG 466
           S+I+     E + +G E F  GD+ SA+  Y + +   P+        YSN  A   K+ 
Sbjct: 394 SYIDPEKAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPE----DARGYSNRAAVLAKLM 449

Query: 467 EYSKSIEDCKIALSLFP 483
            +  +I+DC +A+S  P
Sbjct: 450 SFPDAIKDCDVAISKDP 466

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 418 KTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKI 477
           K  G+ LFK G Y  A+  Y++ +   PQ +P   + YSN     +K+ EY+ +I+ C+ 
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQ-NP---VGYSNKAMALIKLAEYTHAIQTCQE 67

Query: 478 AL 479
            L
Sbjct: 68  GL 69

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G+EL+K   +  A + Y K +    +   +    ++N  A +L++  Y + IEDC 
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCS 145

Query: 477 IALSLFPK 484
            AL++ PK
Sbjct: 146 KALTINPK 153

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E + +G E F  GD+ +A++ Y + +   PQ        +SN  A   K+  + ++IEDC
Sbjct: 382 EARLQGKEFFTKGDWPNAVKAYTEMVKRAPQ----DARGFSNRAAALAKLMSFPEAIEDC 437

Query: 476 KIALSLFP 483
             A+S+ P
Sbjct: 438 NKAVSIDP 445

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G+EL+K   +  A + Y K +    +   +    ++N  A +L++  Y K +EDC 
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCG 145

Query: 477 IALSLFPK 484
            AL++ PK
Sbjct: 146 KALTINPK 153

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 8/86 (9%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G++L+K   +  A + Y K +        +    Y+N  A QL++  +   I DCK
Sbjct: 81  FKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCK 140

Query: 477 IALSLFPK--------GKVTSAWNQI 494
            AL+  PK        GK  +A N+ 
Sbjct: 141 TALTYNPKNIKCYFRMGKAFTAINKF 166

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E K +G+  FKNG Y  A+  Y + ++  P  +P   I YSN     LK   + ++I  C
Sbjct: 5   ELKAKGNISFKNGSYSEAISWYNRCISIDPS-NP---IGYSNKAMALLKADRFDEAITTC 60

Query: 476 KIALSLFPK 484
           +  L L  K
Sbjct: 61  EKGLQLISK 69

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 55/125 (44%), Gaps = 28/125 (22%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +  K +G++ FK   Y  AL+ Y  +L+ L Q  P   + YSNI A  + +G   K +E 
Sbjct: 100 VALKDKGNQFFKEQKYEDALKYYNYALD-LKQ-DP---VFYSNISACYVSLGNLEKVVES 154

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534
              AL L P                        +SK ++R+A + E+LEN+  A+     
Sbjct: 155 STKALELKPD-----------------------YSKALLRRASANENLENFAEAMFDLSV 191

Query: 535 LIENG 539
           L  NG
Sbjct: 192 LSLNG 196

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           + K +G+  FKNGDY +A+  YEK+   L   +P   I +SN+    +K+  + +++  C
Sbjct: 43  DLKVKGNTFFKNGDYETAILYYEKAC-ALDSSNP---IYFSNMATALIKLERWQEAVNAC 98

Query: 476 KIAL 479
              L
Sbjct: 99  DKGL 102

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 36.2 bits (82), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           EFK +G+  +K  ++  A+  Y+K++     Y P   + YSN     +K+  Y+ + + C
Sbjct: 6   EFKIKGNTAYKQNNFTDAVNFYKKAIT----YDPTNPVGYSNCAMALIKLNNYADASQMC 61

Query: 476 KIAL 479
           +  L
Sbjct: 62  QRGL 65

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G++LF    +  A   Y K +    +   +    ++N  A QL++  Y   I DCK
Sbjct: 83  FKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCK 142

Query: 477 IALSLFPK 484
            AL+L PK
Sbjct: 143 HALTLNPK 150

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query: 410 ELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYS 469
           E++G+  FK +G++L+K   +  A + Y K +        +    Y+N  A +L+I  Y 
Sbjct: 76  EIAGN--FKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYR 133

Query: 470 KSIEDCKIALSLFPK 484
           + + DCK AL   PK
Sbjct: 134 RCLNDCKTALQYNPK 148

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 38.1 bits (87), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 36/119 (30%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRI----ISYSNIIATQLKIGEYSK 470
           +  K +G+ELFK   +  A++ Y         ++ L++    I YSNI A    + +Y K
Sbjct: 111 MALKDKGNELFKTSKFEDAIKYY---------HYALKLKDDPIYYSNISACYASLLQYEK 161

Query: 471 SIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529
            IE    AL L P                        +SK++MR+A +YE + N+  A+
Sbjct: 162 VIEYATKALKLRP-----------------------TFSKVLMRRALAYEAMGNFGDAM 197

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E K +G++   N +Y  A+++Y ++++ LP       I Y+N  A    + EY ++I+D 
Sbjct: 104 ELKIQGNKAMANKEYELAIKKYTEAIDVLP----TNAIYYANRAAAHSSLKEYDEAIKDA 159

Query: 476 KIALSLFP 483
           + A+S+ P
Sbjct: 160 ESAISVDP 167

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 37.7 bits (86), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 410 ELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYS 469
           +++  +EFK  G+   K  +Y  A++ Y K++    +  P + I YSN    QLK+  + 
Sbjct: 8   DIAKAVEFKNEGNVFIKEQNYSKAIELYTKAI----ELDPNQSIFYSNRALAQLKLDNFQ 63

Query: 470 KSIEDCKIALSL 481
            +  DC  AL+L
Sbjct: 64  SAYNDCNEALTL 75

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 37.7 bits (86), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 51/118 (43%), Gaps = 36/118 (30%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRI----ISYSNIIATQLKIGEYSKS 471
           E K +G++ FK+ D  +A++ YE         + LR+    + YSNI A    + +  K 
Sbjct: 160 ELKNKGNQYFKSKDNENAIKYYE---------YALRLDQDPVFYSNISACYFAMNQLDKV 210

Query: 472 IEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529
           IE    AL L P                        +SK ++R+A +YE L N K AL
Sbjct: 211 IESSNKALELKPD-----------------------YSKALLRRANAYEALGNNKEAL 245

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G+EL+K   Y  A + Y K +      + +    +SN  A +L++  Y + + DC+
Sbjct: 81  FKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCR 140

Query: 477 IALSLFP 483
            AL   P
Sbjct: 141 QALQFNP 147

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 28/115 (24%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +  K +G+E FKN  Y  A+Q Y  ++    +  P   + YSN  A  + +G+  K +ED
Sbjct: 96  MGLKDKGNEFFKNKKYDEAIQYYSWAIEV--KEDP---VFYSNRSACYVSLGQQEKVVED 150

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529
              AL L P                        +SK ++R+A + E L N+  A+
Sbjct: 151 TTAALKLKPD-----------------------YSKCLLRRASANESLGNFADAM 182

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E + +G E F  GD+ +A++ Y + +   P+        YSN  A   K+  + ++I+DC
Sbjct: 395 EARLQGKEYFTKGDWPNAVKSYTEMIKRAPE----DARGYSNRAAALSKLMSFPEAIKDC 450

Query: 476 KIALSLFP 483
            +A+S  P
Sbjct: 451 NVAISKDP 458

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 410 ELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYS 469
           +++  ++FK +G+E  K  DY SA++ Y K++         + I +SN     LK   + 
Sbjct: 8   DIATALDFKNKGNEYIKKSDYDSAIEFYSKAI----ALDSTQSIYFSNRALAHLKQDNFY 63

Query: 470 KSIEDCKIALSLFPK 484
            ++ DC  AL L PK
Sbjct: 64  SAVVDCDNALKLDPK 78

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +E+K  G+   K  DY  A+++Y+K++    +    + + +SN     LK+  +  + +D
Sbjct: 10  LEYKNEGNACVKVQDYAKAIEKYDKAI----ELDDTQSVYFSNRALCHLKLDNFQCASQD 65

Query: 475 CKIALSLFPK 484
           C  AL+L PK
Sbjct: 66  CDKALALDPK 75

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 10/73 (13%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSL---NTLPQYHPLRIISYSNIIATQLKIGEYSKS 471
           +EFK RG++  K  DY  A++ Y +++   +T+  Y       +SN     LK+  +   
Sbjct: 13  LEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIY-------FSNRAMGHLKMDNFQSG 65

Query: 472 IEDCKIALSLFPK 484
           I DC  AL + PK
Sbjct: 66  INDCDKALEIDPK 78

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           + K +G++   N DY  A+ +Y +++  LP       I Y+N  A    + EY ++++D 
Sbjct: 104 DLKMQGNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAAAHSSLKEYDQAVKDA 159

Query: 476 KIALSLFP 483
           + A+S+ P
Sbjct: 160 ESAISIDP 167

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 404 VPISHIELSGHIE-FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462
           +P    E+    E  K +G++   N DY  A+ +Y +++  LP       I Y+N  A  
Sbjct: 91  IPEEDAEIKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAAAH 146

Query: 463 LKIGEYSKSIEDCKIALSLFP 483
             +  Y +++ED + A+S+ P
Sbjct: 147 SSLKGYDEAVEDAESAISIDP 167

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
            K +G+  FK  DY +A+  Y+K++   P  +P   I YSN     +K+ ++S++++ C 
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPS-NP---IGYSNNAMGLIKLEKWSEAVDACN 62

Query: 477 IALSLF 482
             L + 
Sbjct: 63  KGLKMI 68

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 61/135 (45%), Gaps = 28/135 (20%)

Query: 404 VPISHIELSGHIE-FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462
           +P+   E+  + E FK  G++     D+  A+++Y +++  LP       I Y+N  A  
Sbjct: 90  IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILP----TNAIYYANRAAAH 145

Query: 463 LKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHL 522
             + E+ ++I+D + A+ + P                        +SK   R A +   L
Sbjct: 146 SSLKEFEEAIKDAESAIKIDPS-----------------------YSKGYSRLAFAKYGL 182

Query: 523 ENYKLALDSYQKLIE 537
             ++ AL+SY+K+++
Sbjct: 183 GKHEEALESYKKVLD 197

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 32/115 (27%)

Query: 417 FKTRGSELFKNGDYVSALQEY--EKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
            K +G+ LFK  D+ +A++ Y    SL   P Y       YSNI A    +  Y K IE 
Sbjct: 98  LKEKGNALFKKKDFENAIKYYTFALSLKEDPVY-------YSNISACYSSLLNYEKVIEM 150

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529
              AL+L P                        +SK+++R+A +YE L N+  A+
Sbjct: 151 ATKALALRPD-----------------------YSKVLVRRANAYEKLGNFGDAM 182

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 56/132 (42%), Gaps = 33/132 (25%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKS--LNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
            K +G+ LFK   +  A++ Y  +  L+  P +H       SNI A  + +G+  K +E 
Sbjct: 96  LKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFH-------SNISACYVSLGDLDKVVES 148

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534
              AL L P                        +SK ++R+A +YE++  Y+ A+     
Sbjct: 149 STRALELKPD-----------------------YSKALLRRASAYENMGRYQDAMFDISV 185

Query: 535 LIENG-FTNSKI 545
           L  NG F  S I
Sbjct: 186 LSLNGDFNGSSI 197

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G+E +K   Y +A   YE+ +        +  + + N  A +L++  Y   I DCK
Sbjct: 77  FKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCK 136

Query: 477 IALSLFP 483
            ALS  P
Sbjct: 137 KALSFNP 143

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E + +G E F  GD+ +A++ Y      + +  P     YSN  A   K+  + ++I+DC
Sbjct: 403 EARLQGKEYFTKGDWPNAVKAY----TEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDC 458

Query: 476 KIALSLFP 483
            +A+S  P
Sbjct: 459 DMAISKDP 466

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK  G+E FK G+Y  A+++Y K ++      P   + YSN+    LK     ++   C+
Sbjct: 38  FKDIGNEHFKKGEYDLAIEQYRKCISL----EPTNAVGYSNLAMAYLKNRCPDEAKTACE 93

Query: 477 IALS 480
           + LS
Sbjct: 94  MGLS 97

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 27/121 (22%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK  G+ L  + DY  A++ Y    N + +Y P   I YSN     LK+ +Y  +I D  
Sbjct: 140 FKDEGNRLMFSEDYKKAIECYT---NAISKY-PCDPIYYSNRSVAYLKVNDYESAINDAN 195

Query: 477 IALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLI 536
             +S+                     +F   + +L   + + +++++    ALD Y+K I
Sbjct: 196 FCISI-------------------DANFSKAYIRLANIKVQQHQYID----ALDYYKKFI 232

Query: 537 E 537
           E
Sbjct: 233 E 233

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E KT G+ LFK GDY +A + Y+  +       P   I YSN   + +K   + ++I  C
Sbjct: 5   ENKTEGNRLFKLGDYTAANKFYDLCI----MEEPTNPIGYSNKAMSLIKQEHFDQAIRTC 60

Query: 476 KIAL 479
              L
Sbjct: 61  NTGL 64

>Skud_10.251 Chr10 (447070..448251) [1182 bp, 393 aa] {ON} YJR032W
           (REAL)
          Length = 393

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 55/125 (44%), Gaps = 22/125 (17%)

Query: 418 KTRGSELFKNGDYVSALQEYEKSLNTLPQYHPL-RIISYSNIIATQLKIGEYSKSIEDCK 476
           K  G+ LFK  DY +A  +Y KSLN + +Y P   +    N   T LK+  Y        
Sbjct: 244 KDSGTLLFKKNDYSNAFFKYRKSLNYINEYTPEPDVDKERNYQFTSLKMKVY------LN 297

Query: 477 IALSLFPKGK----VTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESY-------EHLENY 525
           ++L LF   K    +T A   +  D+ P +      +K   R+  SY       E L+NY
Sbjct: 298 LSLVLFNVEKYDDSITYATYLLEMDNVPDKD----QAKAYYRRGNSYLKKKRLDEALQNY 353

Query: 526 KLALD 530
           KL  D
Sbjct: 354 KLCKD 358

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 421 GSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIALS 480
           G E F  GD+ SA++ Y + +   P  H  R   YSN  A   K+  +  +I+DC  A+ 
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAP--HDAR--GYSNRAAALSKLMSFPDAIKDCDKAIE 454

Query: 481 LFP 483
           + P
Sbjct: 455 IDP 457

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 35.4 bits (80), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           I+ K  G++  K   Y  A++ Y K++    +    + I +SN    QLK+  +   ++D
Sbjct: 14  IDLKNEGNKYIKEKKYTKAVEYYTKAI----ELDSTQSIFFSNRALAQLKLDNFQSCLDD 69

Query: 475 CKIALSLFPK 484
           C  AL L PK
Sbjct: 70  CNSALELDPK 79

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 28/114 (24%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E K RG+  FK  DY +A+  Y+ +L    +  P   + YSN+ A  + +    ++IE C
Sbjct: 88  ELKKRGNAYFKVKDYENAINYYKFALQL--KNDP---VFYSNMAACYISLEHNKEAIEAC 142

Query: 476 KIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529
             AL L P                        +SK+++++A  YE++  +  AL
Sbjct: 143 SKALELNPD-----------------------YSKVLLKRAAVYENIGKFADAL 173

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           + K  G+  F+ GDY  A   Y++ +    +  P   I YSN   + +K G +  ++E C
Sbjct: 5   DLKQEGNTFFQKGDYAQANGYYDQCI----KLEPTNPIGYSNKAMSLIKQGNHGLAVETC 60

Query: 476 KIAL 479
           +  L
Sbjct: 61  QEGL 64

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 55/125 (44%), Gaps = 28/125 (22%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           I  K +G+ LFK   +  A++ Y  ++    + +P   I YSN+ A  + + +  + I+ 
Sbjct: 112 IALKDKGNSLFKADKFEEAIKYYNWAIEL--KENP---IFYSNLSACYVSLNKLEEIIKY 166

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534
           C  AL L P                        +SK+++R+A + E LENY  A+     
Sbjct: 167 CNKALELKPD-----------------------YSKVLLRRANANEKLENYADAMFDLSV 203

Query: 535 LIENG 539
           L  NG
Sbjct: 204 LSLNG 208

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           + K +G++   N DY  A+ +Y +++  LP       I Y+N  A    + EY ++++D 
Sbjct: 104 DLKMQGNKAMANKDYELAINKYTEAIQVLP----TNAIYYANRAAAHSSLREYDEAVKDA 159

Query: 476 KIALSLFP 483
           + ++S+ P
Sbjct: 160 ESSISIDP 167

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 34.7 bits (78), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 29/132 (21%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +  K +G++ F+N  Y  A++ Y  +L    +  P   + YSN+ A  + +G+  K +E 
Sbjct: 100 LALKDKGNQFFRNKKYDDAIKYYNWALEL--KDDP---VFYSNLSACYVSVGDLKKVVEM 154

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534
              AL L P                        +SK+++R+A + E L N+  A+     
Sbjct: 155 STKALELKPD-----------------------YSKVLLRRASANEGLGNFADAMFDLSV 191

Query: 535 LIENG-FTNSKI 545
           L  NG F ++ I
Sbjct: 192 LSLNGDFNDASI 203

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E + +G E F N D+ +A++ Y + +   P+        YSN  A   K+  +  +I+DC
Sbjct: 390 EARLQGKEYFTNADWPNAVKAYTEMIKRAPE----DARGYSNRAAALAKLMSFPDAIKDC 445

Query: 476 KIALSLFP 483
            +A+   P
Sbjct: 446 DMAIQKDP 453

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G++L+K   +  A   Y K+L+       +    Y N+ A +L+I  Y   I  C+
Sbjct: 73  FKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCR 132

Query: 477 IALSL 481
            AL L
Sbjct: 133 EALKL 137

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 50/115 (43%), Gaps = 28/115 (24%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +  K +G+E FK  D+  A++ Y  +++   +  P   + YSN  A  + I  + K +ED
Sbjct: 105 LALKDKGNEFFKAKDFEKAIEYYTLAISL--KEDP---VFYSNRSAAYVSINNFEKVVED 159

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529
              AL L P                        +SK  +R+A +YE+L  +  A+
Sbjct: 160 TTAALKLKPD-----------------------YSKCWLRRASAYENLGQFSDAM 191

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 50/115 (43%), Gaps = 22/115 (19%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
            K  G+      DY +A+Q+Y  ++  LP       + Y+N  A    + +Y K++ED +
Sbjct: 93  LKLEGNRAMAAKDYETAIQKYTAAIEVLPT----DAVYYANRAAAYSSLQQYEKAVEDAE 148

Query: 477 IALSLFPKGKVTSAWNQIIPDSTPQRSFKDI-WSKLIMRQAESYEHLENYKLALD 530
            A  +               DS+  + F  + ++K  + + E  E LE YK  LD
Sbjct: 149 KATKV---------------DSSYSKGFSRLGYAKYALGRHE--EALEAYKRVLD 186

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 28/113 (24%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
            K +G+E FKN  +  AL+ Y  SL    +  P   + YSN  A  + +G+  K +ED  
Sbjct: 99  LKDKGNEFFKNKQFEDALKYY--SLAIEVKEDP---VFYSNRSACYVSLGQQEKVVEDTT 153

Query: 477 IALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529
            AL L P                        +SK ++R+A + E L  +  A+
Sbjct: 154 AALKLKPD-----------------------YSKCLLRRASANESLGKFADAM 183

>ZYRO0F05874g Chr6 (485184..486296) [1113 bp, 370 aa] {ON} highly
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 370

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 25/102 (24%)

Query: 418 KTRGSELFKNGDYVSALQEYEKSLNTLPQYHP-------------LRIISYSNIIATQLK 464
           K  G+E +K  +Y  AL +YEK    L +Y P             LR+    NI  T LK
Sbjct: 222 KAIGTEQYKKANYKVALSKYEKCDKFLKEYAPQGLTEEQSTTIEELRVSVPLNIALTALK 281

Query: 465 IGE------------YSKSIEDCKIALSLFPKGKVTSAWNQI 494
           + E            Y KS ++   A +L+ +G+  +  N +
Sbjct: 282 VKEFGTAMVAGSEVLYQKSADEKAKAKALYRRGQAYTGMNDL 323

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 29/132 (21%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +  K +G++ F+N  Y  A++ Y  +L    +  P   + YSN+ A  + +G+  K +E 
Sbjct: 100 LALKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEM 154

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534
              AL L P                        +SK+++R+A + E L N+  A+     
Sbjct: 155 STKALELKPD-----------------------YSKVLLRRASANEGLGNFADAMFDLSV 191

Query: 535 LIENG-FTNSKI 545
           L  NG F ++ I
Sbjct: 192 LSLNGDFNDASI 203

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 29/132 (21%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +  K +G++ F+N  Y  A++ Y  +L    +  P   + YSN+ A  + +G+  K +E 
Sbjct: 100 LALKDKGNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEM 154

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534
              AL             +I PD          +SK+++R+A + E L N+  A+     
Sbjct: 155 STKAL-------------EIKPD----------YSKVLLRRASANEGLGNFADAMFDLSV 191

Query: 535 LIENG-FTNSKI 545
           L  NG F ++ I
Sbjct: 192 LSLNGDFNDASI 203

>KLLA0F05093g Chr6 complement(502635..503753) [1119 bp, 372 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 372

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 54/122 (44%), Gaps = 32/122 (26%)

Query: 421 GSELFKNGDYVSALQEYEKSLNTLPQYHP-------------LRIISYSNIIATQLKIGE 467
           G++ FK  ++  AL +YEKS   L QY P             LR+  + NI    LK   
Sbjct: 227 GTKQFKEKNFEVALVKYEKSSQMLKQYFPQDLPEEDVKKIDALRVSLFLNIALVSLKSKN 286

Query: 468 YSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKL 527
           YS+++               ++A   +  D+T  +S     +K + R+  +Y + +N ++
Sbjct: 287 YSRTL---------------SAATEALHADNTDDKS----KAKALYRRGLAYYYTKNAEM 327

Query: 528 AL 529
           A+
Sbjct: 328 AV 329

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +EFK +G+   K   Y  A++ Y K++    +    + I +SN   ++LK+  +  ++ED
Sbjct: 13  LEFKNQGNAFIKEKKYPEAVEYYSKAI----ELDDTQSIFFSNRAFSRLKLDNFLTALED 68

Query: 475 CKIALSLFPK 484
           C  ++ L PK
Sbjct: 69  CNKSIELDPK 78

>Kwal_56.24487 s56 (1016327..1017439) [1113 bp, 370 aa] {ON} YLR216C
           (CPR6) - cyclophilin related to the mammalian CyP-40
           [contig 161] FULL
          Length = 370

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 53/122 (43%), Gaps = 32/122 (26%)

Query: 421 GSELFKNGDYVSALQEYEKSLNTLPQYHP-------------LRIISYSNIIATQLKIGE 467
           G+  FK  +Y +AL +YEK+ + L QY P             LR+    N+    LK  +
Sbjct: 225 GTAQFKVKNYTTALAKYEKASSMLKQYQPQDLPEDDIKKIDQLRLSILLNVALCALKTTD 284

Query: 468 YSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKL 527
           Y                 KV ++  +++ D+      K   +K + R+  +Y +L++ ++
Sbjct: 285 YQ----------------KVLASTTEVVHDAAADDKSK---AKALYRRGLAYYNLKDPQM 325

Query: 528 AL 529
           AL
Sbjct: 326 AL 327

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G++L++   Y  A + Y + ++       +    +SN  A +L++  Y + + DCK
Sbjct: 81  FKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCK 140

Query: 477 IAL 479
            AL
Sbjct: 141 RAL 143

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 57/129 (44%), Gaps = 23/129 (17%)

Query: 404 VPISHIELSGHIE-FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462
           +P    EL    E  K  G++     DY  A+++Y ++++ +P       + Y+N  A  
Sbjct: 82  IPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVP----TNAVYYANRAAAH 137

Query: 463 LKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDI-WSKLIMRQAESYEH 521
             +  Y ++I+D + A+ +               DS+  + +  + ++K    Q +S E 
Sbjct: 138 SSLKNYDEAIKDAESAVKV---------------DSSYSKGYSRLGYAKFA--QGKSEEA 180

Query: 522 LENYKLALD 530
           LE YK  LD
Sbjct: 181 LEAYKKVLD 189

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +E K  G++  K   Y  A + Y K++    ++ P   I YSN   T LK+  +  S++D
Sbjct: 14  LELKNEGNKFVKEKLYAKAAEYYTKAI----EHDPENTILYSNRAFTNLKLDNFQSSLDD 69

Query: 475 CKIALSL 481
            K A+ L
Sbjct: 70  AKRAIEL 76

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E +  G E F  GD+ SA++ Y + +   P+        YSN  A   K+  +  +I DC
Sbjct: 387 EARLEGKEYFTKGDWPSAVKAYTEMIKRAPE----DARGYSNRAAALSKLMSFPDAISDC 442

Query: 476 KIALSLFP 483
             A+   P
Sbjct: 443 NKAIEKDP 450

>YPL045W Chr16 (467260..469656) [2397 bp, 798 aa] {ON}  VPS16Subunit
           of the vacuole fusion and protein sorting HOPS complex
           and the CORVET tethering complex; part of the Class C
           Vps complex essential for membrane docking and fusion at
           Golgi-to-endosome and endosome-to-vacuole protein
           transport stages
          Length = 798

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 32/77 (41%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +++K+  + +F N      L    +S          R IS   +I   LK   Y + I+ 
Sbjct: 369 LQYKSFDASIFVNACNTIKLLNCFRSFGIFLTVEEYRCISLKGVIDRLLKYHRYYECIQI 428

Query: 475 CKIALSLFPKGKVTSAW 491
           CK+A   F  G V + W
Sbjct: 429 CKLANERFLLGYVFTEW 445

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E +  G + F  GD+ +A++ Y + +   P+        YSN  A   K+  + ++IEDC
Sbjct: 392 EARLEGKDYFTKGDWPNAVKAYTEMIKRAPE----DARGYSNRAAALSKLMSFPEAIEDC 447

Query: 476 KIALSLFP 483
             A+   P
Sbjct: 448 NKAIEKDP 455

>Smik_10.306 Chr10 (476484..477668) [1185 bp, 394 aa] {ON} YJR032W
           (REAL)
          Length = 394

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 418 KTRGSELFKNGDYVSALQEYEKSLNTLPQYHP 449
           K  G+ LFK  DY +AL +Y KSLN + +Y P
Sbjct: 245 KESGTLLFKKKDYSNALFKYRKSLNYINEYMP 276

>SAKL0F10450g Chr6 (806524..807636) [1113 bp, 370 aa] {ON} similar
           to uniprot|P53691 Saccharomyces cerevisiae YLR216C CPR6
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 370

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 18/118 (15%)

Query: 418 KTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKI 477
           K  G+ELFK+ +Y  AL +YEK    L +Y P  +              E +K IE+ K+
Sbjct: 222 KNIGNELFKSQNYEVALAKYEKCSRFLKEYLPNELSE------------EETKKIENLKV 269

Query: 478 ALSLFPKGKVTSA--WNQIIPDSTPQRSFKDI----WSKLIMRQAESYEHLENYKLAL 529
           ++ L        A  +++++  +T    F D      +K + R+  +Y +L++ ++AL
Sbjct: 270 SVFLNIALSALRAKIYSKVLSSTTEVLHFNDADGKSKAKALYRRGLAYYYLKDPEMAL 327

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G++L+K   +  A   Y K +        +  +   N  A +L++  Y + I DC+
Sbjct: 80  FKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCR 139

Query: 477 IALSLFPK 484
            AL L PK
Sbjct: 140 EALKLNPK 147

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 48/113 (42%), Gaps = 28/113 (24%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
            K +G+E FK   +  A++ Y  +L    +  P   + YSN  A  + +G+  K +ED  
Sbjct: 105 LKDKGNEFFKEKKFDDAIKYYNLALEL--KKDP---VFYSNRSACYVSMGQLEKVVEDTT 159

Query: 477 IALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529
            AL L                       K  +SK ++R+A + E L NY  A+
Sbjct: 160 AALKL-----------------------KSDYSKCLLRRASANESLGNYADAM 189

>TBLA0E01990 Chr5 (483675..484799) [1125 bp, 374 aa] {ON} Anc_7.313
           YLR216C
          Length = 374

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 13/70 (18%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHP-------------LRIISYSNIIATQ 462
           + K  G+E FK  +Y  ALQ+Y K    L +Y P             LR     NI    
Sbjct: 223 DVKVIGTEQFKKANYPIALQKYTKCEKLLKEYFPDDLPDEDSARLRQLRNAIALNITLCC 282

Query: 463 LKIGEYSKSI 472
           LK+ +Y+++I
Sbjct: 283 LKVKDYTRAI 292

>KLTH0B02442g Chr2 (193387..196533) [3147 bp, 1048 aa] {ON} similar
           to uniprot|P53037 Saccharomyces cerevisiae YGR170W PSD2
           Phosphatidylserine decarboxylase of the Golgi and
           vacuolar membranes converts phosphatidylserine to
           phosphatidylethanolamine
          Length = 1048

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 43  QFNLNKASTPSLDTFALAPLIPSSRDASKSNSRVTSPPLI-EDDFSD 88
           Q N  K +T +LD + +A +  S  D S  NSRV++PPLI EDD  D
Sbjct: 288 QLNFTKVAT-ALDEYDVA-ISRSDFDPSSGNSRVSTPPLISEDDLID 332

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E +  G E F  GD+ +A++ Y + +   P+        YSN  A   K+  + ++I+DC
Sbjct: 391 EARLEGKEYFTKGDWPNAVKAYSEMIKRAPE----DARGYSNRAAALSKLMSFPEAIKDC 446

Query: 476 KIALSLFP 483
             A+   P
Sbjct: 447 DNAIKKDP 454

>KNAG0B02770 Chr2 complement(535162..536295) [1134 bp, 377 aa] {ON}
           Anc_7.313 YLR216C
          Length = 377

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 51/126 (40%), Gaps = 32/126 (25%)

Query: 418 KTRGSELFKNGDYVSALQEYEKSLNTLPQYHP-------------LRIISYSNIIATQLK 464
           K   +E FK  +Y  AL++Y K    L +Y P             L++    NI  T LK
Sbjct: 229 KAIATEQFKKQNYAVALEKYTKCDKFLKEYFPDDLAEDQINQINNLKVTVPLNIALTGLK 288

Query: 465 IGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLEN 524
           +GEY                  V +A ++++         K   +K + R+  +Y H+ +
Sbjct: 289 LGEYQ----------------TVLTAGSEVLYAEAADELAK---AKALYRRGLAYYHVND 329

Query: 525 YKLALD 530
             LA++
Sbjct: 330 TDLAMN 335

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G++L+K   Y  A   Y K +    +   +    Y N  A +L++  +   I DCK
Sbjct: 82  FKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCK 141

Query: 477 IALSL 481
            AL+ 
Sbjct: 142 KALNF 146

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 57/132 (43%), Gaps = 29/132 (21%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +  K +G++ F+N  Y  A++ Y  +L    +  P   + YSN+ A  + +G+  K +E 
Sbjct: 100 LALKDKGNQFFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEM 154

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534
              AL L P                        +SK+++R+A + E L  +  A+     
Sbjct: 155 STKALELKPD-----------------------YSKVLLRRASANEGLGKFADAMFDLSV 191

Query: 535 LIENG-FTNSKI 545
           L  NG F ++ I
Sbjct: 192 LSLNGDFNDASI 203

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK +G++L++   Y  A + Y K +        +    + N  A +L++  + + I DCK
Sbjct: 83  FKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCK 142

Query: 477 IALSLFPK 484
            AL   PK
Sbjct: 143 EALRYNPK 150

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +EFK +G+   K  ++  A + Y K++    +    + I +SN     LK+  +  ++ D
Sbjct: 13  LEFKNQGNVFIKGKNFSKAAELYSKAI----ELDGTQSIYFSNRAFAHLKLDNFQTALND 68

Query: 475 CKIALSLFPK 484
           C  A+ L PK
Sbjct: 69  CNKAIELDPK 78

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +EFK +G+   K   Y  A++ Y K++    +    + I +SN   ++L++  +  + ED
Sbjct: 11  LEFKNQGNAYVKEKKYQEAVEYYSKAI----ELDDTQSIYFSNRAFSRLRLDNFLTAQED 66

Query: 475 CKIALSLFPK 484
           C  A++L PK
Sbjct: 67  CDKAIALDPK 76

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 28/115 (24%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           +  K +G+E FK+  Y  A++ Y+ +L    +  P   + YSN  A  + + +  K +ED
Sbjct: 96  MALKDKGNECFKDQRYEEAIKFYDCALKL--KEDP---VFYSNRSACYVPLNKLEKVVED 150

Query: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529
              AL L P                        +SK ++R+A + E L NY  A+
Sbjct: 151 TTAALKLKPD-----------------------YSKCLLRRATANESLGNYADAM 182

>SAKL0B01078g Chr2 (97198..101106) [3909 bp, 1302 aa] {ON} similar
           to uniprot|P13433 Saccharomyces cerevisiae YFL036W
          Length = 1302

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 46/105 (43%), Gaps = 23/105 (21%)

Query: 85  DFSDLFNSNEQKNITSPPAPKKDDIDSAFDIFTSTPPLEQQQQQHGLVTEH--------- 135
           D+  L N  +   +   P   +  I+S+ D+ TS  P+ QQ+Q+H L T+          
Sbjct: 210 DYKKLVNELKLVELQDLPEEIRPLIESSEDV-TSPEPVHQQEQKHTLRTQSGEIQTIMER 268

Query: 136 ------------EKDYEEEIIVDEVKDMEVARLMSLGLSIDQANK 168
                       EKD +  + VD +  M V R   LGLS+ +A K
Sbjct: 269 SSVSLKEDVGTLEKDAKTLVAVDTI-GMRVVRHTLLGLSLTEAQK 312

>Kpol_1009.17 s1009 (37274..41821) [4548 bp, 1515 aa] {ON}
           (37274..41821) [4548 nt, 1516 aa]
          Length = 1515

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 46/95 (48%), Gaps = 18/95 (18%)

Query: 173 GILYED---IIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTG 229
           G + ED   I+R   ++KL+Q S  NK   ++K N    S LFD + A+ R     N T 
Sbjct: 517 GTISEDEHRILRDSLQQKLQQTSIENKVKEENKRNQHDLSKLFDKSLASARSLLENNATR 576

Query: 230 NLFSMATDILYKGKELVDQLTAYPEENNRLYKYRE 264
              S+AT      ++L D +       NRL KY+E
Sbjct: 577 ---SVATK-----QQLYDNI-------NRLKKYKE 596

>YJR032W Chr10 (491081..492262) [1182 bp, 393 aa] {ON}
           CPR7Peptidyl-prolyl cis-trans isomerase (cyclophilin),
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues; binds to Hsp82p and
           contributes to chaperone activity
          Length = 393

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 418 KTRGSELFKNGDYVSALQEYEKSLNTLPQYHP 449
           K  G+ LFK  DY +A  +Y KSLN + +Y P
Sbjct: 244 KESGTLLFKKKDYSNAFFKYRKSLNYINEYMP 275

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIIS--YSNIIATQLKIGEYSKSIED 474
           FK +G++L+K   +  A   Y K +  +     ++I    ++N  A +L++  + + I D
Sbjct: 79  FKNQGNDLYKAKRFKDARDVYLKGIQ-IENNKDVKIKESLFANKAACELELKNFRRCIND 137

Query: 475 CKIALSLFPK 484
           CK AL L PK
Sbjct: 138 CKNALQLNPK 147

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 406 ISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKI 465
           IS  + +  +E+K +G++  K  D++ A + Y K++    +    + I +SN     LK 
Sbjct: 4   ISAADSAKALEYKDQGNDFVKKQDFIKAAELYTKAI----ELDDTKSIFFSNRALAHLKQ 59

Query: 466 GEYSKSIEDCKIALSL 481
             +  S+ DC  AL L
Sbjct: 60  DNFQLSLNDCDKALEL 75

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 33/67 (49%)

Query: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476
           FK + ++L+K   +  A + Y K +    +   +    ++N  A +L++  Y   + DC+
Sbjct: 88  FKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQ 147

Query: 477 IALSLFP 483
            A+ + P
Sbjct: 148 KAMEINP 154

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E +  G + F  GD+ +A++ Y + +   P+        YSN  A   K+  + ++I+DC
Sbjct: 399 EARLEGKDYFTKGDWPNAVKAYTEMIKRAPE----DARGYSNRAAVLSKLMSFPEAIDDC 454

Query: 476 KIALSLFP 483
             A+   P
Sbjct: 455 NKAIEKDP 462

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           + K +G++   + D+ +A+++Y +++  LP       + Y+N  A    + +Y +S++D 
Sbjct: 99  DLKLQGNKAMASKDFETAIKKYTEAIEVLPS----NAVYYANRAAAYSSLKKYEESVQDA 154

Query: 476 KIALSLFP 483
           + A+ + P
Sbjct: 155 ESAIKVNP 162

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 8/89 (8%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E +  G E F  GD+ +A++ Y + +       P     YSN  A   K+  + ++I DC
Sbjct: 391 EARLEGKEYFTKGDWPNAVKAYTEMI----ARDPSDARGYSNRAAALSKLMSFPEAITDC 446

Query: 476 KIALSL---FPKGKVTSAWNQI-IPDSTP 500
             A+     F +  +  A  QI I D  P
Sbjct: 447 NTAIEKDPNFIRAYIRKATAQIAIKDFVP 475

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 57/131 (43%), Gaps = 21/131 (16%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E +  G E F   D+ +A++ Y + +   P+        YSN  A   K+  + ++I+DC
Sbjct: 392 EARLEGKEYFTKSDWPNAVKAYTEMIKRAPE----DARGYSNRAAALAKLMSFPEAIKDC 447

Query: 476 KIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKL 535
           + A+   P      A+   +  +T Q + KD    L        E LE  K   D     
Sbjct: 448 EKAIEKDP--NFVRAY---LRKATAQIAIKDFVKAL--------ETLEEAKKKDDE---- 490

Query: 536 IENGFTNSKIM 546
           + NG ++++IM
Sbjct: 491 VNNGASSNEIM 501

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474
           ++FK  G+   K+ DY  A++ Y K++    +      I YSN     LK+  +  ++ D
Sbjct: 13  LKFKDEGNVYIKSQDYQKAIELYTKAI----ELDSTSSIFYSNRALAHLKLDNFQSALHD 68

Query: 475 CKIALSL 481
           C  A+ L
Sbjct: 69  CNDAIKL 75

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 4/68 (5%)

Query: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475
           E +  G E F   D+ +A++ Y + +   PQ        YSN  A   K+  + ++I DC
Sbjct: 384 EARLEGKEYFSKADWPNAVKAYTEMIKRSPQ----DARGYSNRAAALAKLMSFPEAIADC 439

Query: 476 KIALSLFP 483
             A+   P
Sbjct: 440 DRAIEKDP 447

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,788,017
Number of extensions: 3452677
Number of successful extensions: 18330
Number of sequences better than 10.0: 307
Number of HSP's gapped: 18906
Number of HSP's successfully gapped: 335
Length of query: 706
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 589
Effective length of database: 40,065,477
Effective search space: 23598565953
Effective search space used: 23598565953
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)