Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C043105.350ON25925911821e-165
NCAS0F028605.350ON2532565856e-75
KAFR0C018605.350ON2592595222e-65
ZYRO0D10142g5.350ON2552584883e-60
TDEL0E027705.350ON2582584753e-58
Kwal_34.159845.350ON2512534596e-56
KLTH0H14828g5.350ON2512494562e-55
SAKL0G08866g5.350ON2552464381e-52
Suva_2.4885.350ON2742674391e-52
YDR319C5.350ON2742674381e-52
TPHA0E011305.350ON2772664348e-52
CAGL0H07117g5.350ON2602504274e-51
Skud_4.5855.350ON2742674242e-50
Kpol_339.115.350ON2582504223e-50
Smik_4.5785.350ON2742584147e-49
KNAG0C055105.350ON2642603902e-45
Ecym_81835.350ON2652493893e-45
AGR350C5.350ON2612423468e-39
TBLA0A031105.350ON2752803362e-37
KLLA0B10153g5.350ON2672543223e-35
KAFR0A046406.117ON2371391153e-06
Skud_7.1466.117ON316104840.035
Ecym_30686.117ON36749790.13
KNAG0F025106.117ON246125780.17
ZYRO0A09240g6.117ON37226780.19
TBLA0F025006.117ON327106760.33
SAKL0A07062g6.117ON42921760.35
TDEL0G035306.117ON36848750.40
Kpol_461.26.117ON39720740.60
CAGL0I00330g6.117ON371136711.6
AAR165W6.117ON36250692.2
TPHA0J018106.117ON39020692.4
Kwal_14.17966.117ON36349683.3
KLTH0H06556g6.117ON36347658.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C04310
         (259 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON...   459   e-165
NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON...   229   6e-75
KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.35...   205   2e-65
ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {O...   192   3e-60
TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.35...   187   3e-58
Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C...   181   6e-56
KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa] ...   180   2e-55
SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly ...   173   1e-52
Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}...   173   1e-52
YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON} ...   173   1e-52
TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.35...   171   8e-52
CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar...   169   4e-51
Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {O...   167   2e-50
Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON} ...   167   3e-50
Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {O...   164   7e-49
KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5....   154   2e-45
Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to...   154   3e-45
AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON} ...   137   8e-39
TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON...   134   2e-37
KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {O...   128   3e-35
KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON...    49   3e-06
Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W (...    37   0.035
Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}...    35   0.13 
KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON...    35   0.17 
ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {...    35   0.19 
TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.11...    34   0.33 
SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {...    34   0.35 
TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {O...    33   0.40 
Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON} co...    33   0.60 
CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly s...    32   1.6  
AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic ho...    31   2.2  
TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6....    31   2.4  
Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {O...    31   3.3  
KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {...    30   8.5  

>NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON}
           Anc_5.350 YDR319C
          Length = 259

 Score =  459 bits (1182), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 229/259 (88%), Positives = 229/259 (88%)

Query: 1   MKILPIPWPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNK 60
           MKILPIPWPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNK
Sbjct: 1   MKILPIPWPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNK 60

Query: 61  VWSILFILLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVXXXXXX 120
           VWSILFILLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNV      
Sbjct: 61  VWSILFILLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVLLAFLF 120

Query: 121 XXXXXXXXXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXX 180
                    TGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCF               
Sbjct: 121 LIIDSLFILTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFLINISLILWSELSLL 180

Query: 181 NKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCP 240
           NKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCP
Sbjct: 181 NKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCP 240

Query: 241 IVMYYFIPNNVKLKQTLYK 259
           IVMYYFIPNNVKLKQTLYK
Sbjct: 241 IVMYYFIPNNVKLKQTLYK 259

>NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON}
           Anc_5.350 YDR319C
          Length = 253

 Score =  229 bits (585), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 117/256 (45%), Positives = 157/256 (61%), Gaps = 13/256 (5%)

Query: 8   WPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFI 67
           WP +C +YPTIL +G +IN+++  ETL   K  YY+L+SKNI N+V AYNGN +W++LF 
Sbjct: 7   WPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFG 66

Query: 68  LLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVXXXXXXXXXXXXX 127
           +++  Q+ ++    +LLPR  D+    R+ +  LIKQY++KFVLK +             
Sbjct: 67  MMAYFQVWIRIRTQDLLPR--DAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFIDGLF 124

Query: 128 XXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKVLEDR 187
             TGG+C     IWSAE CK +GG WEGGFDISGHFCF                + L D 
Sbjct: 125 LFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDE 184

Query: 188 EETFTKIDKWMEGVIV---IILGC-LYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVM 243
           E         ME +I    ++L C LYLWM +L VTA+YYHTLLEKILGC+LG+ CP++M
Sbjct: 185 ELE-------METIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIM 237

Query: 244 YYFIPNNVKLKQTLYK 259
           Y+ IPN+ KL   LY 
Sbjct: 238 YWLIPNHYKLNHILYS 253

>KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.350
           YDR319C
          Length = 259

 Score =  205 bits (522), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 153/259 (59%), Gaps = 1/259 (0%)

Query: 1   MKILPIPWPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNK 60
           MK+  +P   I  IYP ILF+G+ +++++ +ET    K   Y+L S NI N++ AYNGN 
Sbjct: 1   MKLSLLPPLIISLIYPCILFLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNL 60

Query: 61  VWSILFILLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVXXXXXX 120
           VW ILF  ++ +QI ++S    LLP  +    SK      L+K+Y++KF+LK        
Sbjct: 61  VWFILFSFVASLQIYIRSHTFILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCF 120

Query: 121 XXXXXXXXXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXX 180
                    TGG C       SAE CKA GG W GGFDISGHFCF               
Sbjct: 121 LIIDNIFILTGGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHY 180

Query: 181 NKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCP 240
           +K  E+ EE  ++I+KW++  ++++   LY+WM +L VT++YYHT+LEKILGCI+G+ CP
Sbjct: 181 SKYTEE-EELQSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACP 239

Query: 241 IVMYYFIPNNVKLKQTLYK 259
           +VMY+ IPN  ++K  LY 
Sbjct: 240 LVMYWLIPNQPRMKSLLYA 258

>ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  192 bits (488), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 149/258 (57%), Gaps = 3/258 (1%)

Query: 1   MKILPIPWPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNK 60
           M++ P+ W +   +YP  L +G  +  L+ +E L+S +  +Y LN  N  NQ+ AY GN+
Sbjct: 1   MRLTPLDWKKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQ 60

Query: 61  VWSILFILLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVXXXXXX 120
           +W+ILF  L+ +Q+ +++   +++PR  D+    R+ + SL+K+Y +K +LKN+      
Sbjct: 61  IWTILFCGLAGLQVYMKTHVPDVIPR--DARTIVRKPMTSLLKEYAVKIILKNLLLAIIF 118

Query: 121 XXXXXXXXXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXX 180
                    TGG C+      SAE C   GG WEGGFDISGHFCF               
Sbjct: 119 LFIDNIFILTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHL 178

Query: 181 NKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCP 240
              L + E+   +++ W + +I I +  L  W  IL VT++YYHTLLEKILGC +G++CP
Sbjct: 179 ESWLIE-EDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICP 237

Query: 241 IVMYYFIPNNVKLKQTLY 258
           I+MY+ IPN+  +++ LY
Sbjct: 238 IIMYWLIPNHDIVRKVLY 255

>TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.350
           YDR319C
          Length = 258

 Score =  187 bits (475), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 146/258 (56%), Gaps = 4/258 (1%)

Query: 3   ILPIPWPQICY-IYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKV 61
           ++P   P+I   IYP  L +G +I  +L  + L+  +  YY+L SKNI N + AY GN V
Sbjct: 4   LIPEVTPKIAASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLV 63

Query: 62  WSILFILLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVXXXXXXX 121
           W++ F+ L+++QI ++  N  LLPR  D+  +    + SL+KQY  K +LKNV       
Sbjct: 64  WTVDFVCLALVQIYVKCRNHALLPR--DARTNSSGPLKSLLKQYTSKIILKNVLLAITFF 121

Query: 122 XXXXXXXXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXN 181
                   TGG C   +   SAE C+  GG+W+GGFDISGHFCF                
Sbjct: 122 IIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFR 181

Query: 182 KVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPI 241
             +E RE     + K + GV+V+  G L +W+ +L VTAVYYHT+LEK+LGC LG+VC +
Sbjct: 182 SYME-RESVVFPVSKVVNGVLVVSSGVLGIWVLMLMVTAVYYHTVLEKVLGCALGYVCVL 240

Query: 242 VMYYFIPNNVKLKQTLYK 259
           VMY+ IP + +    LY 
Sbjct: 241 VMYWLIPRSRRFNGLLYS 258

>Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C -
           Hypothetical ORF [contig 272] FULL
          Length = 251

 Score =  181 bits (459), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 101/253 (39%), Positives = 139/253 (54%), Gaps = 12/253 (4%)

Query: 9   PQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFIL 68
            Q   +YP+IL  G LIN L+    L+  +S+YY+L+S NI N++ AY GN  W+ILF L
Sbjct: 8   AQFTLVYPSILAYGSLINLLVDASRLERQRSSYYLLSSGNIVNKLFAYRGNLTWTILFTL 67

Query: 69  LSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVXXXXXXXXXXXXXX 128
           L+V Q+ L +   +LLPR  D+ +  R     L KQY +K +LKNV              
Sbjct: 68  LAVFQVWLHAEQSDLLPR--DARSVHRVGGVRLAKQYTVKLILKNVLLYLAFLFIDNLFV 125

Query: 129 XTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKVLEDRE 188
            TGG C+      SAE C+ +GG W+ GFDISGHFCF                K +   +
Sbjct: 126 WTGGSCS-TSSTRSAERCRKEGGSWDNGFDISGHFCFLTNISLILWYELRSIQKKISSDD 184

Query: 189 ETFTK---IDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYY 245
            + TK   + +W   +++I       W  IL VTAVYYHTLLEK+LG  +G++CP +MY 
Sbjct: 185 ISPTKTWIVLRWSTLIVLIT------WSFILSVTAVYYHTLLEKVLGLTMGYLCPTIMYL 238

Query: 246 FIPNNVKLKQTLY 258
            IPN+  L+  LY
Sbjct: 239 VIPNHSGLRSLLY 251

>KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa]
           {ON} similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 251

 Score =  180 bits (456), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 141/249 (56%), Gaps = 6/249 (2%)

Query: 10  QICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFILL 69
           +  ++YP +L  G++++ L    TLQ  K  YY+L+  N+ N V AY GN +W+ILF+ L
Sbjct: 9   RFAFVYPVVLICGLVVHLLANGSTLQHQKDTYYLLSPNNVINLVFAYKGNLIWTILFVSL 68

Query: 70  SVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVXXXXXXXXXXXXXXX 129
           +  QI+++ +  +LLPR   +    R H   L K+Y +K +LKN+               
Sbjct: 69  AAYQIKIRVSRSDLLPRDARTTYPARWH--RLGKEYAVKIILKNLLLYVIFFVIDCVFVW 126

Query: 130 TGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKVLEDREE 189
           TGG C+      SAE C+ +GG+WE GFDISGHFCF                K L   E 
Sbjct: 127 TGGSCS-SSATKSAERCRKEGGKWENGFDISGHFCFLTNVSLILWLELSSIQKYLNSDER 185

Query: 190 TFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFIPN 249
           T +K+  W   ++   +  L +W  +L VTA+YYHT LEKILG ++G++CP++MY+ +P+
Sbjct: 186 TPSKL--W-RVLLYSNVSVLVIWAFVLSVTAIYYHTTLEKILGLLMGYICPVIMYWLVPS 242

Query: 250 NVKLKQTLY 258
           +  L+Q LY
Sbjct: 243 HTALRQLLY 251

>SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  173 bits (438), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 142/246 (57%), Gaps = 6/246 (2%)

Query: 13  YIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFILLSVI 72
           + YP +L +G+L+N L+  + L   K  YY+L+S+N+ N+V AY GN+++ I FILL+ +
Sbjct: 16  WFYPLVLLLGLLVNLLVSAQELDRQKHEYYLLSSRNVINKVFAYQGNQIFLITFILLAAL 75

Query: 73  QIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVXXXXXXXXXXXXXXXTGG 132
           QI + S N +LLPR  +S++S R     L +QY IKF+LK +               TGG
Sbjct: 76  QIHIHSKNQDLLPR--NSSSSPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGG 133

Query: 133 ECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKVLEDREETFT 192
            C+ I    SAE C+  GG WEGGFDISGHFCF                K + D E    
Sbjct: 134 VCS-ISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNELRVN 192

Query: 193 KIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFIPNNVK 252
           +   W++ + + +   L +W+ +L VTA YYHT+ EK+LG ++G+ CP VMY  IP+  K
Sbjct: 193 RKFAWIKYLTLFV---LVVWLFVLSVTATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTK 249

Query: 253 LKQTLY 258
           L + +Y
Sbjct: 250 LNKLMY 255

>Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  173 bits (439), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 144/267 (53%), Gaps = 17/267 (6%)

Query: 8   WPQICY-IYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILF 66
           W +  Y +YP  + +G +I+ L+  ETL   K  Y +L S N+ N + AY  NK+W I F
Sbjct: 8   WSRKAYLVYPIQVLVGAVISILVSEETLNHQKKTYTLLKSSNLLNIIFAYKANKIWPIFF 67

Query: 67  ILLSVIQIRLQS-TNINLLPRHVDSAAS--------------KRRHVNSLIKQYVIKFVL 111
             L+++QI       +++LP  + S+ +              K R + ++  QY  KFVL
Sbjct: 68  FSLALLQIYFHYLARLDVLPLPISSSDTGSTYLSYGNRRPLLKDRVITTMAAQYACKFVL 127

Query: 112 KNVXXXXXXXXXXXXXXXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXX 171
           KN+               TGG+C+      SAE C+ + G+W GGFDISGHFCF      
Sbjct: 128 KNLLLFLSFQFIDHVFVWTGGQCSSGSGTTSAEKCRLEKGKWYGGFDISGHFCFLVNISM 187

Query: 172 XXXXXXXXXNKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKIL 231
                    ++ ++  E+    ++KW+   +VII   L +W+GIL+VTA+YYHT+LEK+L
Sbjct: 188 ILWMELHLFSRFVQA-EDMLWVVNKWVRACLVIISVVLLIWIGILWVTAIYYHTILEKML 246

Query: 232 GCILGFVCPIVMYYFIPNNVKLKQTLY 258
           GC++G++CP+ +Y+ +P    L   LY
Sbjct: 247 GCLMGYICPVFIYHILPRIELLHDYLY 273

>YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON}
           Putative protein of unknown function, identified as an
           ortholog of the highly conserved FIT family of proteins
           involved in triglyceride droplet biosynthesis; interacts
           with Sst2p and Hsp82p in high-throughput two-hybrid
           screens
          Length = 274

 Score =  173 bits (438), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 93/267 (34%), Positives = 144/267 (53%), Gaps = 17/267 (6%)

Query: 8   WPQICY-IYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILF 66
           W +  Y IYP  +F+G L++ ++ +ETL   K    +L S NIFN + AY  N++W  LF
Sbjct: 8   WSRKAYLIYPFQVFVGALLSIVVSSETLNHQKETCALLKSSNIFNVIFAYKANQLWPFLF 67

Query: 67  ILLSVIQIRLQS-TNINLLPRHVDSAAS--------------KRRHVNSLIKQYVIKFVL 111
             L+ +QI       +++LP  + S  +              K R ++ +I QY  KFVL
Sbjct: 68  FSLAFLQIYFHYLARMDILPLPISSTETSSSYLTYTNHWPLLKNRIISIMITQYACKFVL 127

Query: 112 KNVXXXXXXXXXXXXXXXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXX 171
           K +               TGGEC+      SAE C+ + G+W+GGFDISGHFCF      
Sbjct: 128 KYLLLFLNFQFIDHVFIWTGGECSSGSKTTSAEKCRLENGKWDGGFDISGHFCFLVSISM 187

Query: 172 XXXXXXXXXNKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKIL 231
                    ++ ++  E+ F  ++KW+   + I+   L +W+ IL+VTA+YYHT+LEK+L
Sbjct: 188 ILWMELHLFSRFVQA-EDMFWVVNKWVRACLAIVCAVLVIWICILWVTAIYYHTILEKVL 246

Query: 232 GCILGFVCPIVMYYFIPNNVKLKQTLY 258
           GC++GF+CP+ +Y+ +P    L   LY
Sbjct: 247 GCLMGFICPVFIYHILPKIGILHNYLY 273

>TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.350
           YDR319C
          Length = 277

 Score =  171 bits (434), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 97/266 (36%), Positives = 144/266 (54%), Gaps = 14/266 (5%)

Query: 4   LPIPWPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWS 63
            P+    I YI+  +L  G  ++ +L  ETL+ HK+++Y LNSKN  NQ+ AYNGN VW 
Sbjct: 16  FPLFAISISYIF--VLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWF 73

Query: 64  ILFILLSVIQIRLQSTNI-NLLPRHVDSAAS--------KRRHVNSLIKQYVIKFVLKNV 114
           +LF L+  + +  ++ N   LLP   D             +R    L KQY  K+ +K+ 
Sbjct: 74  LLFCLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSA 133

Query: 115 XXXXXXXXXXXXXXXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXX 174
                          +GG C+       +E C++  G+WEGGFDISGHFCF         
Sbjct: 134 SLFVIFFAIDTLFVLSGGSCDDGSGTTFSETCRSNKGKWEGGFDISGHFCFLITISLILW 193

Query: 175 XXXXXXNKVLEDREETF-TKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGC 233
                 +K +E   E+F  +++     +I +I+G + +W G+L++TA+YYHT  EK+LGC
Sbjct: 194 CELYKLHKRMES--ESFEVELNVVFTVMIGLIVGVIMVWFGLLWITAIYYHTFFEKVLGC 251

Query: 234 ILGFVCPIVMYYFIPNNVKLKQTLYK 259
           +LGFV P++MYY IP+N  L   LYK
Sbjct: 252 MLGFVTPLLMYYTIPSNEFLNGLLYK 277

>CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar to
           uniprot|Q06676 Saccharomyces cerevisiae YDR319c
          Length = 260

 Score =  169 bits (427), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 135/250 (54%), Gaps = 1/250 (0%)

Query: 10  QICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFILL 69
           Q+   YP IL +G  ++ LL  E   + ++NYY+LNSKN+FNQ++AY GN VW  LF+ +
Sbjct: 8   QVSLAYPVILILGCFLSVLLSEEAKINQRANYYLLNSKNVFNQILAYKGNWVWLFLFMGV 67

Query: 70  SVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVXXXXXXXXXXXXXXX 129
           + +Q  L++ + +LLP    +     +    +IK+Y  K+ LK                 
Sbjct: 68  AAVQYNLRTKSQSLLPTDTRALVVSNKTKLQIIKEYFCKYFLKLFILDVIFLVIDGVFIM 127

Query: 130 TGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKVLEDREE 189
           TGG C +     SAE CK+ GG+W GGFDISGHFCF                + +    +
Sbjct: 128 TGGSCTVPNRSISAELCKSLGGKWIGGFDISGHFCFLVNISMILWMELIAIAEHVCGY-D 186

Query: 190 TFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFIPN 249
           T   +    + VI + +  L  WMG+L VTA YYHT+ EK++GC+ G++CP VMY  IPN
Sbjct: 187 TVISLSSLQKHVITVAVVVLVAWMGMLLVTATYYHTIAEKLIGCVFGYICPFVMYGLIPN 246

Query: 250 NVKLKQTLYK 259
           +  L +  Y 
Sbjct: 247 SHDLNKLFYA 256

>Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  167 bits (424), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 142/267 (53%), Gaps = 17/267 (6%)

Query: 8   WPQICY-IYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILF 66
           W +  Y IYP  + +G +I+ L+ +ETL   K  Y +L S N+FN + AY  N++W  LF
Sbjct: 8   WSRKAYLIYPFQVLVGAIISILVSSETLGHQKKTYALLKSSNLFNILFAYKANQLWPFLF 67

Query: 67  ILLSVIQIRLQS-TNINLLPRHVDSAAS--------------KRRHVNSLIKQYVIKFVL 111
             L+ +QI       +++LP  + S+ +              K R +  +  QY  KF+L
Sbjct: 68  FSLAFLQIYFHYLARMDVLPLPISSSETGPTYSSYINRWPLLKDRVIGIMFAQYACKFIL 127

Query: 112 KNVXXXXXXXXXXXXXXXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXX 171
           K++               TGGEC+      SAE C+ + G+W+GGFDISGHFCF      
Sbjct: 128 KSLLLYVCFQFIDHVFIWTGGECSSGSGTTSAEKCRLENGKWQGGFDISGHFCFLVNISM 187

Query: 172 XXXXXXXXXNKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKIL 231
                    +K ++  E+ F   +KW+   + +I   L +W+ IL+VTA+YYHT+LEKIL
Sbjct: 188 ILWMELHLFSKFVQ-AEDMFWVANKWVRACLAVISSILVIWICILWVTAIYYHTVLEKIL 246

Query: 232 GCILGFVCPIVMYYFIPNNVKLKQTLY 258
           GC +G++CPI +Y+ +P    L   +Y
Sbjct: 247 GCFMGYICPIFIYHVLPKIGLLHDYIY 273

>Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON}
           complement(17930..18706) [777 nt, 259 aa]
          Length = 258

 Score =  167 bits (422), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 140/250 (56%), Gaps = 9/250 (3%)

Query: 14  IYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFILLSVIQ 73
           IYP  + IG  ++ ++ +  L+S ++N+Y+L S NI N++ AY+GN+VW +LFI L ++Q
Sbjct: 12  IYPFEVLIGWALSKIIGDLKLESQRNNFYILRSSNIVNELFAYHGNQVWLVLFIFLCLVQ 71

Query: 74  IRLQSTNINLLPRHVDSAASKRR-----HVNSLIKQYVIKFVLKNVXXXXXXXXXXXXXX 128
           I  +S   +LL   + S +   R         L+KQY+ K +LKN+              
Sbjct: 72  IYYRSKRFSLL---ISSESFNGRDQLIARGKPLVKQYICKLILKNLMLILVFSVIDNVFI 128

Query: 129 XTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKVLEDRE 188
            +GGEC       S++ C+ + G WEGGFDISGHFCF                K + D E
Sbjct: 129 FSGGECTSGSGTRSSQRCRHENGHWEGGFDISGHFCFLVTISMILWIELHQFKKHV-DLE 187

Query: 189 ETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFIP 248
               ++  + + +++ +   L +W+ ILF+T+VYYHT +EK+LGC +G++ P VMY+ IP
Sbjct: 188 GLSGQLSLYSKIILMTVFTVLCIWVFILFITSVYYHTFMEKVLGCAMGYITPYVMYHIIP 247

Query: 249 NNVKLKQTLY 258
           NN  L   LY
Sbjct: 248 NNEFLYSILY 257

>Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  164 bits (414), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 138/258 (53%), Gaps = 17/258 (6%)

Query: 8   WPQICY-IYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILF 66
           W +  Y IYP  + +G LI+ L+  +TL   K  + +L S N+FN + AY  N++W ILF
Sbjct: 8   WSRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILF 67

Query: 67  ILLSVIQIRLQS-TNINLLPRHVDSAASKRRHVNS--------------LIKQYVIKFVL 111
             L+ +Q+       +++LP  + S+ ++  ++                +I QY  KF+L
Sbjct: 68  FSLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFIL 127

Query: 112 KNVXXXXXXXXXXXXXXXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXX 171
           K +               TGGEC+      SAE C+ + G+W GGFDISGHFCF      
Sbjct: 128 KYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISM 187

Query: 172 XXXXXXXXXNKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKIL 231
                     + ++  E+    ++KW+   + +I   L +W+ IL+VTA+YYHT+LEKIL
Sbjct: 188 ILWMELHMFCRFIQS-EDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKIL 246

Query: 232 GCILGFVCPIVMYYFIPN 249
           GC++G++CPI +Y+ +P 
Sbjct: 247 GCLMGYICPIFIYHILPK 264

>KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5.350
           YDR319C
          Length = 264

 Score =  154 bits (390), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 137/260 (52%), Gaps = 13/260 (5%)

Query: 8   WPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFI 67
           WP +  +YP +L IG++++ L+P +     K + Y  NSKN+ NQV AY GN VW++LF+
Sbjct: 8   WPNVVLLYPFVLSIGLILHVLVPEQVQDQLKQHVYFFNSKNVLNQVFAYKGNLVWTVLFL 67

Query: 68  LLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVXXXXXXXXXXXXX 127
            ++V+   +++ + + L    +  A  R+    +++QY  K +LKN              
Sbjct: 68  YIAVLSYFIKTMSRDPL----EQRAGGRQVDWQIVRQYCWKLLLKNGLLYLCFLVIDGVF 123

Query: 128 XXTGGECNLI----EDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKV 183
             TGG C  +      I SAE CK  GG+WE GFDISGHFCF                  
Sbjct: 124 IATGGVCTTMGGEMRKIRSAESCKWNGGQWENGFDISGHFCFLMNISLILWAELQLLQDA 183

Query: 184 LEDREETFTKID-----KWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFV 238
           +   E    +++     KW+   +  +   LY+W+ +LFVTA +YHT  EK++GC  G+V
Sbjct: 184 IRREELGEEELNLWICYKWLRHGLTAVKITLYIWLFLLFVTASFYHTSSEKLIGCAFGYV 243

Query: 239 CPIVMYYFIPNNVKLKQTLY 258
           CP VMY+ IP + +L +  Y
Sbjct: 244 CPFVMYHLIPTSPRLNEFFY 263

>Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to
           Ashbya gossypii AGR350C
          Length = 265

 Score =  154 bits (389), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 89/249 (35%), Positives = 138/249 (55%), Gaps = 8/249 (3%)

Query: 14  IYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFILLSVIQ 73
           +YP+++F G ++  L  +E L+S + ++Y+L   N+ N +   NGN VW +L+IL++ +Q
Sbjct: 21  VYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGVQ 80

Query: 74  IRLQSTNINLLP--RHVDSAASKRRHV--NSLIKQYVIKFVLKNVXXXXXXXXXXXXXXX 129
             +++   + LP    V  ++S+ R+     L+KQ+++K  LK V               
Sbjct: 81  CYIRTKESDSLPLGGSVPGSSSRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDHVFIW 140

Query: 130 TGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKVLEDREE 189
           TGG C  + D  S+  C    G+W GGFDISGHFCF                + L   E 
Sbjct: 141 TGGRCT-VSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANEI 199

Query: 190 TFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFIPN 249
              K   W++ +I++    L  W+ IL+VTA++YHTLLEK+LG ILG+VCP+VMY  IP 
Sbjct: 200 RLRKRLIWIKYMILL---ALVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIPY 256

Query: 250 NVKLKQTLY 258
             KL++ LY
Sbjct: 257 YPKLQRILY 265

>AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR319C
          Length = 261

 Score =  137 bits (346), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 118/242 (48%), Gaps = 9/242 (3%)

Query: 12  CYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFILLSV 71
           CY+YP +L  G +I  +L  ET++  +  +Y+LN  N  NQ+  ++G  +W++L  L+  
Sbjct: 17  CYLYPALLLGGEVIKLILGEETIEHDRKTWYLLNGGNFVNQLFVHHGVLLWTLLMGLVLA 76

Query: 72  IQIRLQSTNINLLPRHVDSAASKRRH----VNSLIKQYVIKFVLKNVXXXXXXXXXXXXX 127
           +Q  +++T  + LP         +RH    + S+  Q VIK +L                
Sbjct: 77  LQYHVRTTEFDPLPLDARELGPVKRHPLKMLGSMAVQTVIKVLLVVTVLQALFWFMDHLF 136

Query: 128 XXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKVLEDR 187
             TGG C  + D   +  C+  GG W GGFDISGHFC                 + +  +
Sbjct: 137 VWTGGRCT-VSDTKDSVACRRLGGEWVGGFDISGHFCLVMNLSLVLWLELTELQRYMHSQ 195

Query: 188 EETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFI 247
           E    K   W       +LG L +W+ +L +TA+YYHT +EK+LG I G+   +V+YY +
Sbjct: 196 EIQLRKF-AWAR---TTVLGALGVWLALLAITAIYYHTFVEKLLGTIFGYSTSLVIYYVL 251

Query: 248 PN 249
           P 
Sbjct: 252 PR 253

>TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON}
           Anc_5.350 YDR319C
          Length = 275

 Score =  134 bits (336), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 134/280 (47%), Gaps = 26/280 (9%)

Query: 1   MKILPIPWPQICYIYPTILFIGVLINSL----------------LPNETLQSHKSNYYVL 44
           MK L   W  +  +YP+I+  G L  SL                LP+E        ++++
Sbjct: 1   MKQLAPNWIVLVCLYPSIMLFGSLTGSLGGYNKSNGNGHNDIDDLPSEP----SDKFWLI 56

Query: 45  NSKNIFNQVMAYNGNKVWSILFILLSVIQIRLQSTNINL-LPRHVDSAAS----KRRHVN 99
            S + FNQ+ AYNGN V+  LF+++  +Q+     +  L LP  + + +     + +H  
Sbjct: 57  RSNSWFNQLFAYNGNTVFLGLFLIIVSLQVYFSREDARLSLPIEIRTISRIKQFQTKHYL 116

Query: 100 SLIKQYVIKFVLKNVXXXXXXXXXXXXXXXTGGECNLIEDIWSAEHCKAKGGRWEGGFDI 159
            + K+Y+ K +LK                 TGG C        A  C++  G W GGFDI
Sbjct: 117 RIAKEYICKLILKYFFLYLEFLFIDHLFVLTGGYCTNGSGTRDAMICRSGNGEWVGGFDI 176

Query: 160 SGHFCFXXXXXXXXXXXXXXXNKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVT 219
           SGHFCF                + +  R+   + +   +  ++  I+  L LW+ +L VT
Sbjct: 177 SGHFCFLVTLSLIIWLELFKLEEFIRSRDLK-SNVTNEVIFMVFFIVSILILWIVMLCVT 235

Query: 220 AVYYHTLLEKILGCILGFVCPIVMYYFIPNNVKLKQTLYK 259
           ++YYHT +EK+LGCI+G++CPIVMY  +P N    + +YK
Sbjct: 236 SLYYHTFVEKLLGCIMGYICPIVMYRVLPRNTIFTRYIYK 275

>KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C
          Length = 267

 Score =  128 bits (322), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 128/254 (50%), Gaps = 15/254 (5%)

Query: 4   LPIPWPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWS 63
            P+P     +IYP ++  G  I+ L+  + L+  +  +Y +  +N+ N + AY G  ++ 
Sbjct: 11  FPVPGDWWLHIYPALVIFGYFISVLIGEDELERERKEWYWIGGRNVVNHLFAYKGIYIFD 70

Query: 64  ILFILLSVIQIRLQSTNI-NLLPRHVDSAASKRRHVNSLIKQ-------YVIKFVLKNVX 115
           +LF LL  +Q+ ++  +  +LLP    S   + R+   L+KQ       Y IKFVL  + 
Sbjct: 71  VLFGLLIGLQVYVRMKHEESLLP---TSNGEQDRNSPDLLKQVGKVLKVYSIKFVLVYLV 127

Query: 116 XXXXXXXXXXXXXXTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXX 175
                         TGG C+L  D  SAE C++ GG W GGFDISGHFCF          
Sbjct: 128 LWACFLFIDHLFVWTGGNCDL-SDTKSAEKCRSLGGSWVGGFDISGHFCFLTNISLTLWQ 186

Query: 176 XXXXXNKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCIL 235
                 +       ++       + +++++L C+  W+ +L +T++YYHT  EK+LGC  
Sbjct: 187 ELKLLLQYANQHTISWNSPSSKYQWIVLLVL-CI--WINVLTITSIYYHTFPEKVLGCAF 243

Query: 236 GFVCPIVMYYFIPN 249
           G+ C +V+YY +P 
Sbjct: 244 GYSCLLVIYYILPR 257

>KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON}
           Anc_6.117 YGL126W
          Length = 237

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 63/139 (45%), Gaps = 19/139 (13%)

Query: 130 TGGECN----LIEDIWSAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKV-- 183
           TGG+C+      + + S++HCK  GG W  G D SGH                   +V  
Sbjct: 99  TGGKCDGGSTSSKLLKSSKHCKKIGGNWINGHDPSGHIFLLSIMTTFMINEFSKIRRVSM 158

Query: 184 ---LEDREETFTKIDKWM---------EGVIVIILGCLYLWMGILFVTAV-YYHTLLEKI 230
               +D  ET   +D+ +            ++I+L  + LW   L +T++ YYHTL E++
Sbjct: 159 TQLRQDFVETDWNLDRQLPVKIILFISNNPVIIMLSFILLWWHSLVITSINYYHTLSEQL 218

Query: 231 LGCILGFVCPIVMYYFIPN 249
            G +  ++    +Y F+P+
Sbjct: 219 SGLLFAYIIMGPLYLFLPS 237

>Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W
           (REAL)
          Length = 316

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 42/104 (40%), Gaps = 11/104 (10%)

Query: 142 SAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKVLEDREETFTKIDKWMEGV 201
           ++  C+  GG W GG D SGH                   +V   R        KW    
Sbjct: 213 TSAQCRRFGGHWAGGHDPSGHVFLTTLMCMFLLGEL----RVFGRRALAHLYAQKWH--- 265

Query: 202 IVIILGCL-YLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMY 244
              +LG + +LW  +L   A ++HT+ E I G +  ++   V+Y
Sbjct: 266 ---LLGMVTWLWQLLLTAVASHFHTVREHISGLLAAYLVTGVVY 306

>Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii AAR165W
          Length = 367

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 30/49 (61%)

Query: 199 EGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFI 247
           E  ++ ++G ++ W+   F+T   +H+L E++ G I  ++   ++Y++I
Sbjct: 318 ENPVIFLIGLIFTWLWAFFITCTMFHSLGEQLTGLIAAYIVVSLIYWYI 366

>KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON}
           Anc_6.117 YGL126W
          Length = 246

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 47/125 (37%), Gaps = 18/125 (14%)

Query: 130 TGGECNLIE-----DIW--SAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNK 182
           +GG C L        +W  ++  C+  GG W+GG D SGH                  + 
Sbjct: 115 SGGSCLLDPATTPGTLWLSTSAACRRHGGLWQGGHDPSGHMFLLSLMLMFLLSELPAGSS 174

Query: 183 VLEDREE--------TFTKIDKWME-GVIVIILGCLYLWMGILFVTAVYYHTLLEKILGC 233
               R +           +   W E GV+ + L   + W   L VTA  +HTL E+  G 
Sbjct: 175 GGRRRGKHAAFASAAAAARFILWDEPGVLALALTACWTWA--LLVTAARFHTLPEQTSGL 232

Query: 234 ILGFV 238
           +   V
Sbjct: 233 LAAVV 237

>ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 372

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 137 IEDIWSAEHCKAKGGRWEGGFDISGH 162
           + +I ++  C+A GG W+GG D SGH
Sbjct: 199 VREISTSAACRATGGHWKGGHDPSGH 224

>TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.117
           YGL126W
          Length = 327

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 43/106 (40%), Gaps = 16/106 (15%)

Query: 142 SAEHCKAKGGRWEGGFDISGHFCFXXXXXXXXXXXXXXXNKVLEDREETFTKIDKWMEGV 201
           S++ C+  GG W GG D SGH                  +  L      F ++   M G+
Sbjct: 236 SSQKCRKIGGAWSGGHDPSGHMFLLTLMIMTFLTISISKDNYL------FVRLIAAMFGL 289

Query: 202 IVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFI 247
           +       Y +M    VT   +HT  E+I G +  ++ P  +Y ++
Sbjct: 290 M-----SSYSFM----VTIFNFHTFAEQITGFMAAYI-PAGLYIYL 325

>SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {ON}
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126W SCS3 Protein required for inositol prototrophy
          Length = 429

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 15/21 (71%)

Query: 142 SAEHCKAKGGRWEGGFDISGH 162
           S++ CK+ GG W GG D SGH
Sbjct: 266 SSQKCKSLGGHWSGGHDPSGH 286

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 28/47 (59%)

Query: 199 EGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYY 245
           E  I++++  +++W     VT + +HT+ E++ G I  +V   ++Y+
Sbjct: 380 ENPIILLVSLVFVWWWNFLVTTIVFHTISEQLSGLICAYVVAGLVYW 426

>TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {ON}
           Anc_6.117 YGL126W
          Length = 368

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 28/48 (58%)

Query: 198 MEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYY 245
           +E  +++++G   +W     VT+V +HTL E++ G    ++   V+Y+
Sbjct: 310 LENPVILLVGLFLMWWWSFLVTSVVFHTLSEQVSGLAFAYLVAGVIYW 357

>Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON}
           complement(1735..2928) [1194 nt, 398 aa]
          Length = 397

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 143 AEHCKAKGGRWEGGFDISGH 162
           + +C+A GG W GG D SGH
Sbjct: 230 SSNCRAHGGHWVGGHDPSGH 249

>CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126w SCS3 inositol phospholipid synthesis protein
          Length = 371

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 49/136 (36%), Gaps = 37/136 (27%)

Query: 146 CKAKGGRWEGGFDISGHFCFXXXXX-----XXXXXXXXXXNKVLEDREETFTKIDK---- 196
           C+  GG W+GG D SGH                        +V++ R+    KI K    
Sbjct: 235 CRLNGGYWQGGHDPSGHIFLLTLMILFLVGESKQFIVGAVMRVVDTRKYVMDKIKKICNE 294

Query: 197 ---------------------------WMEGVIVIILGCLYLWMGILFVTAVYYHTLLEK 229
                                      W E  ++++L  L +W+    +T + +HTL E+
Sbjct: 295 PMANASVYERRVRKLMRCLSFSASYILW-ENPVILLLLLLAIWVWNFVITVIVFHTLTEQ 353

Query: 230 ILGCILGFVCPIVMYY 245
           + G    +V   ++YY
Sbjct: 354 LSGLFFAYVVGALLYY 369

>AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL126W (SCS3)
          Length = 362

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 29/50 (58%)

Query: 198 MEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFI 247
           +E  I++++G +  W   L VT + +H+  E + G +  ++  + +Y++I
Sbjct: 313 LENPILLLVGLILTWTWSLLVTILSFHSFAEHLTGLLFAYLLVLALYWYI 362

>TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6.117
           YGL126W
          Length = 390

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 12/20 (60%)

Query: 143 AEHCKAKGGRWEGGFDISGH 162
           +  CK  GG W GG D SGH
Sbjct: 222 SSKCKRNGGHWVGGHDPSGH 241

>Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {ON}
           YGL126W (SCS3) - involved in inositol biosynthesis
           [contig 237] FULL
          Length = 363

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 197 WMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYY 245
           W   VI+++L   +LW   L +T + +HTL E++ G +  +V    +Y+
Sbjct: 313 WRNPVILLVL-FTFLWWWSLLITTIAFHTLWEQLSGLLCAYVVAGFVYW 360

>KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 363

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 27/47 (57%)

Query: 199 EGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYY 245
           E  +V+++   +LW   L +T + +HTL E++ G +  ++    +Y+
Sbjct: 314 ENPVVLLVLFTFLWWWSLLITTIAFHTLWEQLSGLLCAYIVAGFVYW 360

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.143    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,652,720
Number of extensions: 905117
Number of successful extensions: 3332
Number of sequences better than 10.0: 47
Number of HSP's gapped: 3361
Number of HSP's successfully gapped: 53
Length of query: 259
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 152
Effective length of database: 41,212,137
Effective search space: 6264244824
Effective search space used: 6264244824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)