Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C031105.122ON56456427810.0
NCAS0D016605.122ON56456425820.0
CAGL0M07920g5.122ON56456425660.0
NDAI0A01400na 1ON56356225200.0
Smik_12.1065.122ON56356325200.0
YLR044C (PDC1)5.122ON56356325120.0
Suva_10.1285.122ON56356325090.0
Skud_12.1105.122ON56356325070.0
TDEL0E050805.122ON56356224930.0
KAFR0E020205.122ON56456424920.0
ACL134C5.122ON58656424680.0
KLLA0E16303g5.122ON56356224660.0
Kpol_1010.485.122ON56356324590.0
SAKL0G14894g5.122ON56456424580.0
Suva_10.227na 2ON56356324480.0
SAKL0G10164gna 3ON56456424440.0
Ecym_24795.122ON56456424390.0
Smik_12.197na 2ON56356324360.0
KLTH0B01188g5.122ON59356224290.0
YLR134W (PDC5)na 2ON56356324280.0
Skud_12.203na 2ON56356324210.0
TPHA0H009505.122ON56356324200.0
ZYRO0F01606g5.122ON56356324190.0
TPHA0Q00120singletonON56356324170.0
TBLA0B075205.122ON56356324170.0
NCAS0A14630na 1ON56356224100.0
Kwal_33.155405.122ON56456224080.0
TBLA0B10060singletonON56456423880.0
Suva_7.369na 4ON56356323800.0
KAFR0E01520singletonON56356323750.0
AAL073Wna 3ON56356223450.0
YGR087C (PDC6)na 4ON56356323420.0
SAKL0F04334gsingletonON56456323350.0
KNAG0M012505.122ON56356323260.0
TBLA0D02840singletonON56356323190.0
KNAG0J01330singletonON56456422880.0
TBLA0E03070singletonON56356322790.0
NCAS0A14240singletonON56556422760.0
NDAI0A02510singletonON56356322480.0
KLTH0D08272gsingletonON56356221830.0
NDAI0D03270singletonON52152121770.0
KNAG0J01340singletonON56556221780.0
CAGL0G02937gna 4ON56456320880.0
Ecym_3185na 3ON56356319910.0
SAKL0E04972g2.390ON61154818370.0
KLTH0E09702g2.390ON60754915790.0
Kwal_47.178782.390ON61054915720.0
ZYRO0A08426g2.390ON58454615650.0
YDL080C (THI3)2.390ON60955415490.0
Suva_4.1672.390ON62055415450.0
TDEL0G032102.390ON60656715390.0
KNAG0A059002.390ON62055715120.0
Skud_4.1752.390ON62055415050.0
Smik_4.1562.390ON62155415020.0
TPHA0G026202.390ON68859314940.0
CAGL0L06842g2.390ON63858114810.0
NCAS0A040002.390ON62556814650.0
KAFR0F029902.390ON60855714580.0
TBLA0B088202.390ON63558614430.0
NDAI0E017002.390ON62156414410.0
Ecym_60552.390ON59256013031e-174
ADR254W2.390ON58155312531e-166
Kpol_1046.92.390ON59856410981e-143
KLLA0F16962g2.390ON5785558371e-104
CAGL0A03102g5.456ON6496028221e-101
SAKL0G03036g5.456ON6376008121e-100
YDR380W (ARO10)5.456ON6356117989e-98
Suva_2.5545.456ON6356107962e-97
NCAS0A118305.456ON6376137822e-95
Skud_4.6515.456ON6356167805e-95
Kpol_1062.125.456ON6305917691e-93
Smik_4.6495.456ON6356107682e-93
KLTH0F15510g5.456ON6256017612e-92
ACR211W5.456ON6295947594e-92
KAFR0E037305.456ON6356097377e-89
Kpol_440.45.456ON6366087352e-88
ZYRO0G04378g5.456ON6136057236e-87
TPHA0J026805.456ON6486287204e-86
TBLA0A026705.456ON6406177177e-86
KNAG0C047905.456ON6376027161e-85
TDEL0D024505.456ON6756077172e-85
KLLA0E02707g5.456ON6315996992e-83
TBLA0A064205.456ON6386146942e-82
SAKL0D00220gsingletonON5775736892e-82
TPHA0E016005.456ON6515996742e-79
KLTH0D00418gsingletonON5615666402e-75
TDEL0C07020singletonON5605666104e-71
TDEL0F00150singletonON5605656106e-71
NDAI0A044505.456ON5615545913e-68
Skud_7.383na 4ON86922073e-19
YMR108W (ILV2)2.441ON6873121859e-14
NDAI0H023802.441ON6853011795e-13
Smik_13.2972.441ON6873111733e-12
NCAS0F015002.441ON6845151724e-12
KAFR0A005702.441ON6823111707e-12
KNAG0E023602.441ON6933121662e-11
CAGL0K03465g2.441ON6773091653e-11
Suva_13.2872.441ON6873041619e-11
TBLA0I014002.441ON7103101592e-10
Kwal_26.75822.441ON6793021592e-10
SAKL0E03740g2.441ON6793111582e-10
TDEL0B055201.450ON5554901572e-10
TPHA0G024402.441ON6913041554e-10
KNAG0A062502.441ON6803091538e-10
KLLA0B12584g2.441ON6915301502e-09
Kpol_297.122.441ON6713111502e-09
Skud_13.2672.441ON6873051502e-09
Ecym_61072.441ON6893091483e-09
ZYRO0G19954g2.441ON7003101484e-09
TDEL0A021602.441ON6823061474e-09
KLTH0D04532g2.441ON6783021457e-09
NCAS0A043202.441ON6893151449e-09
TPHA0G028852.441ON6883041394e-08
Skud_5.761.450ON5604971394e-08
SAKL0D10934g1.450ON5503481385e-08
AEL305C2.441ON6683071385e-08
NDAI0E020502.441ON6905051351e-07
ZYRO0E03454g1.450ON5492841341e-07
NCAS0G039601.450ON5772941332e-07
YEL020C1.450ON5603701323e-07
Smik_5.871.450ON5604991305e-07
AEL055C1.450ON5454871224e-06
Suva_5.681.450ON5613551135e-05
Ecym_13601.450ON5442821109e-05
KNAG0H015801.450ON5602971054e-04
TPHA0B039401.450ON5751111037e-04
Kpol_1061.501.450ON5711041020.001
KLTH0H14102g1.450ON551104990.002
Kwal_34.161161.450ON553142980.003
CAGL0M03245g1.450ON56276900.023
NDAI0G005201.450ON575364890.035
TBLA0C015601.450ON582361860.073
KAFR0H028901.450ON56056820.26
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C03110
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122   1075   0.0  
NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {O...   999   0.0  
CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa] ...   993   0.0  
NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON}              975   0.0  
Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {...   975   0.0  
YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON} ...   972   0.0  
Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {...   971   0.0  
Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {...   970   0.0  
TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.1...   964   0.0  
KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.1...   964   0.0  
ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON} S...   955   0.0  
KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]...   954   0.0  
Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON} (1109...   951   0.0  
SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON} unip...   951   0.0  
Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134...   947   0.0  
SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {...   946   0.0  
Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar t...   944   0.0  
Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134...   942   0.0  
KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {...   940   0.0  
YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor...   939   0.0  
Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134...   937   0.0  
TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.1...   936   0.0  
ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {...   936   0.0  
TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON}      935   0.0  
TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa] ...   935   0.0  
NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa] ...   932   0.0  
Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR0...   932   0.0  
TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa] ...   924   0.0  
Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON...   921   0.0  
KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {O...   919   0.0  
AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-synteni...   907   0.0  
YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}  ...   906   0.0  
SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {...   904   0.0  
KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {...   900   0.0  
TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {O...   897   0.0  
KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {...   885   0.0  
TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON}              882   0.0  
NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON}            881   0.0  
NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {O...   870   0.0  
KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {...   845   0.0  
NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON}              843   0.0  
KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {...   843   0.0  
CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {...   808   0.0  
Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar t...   771   0.0  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...   712   0.0  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...   612   0.0  
Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080...   610   0.0  
ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {...   607   0.0  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...   601   0.0  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...   599   0.0  
TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {O...   597   0.0  
KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {O...   587   0.0  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...   584   0.0  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...   583   0.0  
TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {O...   580   0.0  
CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} simil...   575   0.0  
NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {O...   568   0.0  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...   566   0.0  
TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON} Anc_2...   560   0.0  
NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390    559   0.0  
Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}...   506   e-174
ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic ...   487   e-166
Kpol_1046.9 s1046 (18301..18855,18984..18992,19556..19693,19697....   427   e-143
KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]...   327   e-104
CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} simila...   321   e-101
SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} simila...   317   e-100
YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}  ARO10Phe...   311   9e-98
Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W ...   311   2e-97
NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON} Anc_5...   305   2e-95
Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380...   305   5e-95
Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {O...   300   1e-93
Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380...   300   2e-93
KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]...   297   2e-92
ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic ho...   296   4e-92
KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {O...   288   7e-89
Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..1137...   287   2e-88
ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {...   283   6e-87
TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5....   281   4e-86
TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {O...   280   7e-86
KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {O...   280   1e-85
TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {O...   280   2e-85
KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} simila...   273   2e-83
TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa] ...   271   2e-82
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...   270   2e-82
TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {O...   264   2e-79
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...   251   2e-75
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...   239   4e-71
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                239   6e-71
NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa] ...   232   3e-68
Skud_7.383 Chr7 complement(638760..638846,638850..638882,638886....    84   3e-19
YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}  ILV2Aceto...    76   9e-14
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     74   5e-13
Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108...    71   3e-12
NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.4...    71   4e-12
KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {O...    70   7e-12
KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {O...    69   2e-11
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    68   3e-11
Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108...    67   9e-11
TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.4...    66   2e-10
Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W...    66   2e-10
SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly...    65   2e-10
TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {O...    65   2e-10
TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {O...    64   4e-10
KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {O...    64   8e-10
KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]...    62   2e-09
Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}...    62   2e-09
Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108...    62   2e-09
Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}...    62   3e-09
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    62   4e-09
TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {O...    61   4e-09
KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly...    60   7e-09
NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {O...    60   9e-09
TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}     58   4e-08
Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}...    58   4e-08
SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} simila...    58   5e-08
AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON} Syn...    58   5e-08
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    57   1e-07
ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {...    56   1e-07
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    56   2e-07
YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON} P...    55   3e-07
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    55   5e-07
AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON} S...    52   4e-06
Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C (...    48   5e-05
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    47   9e-05
KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {O...    45   4e-04
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    44   7e-04
Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON} (1417...    44   0.001
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    43   0.002
Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {...    42   0.003
CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa] ...    39   0.023
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    39   0.035
TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.4...    38   0.073
KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {O...    36   0.26 

>NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122
          Length = 564

 Score = 1075 bits (2781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/564 (93%), Positives = 526/564 (93%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF
Sbjct: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAE                     
Sbjct: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEAAKGYKPVAVPAKPAANAAVD 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG
Sbjct: 361 AATPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI
Sbjct: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML
Sbjct: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQD 564
           PVMDAPSNLVAQAQLTAKINAKQD
Sbjct: 541 PVMDAPSNLVAQAQLTAKINAKQD 564

>NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {ON}
           Anc_5.122
          Length = 564

 Score =  999 bits (2582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/564 (84%), Positives = 507/564 (89%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+Q+DVKTIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLSLKAND EAE EV+ TIL+L+K AKNP+ILADACASRHDVKAET+KLIDITQF
Sbjct: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPA+K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDYIKIKNATFPGVQMKF LQKLL  +A                      
Sbjct: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIAAAAKGYKPVAVPAKPAANPATA 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQVGKFLQEGDVVI+ETGTSAFGINQTHFPNNTYGISQVLWGSIGF TG
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
             LGAAFAAEE+DPKKRVILF G+GSLQLTVQEISTMVRWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG  A YN+IQ+W+HL+LLPTFGAKDYENHRV+TTGEW KLT NKEFNQN+RIR+IEIML
Sbjct: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQD 564
           PVMDAPSNLVAQA+LTA INAKQD
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQD 564

>CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 pyruvate decarboxylase or
           uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
          Length = 564

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/564 (85%), Positives = 505/564 (89%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL+QVDVKTIFGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDLSLK ND EAETEVV+T+LELIK AKNPVILADACASRHDVKAETKKLID TQF
Sbjct: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDYIKI+NATFPGVQMKFALQKLL +V E                     
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEWMWNQV KFLQEGDVVITETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           ACLGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG  A YN+IQ+WDHL+LLPTFGAKDYENHRVATTGEW KLT++KEFN+NS+IR+IE+ML
Sbjct: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQD 564
           PVMDAP++L+ QA+LTA INAKQ+
Sbjct: 541 PVMDAPTSLIEQAKLTASINAKQE 564

>NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/562 (85%), Positives = 500/562 (88%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLSQV+V TIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVNVNTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDLSLK ND EAE EV+  +L LIK+AKNPVILADAC SRHDVK ET+KLIDITQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVLEEVLSLIKNAKNPVILADACCSRHDVKVETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IKI+NATFPGVQMKF LQKLL SV                       
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLKSVPAAVKGYKPVPVPAGIPANKKVA 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEWMWNQVGKFLQEGD+VITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG
Sbjct: 361 DSTPLKQEWMWNQVGKFLQEGDIVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DPK+RVILFIGDGSLQLTVQEISTMVRWNLKPYLF+LNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKRRVILFIGDGSLQLTVQEISTMVRWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTAQYNEIQSW+HL LL TFGAKDYENHRVATTGEW KL ENKEFN NSRIR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLKLLETFGAKDYENHRVATTGEWNKLCENKEFNVNSRIRVIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAK 562
           PVMDAP +L+ Q +LTA+INA+
Sbjct: 541 PVMDAPQSLIKQGELTAQINAR 562

>Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/563 (82%), Positives = 495/563 (87%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPID+SLKAND E+E EV++TIL L+KDAKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDMSLKANDAESEKEVIDTILSLVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD++KI+NATFPGVQMKF LQKLL  +A+                     
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTVIADAAKGYKPVAVPANTPANAAVP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEWMWNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWMWNQLGSFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP AQYNEIQ+WDHLSLLPTFGAKDYE HRVATTGEW KLT++K FN NS+IR+IE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PV DAP NLV QA+LTA  NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON}
           PDC1Major of three pyruvate decarboxylase isozymes, key
           enzyme in alcoholic fermentation, decarboxylates
           pyruvate to acetaldehyde; subject to glucose-, ethanol-,
           and autoregulation; involved in amino acid catabolism
          Length = 563

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/563 (82%), Positives = 494/563 (87%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPID+SLK ND E+E EV++TIL L+KDAKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD++KI+NATFPGVQMKF LQKLL ++A+                     
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEWMWNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP AQYNEIQ WDHLSLLPTFGAKDYE HRVATTGEW KLT++K FN NS+IR+IEIML
Sbjct: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PV DAP NLV QA+LTA  NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/563 (82%), Positives = 497/563 (88%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+QV+V T+FGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPID+SLK ND E+E EV++TIL L+KDAKNP+ILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDMSLKPNDAESEKEVIDTILALVKDAKNPIILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPR+GGVYVGTLS P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD++KI+NATFPGVQMKF LQKLL +VA+                     
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTVADAAKGYKPVAVPAPTPANAAVP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEWMWNQ+G+FLQEGDVVI ETGTSAFGINQ  FPNNTYGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWMWNQLGEFLQEGDVVIAETGTSAFGINQVAFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP AQYNEIQ+WDHLSLLPTFGAKDYE HRVATTGEW KLT++K FN+NS+IR+IEIML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PV DAP NLV QA+LTA  NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/563 (82%), Positives = 495/563 (87%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPID+SLK ND E+E EV++TI+ L+KDAKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS PAVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IKI+NATFPGVQMKF LQKLL ++A+                     
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPAGTPANAAVA 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEWMWNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLF+LNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP AQYNEIQ+WDHLSLLPTFGAKDYE HRVATTGEW KLT++K FN NS+IR+IEIML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PV DAP NLV QA+LTA  NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  964 bits (2493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/562 (82%), Positives = 494/562 (87%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QVD  TIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLSLKAND EAE EVV+ +L LIK AKNPVILADAC SRHDVK ET+KLIDITQF
Sbjct: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLSSP VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDYIKI+NATFPGVQMKFALQKLL  V +                     
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQ+W+WNQVGKFLQEGDVVITETGTSAFGINQ+HFPN TYGISQVLWGSIGFTTG
Sbjct: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTMVRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG  AQYN+IQ W +L LLPTFGAKDYE HRV+TTGEW KLT + EFN+NS+IR+IE+ML
Sbjct: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAK 562
           PVMDAPS+LVAQAQLTA INAK
Sbjct: 541 PVMDAPSSLVAQAQLTASINAK 562

>KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.122
           YLR044C
          Length = 564

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/564 (82%), Positives = 492/564 (87%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL+QVDVKTIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDLSLK ND EAE EVV+TIL LIKDAKNPVIL+DACASRHDVKAETK+LID TQF
Sbjct: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPRFGGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNI+EFHSDY KI+NATFPGVQMKF L+KLL SVA+                     
Sbjct: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPL QEWMWNQ  KF QEGDV+ITETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM+RWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG  A YN+IQ+W HL LL TFGAKDYENHRVATTGEW  L  +KEFN+NSRIR+IE+ML
Sbjct: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQD 564
           PVMDAPSNLV QA++TA  NAKQD
Sbjct: 541 PVMDAPSNLVQQAKITAATNAKQD 564

>ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR044C
           (PDC1) and Non-syntenic homolog of Saccharomyces
           cerevisiae YLR134W (PDC5) and YGR087C (PDC6)
          Length = 586

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/564 (80%), Positives = 496/564 (87%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL Q++V+TIFGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 23  MSEITLGRYLFERLRQIEVQTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 82

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 83  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 142

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANIS TTAM++DI +APAEIDRCIRT Y+TQRPVYLGLPAN+VDLKVPASL
Sbjct: 143 DFTVFHRMSANISGTTAMISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPASL 202

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDL+LK ND EAE EVV T+LE+I  AKNPVIL+DACASRHDVKAET KLID+TQF
Sbjct: 203 LETPIDLNLKPNDPEAEAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQF 262

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSI EQHPRFGGVYVGTLSSP VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 263 PAFVTPMGKGSIYEQHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 322

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IKI+NATFPGVQMK+ L+KL+ +VAE                     
Sbjct: 323 YKTKNVVEFHSDHIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEID 382

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQVGKFL+EGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG
Sbjct: 383 SATPLKQEWLWNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 442

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           ACLGAAFAAEE+DP +RVILFIGDGSLQLTVQEISTMVRW LKPYLFVLNN+GYTIE+LI
Sbjct: 443 ACLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 502

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG TAQYN+IQ W HL+LLPTFGAKDYE  RV+TTGEW  LT++K FN+NS+IR+IE+ML
Sbjct: 503 HGETAQYNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVML 562

Query: 541 PVMDAPSNLVAQAQLTAKINAKQD 564
           PVMDAPSNLV QA+LTA  NAKQ+
Sbjct: 563 PVMDAPSNLVKQAELTAATNAKQE 586

>KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism
          Length = 563

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/562 (81%), Positives = 492/562 (87%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+V+TIFGLPGDFNLSLLD IYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDNIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETTAM+TDI TAPAEIDRCIRTTYV+QRPVYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSSNISETTAMITDINTAPAEIDRCIRTTYVSQRPVYLGLPANLVDLTVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLSLK ND EAE EV+  +L+LIK+AKNPVILADAC SRHD KAETKKLID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEEEVIENVLQLIKEAKNPVILADACCSRHDAKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPRFGGVYVGTLSSPAVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDY KI++ATFPGVQMKFALQKLL  VA+                     
Sbjct: 301 YKTKNIVEFHSDYTKIRSATFPGVQMKFALQKLLTKVADAAKGYKPVPVPSEPEHNEAVA 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+W QVG+FL+EGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG
Sbjct: 361 DSTPLKQEWVWTQVGEFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG TAQYN IQ+W HL LLPTFGAKDYE  RV+TTGEW KLT +++F  N+RIRLIE+ML
Sbjct: 481 HGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKFQDNTRIRLIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAK 562
           P MDAPSNLV QAQLTA  NAK
Sbjct: 541 PTMDAPSNLVKQAQLTAATNAK 562

>Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON}
           (110999..112690) [1692 nt, 564 aa]
          Length = 563

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/563 (80%), Positives = 491/563 (87%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV V+TIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETTAM+TDIA APAEIDRCIRTTY+TQR VYLGLPAN+VDL VPA L
Sbjct: 121 DFTVFHRMSACISETTAMITDIANAPAEIDRCIRTTYITQRTVYLGLPANMVDLMVPADL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLSLK ND EAETEV++TIL ++K+AKNP+ILADACASRHDVKAETK+LID TQF
Sbjct: 181 LKTPIDLSLKPNDPEAETEVLDTILAMVKEAKNPIILADACASRHDVKAETKQLIDTTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGSIDEQHPRFGGVYVGTLS P VK AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKAAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKN+VEFHSD+ KIK A+FPGVQMKF LQKL+  +                       
Sbjct: 301 YQTKNVVEFHSDHTKIKKASFPGVQMKFVLQKLVAQIGAAVKDYKPVAAPALPASNAECP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQVGKFLQEGD+V+TETGTSAFGINQTHFPNNTYGISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DPKKR I+FIGDGSLQLTVQEISTM+RWNLKPY+FVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTAQYNEIQ+W HL +LPTFGAKDYE  RVATTGE+ KL E+K FN+NS+IR+IEIML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYEAIRVATTGEFNKLCEDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PVMDAPSNLVAQA+LTA INAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAF0 Saccharomyces kluyveri PDC12 Pyruvate
           decarboxylase
          Length = 564

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/564 (83%), Positives = 500/564 (88%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL+QV+V+TIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVEVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTA VTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLSLK ND EAE EVVNT+LELIKDAKNPVILADACASRH+VK+ETK+LIDITQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNTVLELIKDAKNPVILADACASRHNVKSETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPRFGGVYVGTLS+  VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDYIKI+NATFPGVQMKFALQKLL  V E                     
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSQVGEVVKDYKPVAVPAKPTPNPACD 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQVG+FLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           ACLGAA AAEE+D  KRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG  AQYNEIQ W +L LLPTFGAKDYE +RVATTGEW KL +++ FN+NSRIR++E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQD 564
           PVMDAPSNLV QAQLTA INAKQ+
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQE 564

>Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/563 (79%), Positives = 484/563 (85%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLSQVD  T+FGLPGDFNLSLLDK+YE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVDCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPID++LK ND EAE EVV T++E+I+DAKNPVILADACASRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDMALKPNDAEAEAEVVRTVIEMIQDAKNPVILADACASRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKNIVEFHSD+IKI+NATFPGVQMKFALQ+LL ++ E                     
Sbjct: 301 YRTKNIVEFHSDHIKIRNATFPGVQMKFALQRLLSAIPEVVKDYKPVAVPARTPANKALP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TP+KQEWMWNQ+  FLQEGD+VI ETGTSAFGINQT FP + Y I QVLWGSIGFT G
Sbjct: 361 ASTPMKQEWMWNQLSTFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGA  AAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPY+FVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP A+YNE+Q WDHL+LLPTFGAKDYE HRV TTGEW KLT++KEF  NSRIR+IE+ML
Sbjct: 481 HGPHAEYNEVQPWDHLALLPTFGAKDYETHRVVTTGEWDKLTQDKEFQDNSRIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PV DAP NLV QAQLTA  NAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {ON}
           uniprot|Q6W9G6 Saccharomyces kluyveri PDC11 Pyruvate
           decarboxylase
          Length = 564

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/564 (83%), Positives = 497/564 (88%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLG YLFERL+QVDVKTIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGLYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTA VTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLSLK ND EAE EVVN++LELIKDAKNP+ILADACASRHDVK ETK+LIDITQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNSVLELIKDAKNPIILADACASRHDVKPETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPRFGGVYVGTLS+  VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDYIKI+NATFPGVQMKFALQKLL  +                       
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSEIGAVVKDYKPVAVPPKPTPNPACD 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQVG+FLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           ACLGAA AAEE+D  KRVILFIGDGSLQLTVQEISTM+RW L+PYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLRPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG  AQYNEIQ W +L LLPTFGAKDYE +RVATTGEW KL +++ FN+NSRIR++E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQD 564
           PVMDAPSNLV QAQLTA INAKQD
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQD 564

>Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii ACL134C
          Length = 564

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/564 (79%), Positives = 492/564 (87%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEIT+G YLF+RL QV+V+TIFGLPGDFNL+LLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITIGHYLFQRLKQVEVQTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCVITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISE+TAM+TD+ATA  EIDRCIRT Y++QRPVYLGLPANLVD KVPASL
Sbjct: 121 DFTVFHRMSANISESTAMITDVATAAREIDRCIRTCYISQRPVYLGLPANLVDAKVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPID SLK ND EAE EVV T+LE+I ++KNPVIL+DACASRHDVK ETK+LID+TQF
Sbjct: 181 LETPIDFSLKPNDAEAENEVVGTVLEMIANSKNPVILSDACASRHDVKEETKRLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPRFGGVYVGTLSSP VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+ K++NATFPGVQMKF L+KL+  V +                     
Sbjct: 301 YKTKNIVEFHSDHTKVRNATFPGVQMKFVLKKLVDVVGDVAKNYVPVPVPTQPVHGSDVD 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPL+QEW+W +V +FL+EGDVVITETGTSAFGINQTHFPN+TYGISQVLWGSIGFTTG
Sbjct: 361 PATPLRQEWIWREVARFLREGDVVITETGTSAFGINQTHFPNDTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           ACLGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG TAQYN+IQ WDHL LLPTFGAKDYE  RV+T GEW +LT++K F++NS+IR+IE+ML
Sbjct: 481 HGETAQYNDIQPWDHLKLLPTFGAKDYEAVRVSTAGEWQQLTQDKAFSENSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQD 564
           PVMDAPSNLV QAQLTA  NAKQD
Sbjct: 541 PVMDAPSNLVKQAQLTAATNAKQD 564

>Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  942 bits (2436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/563 (80%), Positives = 483/563 (85%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLSQV   T+FGLPGDFNLSLLDK+YE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVKCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKG++CIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGIACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDLSLK ND EAE EVV T++E+IKDAKNPVILADACASRHDVKAETKKLI++TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPR+GGVYVGTLS P VKE VE+ADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKEGVENADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IKI+NATFPGVQMKFALQKLLG++                       
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLGAIPAVVKDYKPVAVPARVPLNKPSP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TP+KQEWMWNQ+  FLQEGD+VI ETGTSAFGINQT FP + Y I QVLWGSIGFT G
Sbjct: 361 ANTPMKQEWMWNQLSNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGA  AAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPY+FVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP A YNEIQ WDHL+LLPTFGAKDYENHR+ATTGEW KLT++K+F  NSRIRLIE+ML
Sbjct: 481 HGPYADYNEIQGWDHLALLPTFGAKDYENHRIATTGEWDKLTQDKDFQDNSRIRLIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PV DAP NLV QAQLTA INAKQ
Sbjct: 541 PVFDAPENLVQQAQLTASINAKQ 563

>KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 593

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/562 (79%), Positives = 487/562 (86%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRY+FERL QVDV T+FGLPGDFNL LLD+IYE  GMRWAGN NELNA+YAAD 
Sbjct: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPASL
Sbjct: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDL+LK ND +AE EV++T+LE+IKDAKNPVILADACASRHDVKAETKKLIDITQF
Sbjct: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLSSPAVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IKI+NATFPGVQMKF LQ LL  V                       
Sbjct: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQ+W+WNQVG+FLQEGD+V+TETGTSAFGINQTHFPNNTYGISQVLWGSIG+ TG
Sbjct: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           ACLGA  AAEE+D  KRVILF G+GSLQLT QEISTMVRWNLKPYLFVLNN GYTIEKLI
Sbjct: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTA+YNEIQ+W+HL LLPTFGAKDYE  RV+TTGEW KL E+K+FN+NS+IRLIE+ML
Sbjct: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569

Query: 541 PVMDAPSNLVAQAQLTAKINAK 562
           PVMDAP +LV QAQLTA  NAK
Sbjct: 570 PVMDAPESLVKQAQLTAATNAK 591

>YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor
           isoform of pyruvate decarboxylase, key enzyme in
           alcoholic fermentation, decarboxylates pyruvate to
           acetaldehyde, regulation is glucose- and
           ethanol-dependent, repressed by thiamine, involved in
           amino acid catabolism
          Length = 563

 Score =  939 bits (2428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/563 (79%), Positives = 484/563 (85%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLSQV+  T+FGLPGDFNLSLLDK+YE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIA APAEIDRCIRTTY TQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDLSLK ND EAE EVV T++ELIKDAKNPVILADACASRHDVKAETKKL+D+TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPR+GGVYVGTLS P VK+AVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IKI+NATFPGVQMKFALQKLL ++ E                     
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLDAIPEVVKDYKPVAVPARVPITKSTP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TP+KQEWMWN +G FL+EGD+VI ETGTSAFGINQT FP + Y I QVLWGSIGFT G
Sbjct: 361 ANTPMKQEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGA  AAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPY+FVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP A+YNEIQ WDHL+LLPTFGA++YE HRVATTGEW KLT++K+F  NS+IR+IE+ML
Sbjct: 481 HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PV DAP NLV QAQLTA  NAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  937 bits (2421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/563 (78%), Positives = 483/563 (85%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLSQV+  T+FGLPGDFNLSLLDK+YE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKHLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIA+AP+EIDRCIRTT+ TQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIASAPSEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPID+SLK ND EAE EVV T++E+IKDAKNPVILADACASRHDVKAETKKLI++TQF
Sbjct: 181 LDTPIDMSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+IDEQHPR+GGVYVGTLS P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PIFVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IKI+NATFPGVQMKF LQKLL ++ E                     
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFTLQKLLNAIPEVVKDYKPVAVPARVPINKATP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             T +KQEWMWNQ+G FLQEGD+VI ETGTSAFGINQT FP + Y I QVLWGSIGFT G
Sbjct: 361 ANTSMKQEWMWNQLGNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGA  AAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPY+FVLNNNGYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP A+YNE+QSWDHLSLLPTFGA+DYE HR+ TTGEW KLT++K+F  NSRIR+IE+ML
Sbjct: 481 HGPHAEYNEVQSWDHLSLLPTFGARDYETHRITTTGEWDKLTQDKDFQDNSRIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PV DAP NLV QAQLTA  NAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  936 bits (2420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/563 (79%), Positives = 485/563 (86%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MS+ITLG+YLFERL QV  +TIFGLPGDFNLSLLDKIYE PGMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L TPIDLSLK NDV+AETEV+  ILELIKDAKNP+ILADACASRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLS P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSD+IKI+ A+FPGVQMKF L+KL+  V                       
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKPVAIPAPVPANPATP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQVGKFL+EGD+V+TETGTSAFGINQTHFP NTYGISQVLWGSIGFT G
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DPKKR I+FIGDGSLQLTVQEISTM+RWNLKPY+FVLNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTAQYNEIQ+W HL +LPTFGAKDYE  RVATTGEW KL  +K FN+NS+IR+IEIML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PVMDAPSNL+AQA+LTA  NAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTAATNAKQ 563

>ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  936 bits (2419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/563 (80%), Positives = 487/563 (86%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QVD  TIFG+PGDFNLSLLDK+YE  G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KG++ +ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI  APAEIDRCIR  YV QRPVYLGLPANLVD KVPASL
Sbjct: 121 DFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQRPVYLGLPANLVDQKVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L TPIDLSLK ND EAETEVV+T+LELIK+AKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLSSP VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IKI+NATFPGVQMKF L+KLL +V E                     
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLLQAVPEAVKNYKPGPVPAPPSPNAEVA 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             T LKQEW+W QVG FL+EGDVVITETGTSAFGINQTHFPN TYGISQVLWGSIG+TTG
Sbjct: 361 DSTTLKQEWLWRQVGSFLREGDVVITETGTSAFGINQTHFPNQTYGISQVLWGSIGYTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           + LGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 STLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG TA+YN IQ W HL LL TFGAKDYENHRV+T GEW KLT++ +FN+NSRIR+IE+ML
Sbjct: 481 HGETAEYNCIQPWKHLELLNTFGAKDYENHRVSTVGEWNKLTQDPKFNENSRIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
            VMDAPS+LVAQAQLTA  NAKQ
Sbjct: 541 EVMDAPSSLVAQAQLTAATNAKQ 563

>TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/563 (79%), Positives = 484/563 (85%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MS+ITLG+YLFERL QV   TIFGLPGDFNLSLLDKIYE PGMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCNTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L TPIDLSLK NDV+AETEV+  ILELIKDAKNP+ILADACASRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDTTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLS P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSD+IKI+ A+FPGVQMKF L+KL+  V                       
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVIKGYKPVAIPAPVPANPATP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQVGKFL+EGD+V+TETGTSAFGINQTHFP NTYGISQVLWGSIGFT G
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DPKKR I+FIGDGSLQLTVQEISTM+RWNLKPY+FVLNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTA+YNEIQ+W HL +L TFGAKDYENHRVATTGEW KL  ++ FN+NS+IRLIEIML
Sbjct: 481 HGPTAEYNEIQNWKHLDILSTFGAKDYENHRVATTGEWDKLASDRAFNENSKIRLIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PVMDAPSNL+AQA+LT   NAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTEATNAKQ 563

>TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa]
           {ON} Anc_5.122 YLR044C
          Length = 563

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 487/563 (86%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL+QV V+TIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETTAM+TDIATAPAEIDRCIRTTYV QR VYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSAEISETTAMITDIATAPAEIDRCIRTTYVKQRTVYLGLPANLVDLTVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDLSLK ND EAE EV+ T+LEL+++AKNP+I+ADAC SRHDVK+ET++LI+ TQF
Sbjct: 181 LETPIDLSLKPNDAEAENEVIETVLELVREAKNPIIIADACCSRHDVKSETEELINATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSI+E+HPRFGGVYVGTLS P VK AVESADL+LSVGALLSDFNTGSFSY+
Sbjct: 241 PSFTTPMGKGSINERHPRFGGVYVGTLSRPEVKAAVESADLVLSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IK+KNATFPGVQMKF LQKL+  +                       
Sbjct: 301 YKTKNIVEFHSDHIKVKNATFPGVQMKFVLQKLVSKIGAAIKGYKPVAVPAGIPANKEVP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQ+G FLQEGD+V+TETGTSAFGINQT FP +TYGISQVLWGSIGFT G
Sbjct: 361 ANTPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
             LGAAFAAEE++P KR ILFIGDGSLQLTVQEIST++RWNLKPYLFVLNNNGYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPNKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTAQYNEIQ W+HL +LPTFGAKDYE  RVATTGEWIKLT +K F +NS+IR+IEIML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEALRVATTGEWIKLTTDKAFQKNSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PVMDAPSNLVAQA+LTA  NAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTAATNAKQ 563

>NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa]
           {ON} 
          Length = 563

 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/562 (80%), Positives = 484/562 (86%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+V TIFGLPGDFNL+LLDKIYE PGMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETTAMVTD+A A +EIDRCIRTTYVTQR VYLGLPAN+ DLKV ASL
Sbjct: 121 DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLSLK ND  AE EVV TIL L+KDAKNP+ILADAC SRHDVKAETKKLIDITQF
Sbjct: 181 LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PR+GGVYVGTLS+P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IKIK+ATFPGVQMKF LQKLL  +                       
Sbjct: 301 YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TP+KQEWMWN++ KF QEGDV+ITETGTSAFGINQT FP N YGISQVLWGSIGF TG
Sbjct: 361 ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
             LGAAFAAEE+DPKKRVILF G+GSLQLTVQEISTMVRWNLKPYLFVLNN GYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG  A YN+IQ W+HL+LL TFGAKDYENHRV+TTGEW KLT NK+FNQNSRIRLIEIML
Sbjct: 481 HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAK 562
            VMDAPSNLVAQAQLTA INAK
Sbjct: 541 EVMDAPSNLVAQAQLTASINAK 562

>Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR044C
           (PDC1) - pyruvate decarboxylase [contig 290] FULL
          Length = 564

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/562 (82%), Positives = 490/562 (87%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+  TIFGLPGDFNL LLD+IYET GMRWAGNANELNAAYAAD 
Sbjct: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWAGNANELNAAYAADA 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM++D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDLSLK ND  AE EVV+T+L+LIK+AKNPVILADACASRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLSSPAVKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IKI+NATFPGVQMKF LQKLL  V +                     
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQ+W+WNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG
Sbjct: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+D  KRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNNNGYTIEKLI
Sbjct: 421 ATLGAAFAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG  AQYNEIQ W+HL LLPTFGAKDYE  RVATTGEW KL E++EFN+NS+IR+IE+ML
Sbjct: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAK 562
           PVMDAP +LV QAQLTA  NAK
Sbjct: 541 PVMDAPESLVKQAQLTAATNAK 562

>TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa]
           {ON} 
          Length = 564

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/564 (78%), Positives = 489/564 (86%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MS+ITLG+YLFERL+QV V+TIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAE               QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVASQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF  FHRMSA ISETTAM+TDIA APAEIDRCIRTTYVTQR VYLGLPANLVDL VPASL
Sbjct: 121 DFDAFHRMSAEISETTAMITDIANAPAEIDRCIRTTYVTQRTVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDL+LK N  E+E+EV+ TIL+++K+AKNP+I+ADACASRH+VK ET++LIDITQF
Sbjct: 181 LETPIDLALKPNCPESESEVIETILDMVKNAKNPIIIADACASRHNVKKETEQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E+HPRFGGVYVGTLS P +K+AVESADLILSVGALLSDFNTGSFSY+
Sbjct: 241 PAFTTPMGKGSINEKHPRFGGVYVGTLSRPEIKQAVESADLILSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKNIVEFHSD++KIKNATF GVQMKF L+KL+  + +                     
Sbjct: 301 YQTKNIVEFHSDHMKIKNATFQGVQMKFVLEKLIAKIGDYIKDYKPVAVPAAVPANKPVP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQ+G FLQEGD+V+TETGTSAFGINQT FP +TYGISQVLWGSIGFT G
Sbjct: 361 AETPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
             LGAAFAAEE++P KR ILFIGDGSLQLTVQEIST++RWNLKPYLFVLNNNGYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPDKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTAQYNEIQ W+HL +LPTFGAKDYE  RVATTGEW KLT +K FN+NS+IR+IEIML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEAVRVATTGEWDKLTTDKAFNKNSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQD 564
           PVMDAPSNLVAQAQLTA INAKQD
Sbjct: 541 PVMDAPSNLVAQAQLTAAINAKQD 564

>Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON}
           YLR134W (REAL)
          Length = 563

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/563 (77%), Positives = 483/563 (85%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+V TIFGLPGDFNLSLLDKIYE  G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKG+S +ITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSALITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS NISETT+M+TDIATAP+EIDR IRTT+VTQRP YLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSTNISETTSMITDIATAPSEIDRLIRTTFVTQRPSYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L  PIDLSLK ND EAE EV++T+LELI+ +KNP+IL+DACASRH VK ET+KLID+TQF
Sbjct: 181 LNKPIDLSLKPNDPEAEKEVIDTVLELIQKSKNPIILSDACASRHHVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPR+GGVYVGTLS P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDYIK+KNATFPGVQMKFALQKLL  +                       
Sbjct: 301 YKTKNVVEFHSDYIKVKNATFPGVQMKFALQKLLSVIPSVIKSYKAVPVPTKTAPNKEVA 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WN++ KFLQEGDV+++ETGTSAFGINQT FP + YGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIVSETGTSAFGINQTSFPKDAYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DP +RVILFIGDGSLQLTVQEISTMVRW LKPYLFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP A+YNEIQ+WDHL+LLPTFGAK YENH+VATTGEW KLT + EF +NS IRLIE+ L
Sbjct: 481 HGPYAEYNEIQTWDHLALLPTFGAKKYENHKVATTGEWDKLTHDPEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PV DAP +L+ QA+LTA  NAKQ
Sbjct: 541 PVFDAPESLIKQAELTAATNAKQ 563

>KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/563 (77%), Positives = 479/563 (85%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLSQVDVKTIFGLPGDFNL+LLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAE               QAKQLLLHH+LGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHSLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTA++TDIATA AEIDRCI+TTY+TQRPVYLG+PAN+ D K+PA L
Sbjct: 121 DFTVFHRMSANISETTAVLTDIATAAAEIDRCIKTTYITQRPVYLGIPANMFDFKLPAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDLSLK ND EAE EV++ IL L+K AKNPVIL+DACASRH+V+ ET++LID TQF
Sbjct: 181 LETPIDLSLKPNDPEAEDEVIDAILSLVKAAKNPVILSDACASRHNVRKETRQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPR+GGVYVGTLS P VK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRYGGVYVGTLSRPEVKKAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDY KIKNATFPGVQMKF LQKL   + +                     
Sbjct: 301 YKTKNVVEFHSDYTKIKNATFPGVQMKFVLQKLSKVIDQTVKGYKPIPVPAKVPSNKPCS 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPL QEWMWNQ  KF QEGD++ITETGT+AFGINQ+ FP +  GISQVLWGSIGFT G
Sbjct: 361 PSTPLSQEWMWNQASKFFQEGDIIITETGTAAFGINQSEFPTHAVGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+D  +RVILFIGDGSLQLTVQEISTM+RWNL+PYLFVLNNNGYTIEKLI
Sbjct: 421 AVLGAAFAAEELDINRRVILFIGDGSLQLTVQEISTMIRWNLRPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG  AQYNEIQ+W HL LL TFGAKDYENHR+ATTGEW  L  NK+FN+NSRIRLIEIML
Sbjct: 481 HGENAQYNEIQNWKHLKLLETFGAKDYENHRIATTGEWDALLSNKDFNKNSRIRLIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PVMDAPSNLV QA++TA  NA+Q
Sbjct: 541 PVMDAPSNLVQQAKITAATNAQQ 563

>AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR087C (PDC6) and
           YLR134W (PDC5)
          Length = 563

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/562 (77%), Positives = 481/562 (85%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+V+TIFG+PGDFNLSLLDK+YE  GMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+K +SC++TTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANIS+TTA++TDI++APAEIDRCIR  YV QRPVYLGLPAN+VDL VPASL
Sbjct: 121 DFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPVYLGLPANMVDLTVPASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L T IDLSLK ND EAE EVV+T+LEL+ +AK+PVIL+DACASRHDVK ETK+LID+TQF
Sbjct: 181 LNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACASRHDVKQETKQLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPRFGGVYVGTLS+P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+ KI++ATFPG++MK  LQ L+  + E                     
Sbjct: 301 YKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEAAKGYQPSPVPTYAAPNEDAD 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQV  FL+EGD+VITETGT+AFGINQT FP++T GISQVLWGSIGFTTG
Sbjct: 361 PKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTRFPSSTIGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           ACLGAAFAAEE+DP KRVILFIGDGSLQLTVQEISTMVRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG TAQYN IQ W HL LLPTFGAKDYE HRVATTGEW  LTE +EFN+NS IR+IEIML
Sbjct: 481 HGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGEWRALTEKQEFNKNSSIRMIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAK 562
            VMDAPS+L+ QA+LTA  NA+
Sbjct: 541 DVMDAPSSLIKQAKLTAATNAQ 562

>YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}
           PDC6Minor isoform of pyruvate decarboxylase,
           decarboxylates pyruvate to acetaldehyde, involved in
           amino acid catabolism; transcription is glucose- and
           ethanol-dependent, and is strongly induced during sulfur
           limitation
          Length = 563

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/563 (76%), Positives = 482/563 (85%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V TIFGLPGDFNLSLLDKIYE  G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKG+S ++TTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETT+M+TDIATAP+EIDR IRTT++TQRP YLGLPANLVDLKVP SL
Sbjct: 121 DFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LE PIDLSLK ND EAE EV++T+LELI+++KNPVIL+DACASRH+VK ET+KLID+TQF
Sbjct: 181 LEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPR+GGVYVGTLS   VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDY+K+KNATF GVQMKFALQ LL  + +                     
Sbjct: 301 YKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WN++ KFLQEGDV+I+ETGTSAFGINQT FP + YGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DP KRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP A+YNEIQ+WDHL+LLP FGAK YENH++ATTGEW  LT + EF +NS IRLIE+ L
Sbjct: 481 HGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PV DAP +L+ QAQLTA  NAKQ
Sbjct: 541 PVFDAPESLIKQAQLTAATNAKQ 563

>SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAE9 Saccharomyces kluyveri PDC13 Pyruvate
           decarboxylase
          Length = 564

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/563 (75%), Positives = 479/563 (85%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV V+TIFGLPGDFNLSLLDKIYE PG+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KGMSCI+TTFGVGELSALNGIAGSYAE               QA+QLLLHHTLGNG
Sbjct: 61  YARVKGMSCIVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAQQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+ ISETTA++TDI  AP EIDRCI+ TY  QRPVYLGLPANLVDLKV ASL
Sbjct: 121 DFTVFHRMSSEISETTAVITDIKDAPKEIDRCIKVTYSKQRPVYLGLPANLVDLKVSASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLS+  ND +AE EVV T+L ++  AKNPVILADAC +RHDVK ETKKLID+TQF
Sbjct: 181 LDTPIDLSMTPNDADAEDEVVETVLAMVSKAKNPVILADACCTRHDVKRETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE HPRFGGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEDHPRFGGVYVGTLSDPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDY K++NATFPGVQMK  LQKLL  V++                     
Sbjct: 301 YKTKNIVEFHSDYTKVRNATFPGVQMKLVLQKLLSKVSDAASGYKPVPVPKGTRSNPGVE 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEW+WN +  +L+EGDVVITETGTSAFGINQ+ FPN+TYGISQVLWGSIG++ G
Sbjct: 361 SSTPLKQEWIWNHISDWLEEGDVVITETGTSAFGINQSRFPNSTYGISQVLWGSIGYSVG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           +CLGAAFAAEE+D  +RVILF+GDGSLQLTVQEISTMVRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 SCLGAAFAAEELDKNRRVILFVGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HG TAQYN++Q W HL+LLPTFGAKDY++ R++TTGE++KLTE++ F++NS+IRLIE+ML
Sbjct: 481 HGETAQYNDVQPWLHLNLLPTFGAKDYDSIRISTTGEFLKLTEDQAFSRNSKIRLIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PVMDAPS LV QAQLTA  NAKQ
Sbjct: 541 PVMDAPSTLVKQAQLTAATNAKQ 563

>KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {ON}
           Anc_5.122 YLR044C
          Length = 563

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/563 (76%), Positives = 477/563 (84%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QVDVKTIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAE               QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDL+LK ND EAE EV+ T+LELI++A NPVILADACA RHDVK ET KLID+TQF
Sbjct: 181 LETPIDLTLKPNDQEAENEVIETVLELIEEASNPVILADACAGRHDVKVETNKLIDMTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS+  V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDYIKI+NATFPGVQMKF L KLL  V                       
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             T L+QEWMWN+V KF ++GD+++TETGT+AFGINQ+ FPNNT GISQVLWGSIGFT G
Sbjct: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGA+FAAEE+DP KRVILFIGDGSLQLTVQEIST++RW+LKPYLFVLNNNGYTIE+LI
Sbjct: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP A YN IQ W H  LL  FGA DYEN ++ TTGEW  LT++K+FN+ S+IR+IE+ML
Sbjct: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PVMDAPSNL+AQA+LTA IN+K+
Sbjct: 541 PVMDAPSNLIAQAKLTACINSKK 563

>TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {ON}
           Anc_2.390 YDL080C
          Length = 563

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/563 (74%), Positives = 478/563 (84%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MS++TLGRYLFERL+Q+ ++TIFGLPGDFNL LLDKIYE PGMRW GNANELNAAYAADG
Sbjct: 1   MSQVTLGRYLFERLNQIKIQTIFGLPGDFNLPLLDKIYEIPGMRWVGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAE               QAK+LLLHHTLG+G
Sbjct: 61  YARIKGMSCMITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLEAQAKKLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF  F+RMS+ ISET  M+ D+ TAPAEIDRCI+T YV QRPVYLGLP NLV+  VP SL
Sbjct: 121 DFNAFYRMSSEISETAVMIKDVTTAPAEIDRCIKTAYVMQRPVYLGLPVNLVNAMVPVSL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLSL+ ND ++E+EV+ TILE++K AKNP+I+ADACASRHDVKAET+KLIDITQF
Sbjct: 181 LQTPIDLSLRPNDADSESEVIQTILEMVKQAKNPIIIADACASRHDVKAETEKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSI+EQHPRFGGVYVGTL+ P VK+AVESADLILS+GALLSDFNTGSFSY+
Sbjct: 241 PSFVTPMGKGSINEQHPRFGGVYVGTLTRPEVKKAVESADLILSIGALLSDFNTGSFSYN 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKN++EFHSD+ KIKNA + G+QMKF L KL+  + E                     
Sbjct: 301 YETKNVIEFHSDHTKIKNAVYEGIQMKFVLSKLITKIGEVVKNYKPVAVPAPILANPKTS 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPL+QEW+WNQ+G FLQEGD+V+TETGTSAFGINQT+FP NTYGISQVLWGSIGFT G
Sbjct: 361 PETPLRQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTYFPKNTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
             LGAAFAAEE+DPKKRV+LFIGDGSLQLTVQEISTMV WNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEIDPKKRVVLFIGDGSLQLTVQEISTMVNWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTAQYNEIQ W++L LL TFGAKDY+  RVATTGEW  LT+N EFNQNS+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQPWNNLELLSTFGAKDYQAVRVATTGEWNILTQNPEFNQNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           P MDAPSNL++QA+LTA INAKQ
Sbjct: 541 PTMDAPSNLISQAELTASINAKQ 563

>KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {ON}
           
          Length = 564

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/564 (74%), Positives = 475/564 (84%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MS ++LG YLFERL QV V TIFGLPGDFNL LLDKIY+ PGMRW GNANELNA+YAADG
Sbjct: 1   MSTVSLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDIPGMRWVGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGM+C++TTFGVGELSALNGIAGSYAE               QAK LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTLSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMSA ISETTA++TD++ A +EIDRCIRTTYV QR VYLG+PAN+ D ++P SL
Sbjct: 121 DFDVFHRMSAEISETTAVITDLSKAASEIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLSLKAN+ E+E+EV++TIL+L+  AKNP+ILADACASRHDVK ET++LID TQF
Sbjct: 181 LDTPIDLSLKANNPESESEVLDTILDLVSKAKNPIILADACASRHDVKKETQQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE HPR+GG+YVGTLSSPAVK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDETHPRYGGIYVGTLSSPAVKKAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKNIVEFHSD+IKI+NA FP +QMK  LQKL+  +                       
Sbjct: 301 YQTKNIVEFHSDHIKIRNALFPDMQMKSILQKLITQIKPVIANYSPVAVPARAPANAAVD 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPLKQEWMW ++G FLQEGD+VITETGTSAFGIN T FP NT GISQVLWGSIGFT G
Sbjct: 361 PSTPLKQEWMWKELGNFLQEGDIVITETGTSAFGINGTTFPKNTVGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAAFAAEE+DP +RVILFIGDGSLQLTVQEIST ++WNLKPYLF+LNNNGYTIEKLI
Sbjct: 421 AVLGAAFAAEEIDPNRRVILFIGDGSLQLTVQEISTCIKWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTAQYNEIQSW+HL LLPTFGAKDYE  R+AT GEW KLT++KEFN+NSRIRLIE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLQLLPTFGAKDYEAVRIATVGEWNKLTQDKEFNKNSRIRLIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQD 564
           PVMDAP +L+ Q QLTA INAK+D
Sbjct: 541 PVMDAPESLIKQGQLTAAINAKKD 564

>TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/563 (74%), Positives = 469/563 (83%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V TIFGLPGDFNL+LLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAE               QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTTSQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMS  ISETTAM+TD++ A ++ID CIR TY TQRPVYLG+PAN+ D  +PA L
Sbjct: 121 DFDVFHRMSTEISETTAMITDLSKAASQIDNCIRVTYTTQRPVYLGIPANMFDFTLPAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPI++ L  N+ E+E EVV TIL ++K AKNPVI+ADAC SRH+VKAET+KLID TQF
Sbjct: 181 LETPINMKLSPNNQESEDEVVETILRMVKGAKNPVIIADACCSRHNVKAETEKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E HPRFGGVYVGTL+ P VK+AVESADLILSVGALLSDFNTG+FSY 
Sbjct: 241 PAFTTPMGKGSINEHHPRFGGVYVGTLTRPEVKKAVESADLILSVGALLSDFNTGTFSYD 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKNIVEFHSD+IKIKNATF GVQMKF L +L+  + +                     
Sbjct: 301 YETKNIVEFHSDHIKIKNATFQGVQMKFVLDRLIKEIGDYVKDYKPVPVPAGIPDNKPCP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPL+QEW+WNQ+G FLQEGD+V+TETGTSAFGIN T FP NTYGI+QVLWGSIGFT G
Sbjct: 361 DETPLQQEWLWNQLGNFLQEGDIVLTETGTSAFGINHTKFPKNTYGINQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
             LGAAFAAEE+DPKKRV LFIGDGSLQLTVQEISTM+RWNLKPYLFVLNNNGYTIEKLI
Sbjct: 421 CVLGAAFAAEEIDPKKRVHLFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTAQYNEIQ WDHLS+LPTFGA DYE  RVAT GEW KLT + +FN+NS+IR+IEIML
Sbjct: 481 HGPTAQYNEIQGWDHLSILPTFGATDYEAIRVATIGEWNKLTTDDKFNKNSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PVMDAPSNL+AQ +LT  INA Q
Sbjct: 541 PVMDAPSNLIAQGKLTEAINAAQ 563

>NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/564 (74%), Positives = 467/564 (82%), Gaps = 2/564 (0%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MS I+LGRYLFERL QV V TIFGLPGDFNL+LLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSTISLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KGM+C++TTFGVGELSALNGIAGSYAE               QAK LLLHHTLGNG
Sbjct: 61  YARVKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKNLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETT++VTD+A APAEIDRCIR TY+ QRPVYLG+PAN  DL + A L
Sbjct: 121 DFTVFHRMSSNISETTSIVTDVAQAPAEIDRCIRETYIKQRPVYLGIPANFFDLPISAKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L TPIDLSL  ND EAETE ++ +L L+KDA NP+IL DACASRHDVK ETKKLIDITQ+
Sbjct: 181 LNTPIDLSLHENDEEAETEAIDLVLGLVKDAVNPIILVDACASRHDVKEETKKLIDITQY 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+EQHPR+GGVYVG L+ PA+KEAVESADLILSVGALLSDFNTGSFSY 
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGNLTDPAIKEAVESADLILSVGALLSDFNTGSFSYG 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
            KTKN+VEFHSDY+KI+NA+FPGVQMKF LQKL   +                       
Sbjct: 301 LKTKNVVEFHSDYVKIRNASFPGVQMKFVLQKLNRQLPPYTKNYKPVPVPTKTASNKNVA 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TP+KQEWMWNQ+ KFLQEGD+VI+ETGTS FGINQT FPNNT GISQVLWGSIGF TG
Sbjct: 361 ASTPMKQEWMWNQLAKFLQEGDIVISETGTSGFGINQTSFPNNTTGISQVLWGSIGFATG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
             LGA  AAEE+DPKKRVILF GDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI
Sbjct: 421 CTLGATMAAEEIDPKKRVILFTGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKD--YENHRVATTGEWIKLTENKEFNQNSRIRLIEI 538
           HG  A YNEIQ W+HL L   FGAK+  +ENHRV+TTGEW KLTE+K+F  N++IR+IE+
Sbjct: 481 HGEHAGYNEIQPWNHLELFHAFGAKEGTFENHRVSTTGEWNKLTESKQFQDNTKIRMIEV 540

Query: 539 MLPVMDAPSNLVAQAQLTAKINAK 562
           MLPVMDAP++L+ QA+LTA INAK
Sbjct: 541 MLPVMDAPTSLIKQAKLTASINAK 564

>NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/563 (73%), Positives = 464/563 (82%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV V TIFGLPGDFNL+LLDK+YE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKVYEVAGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAE               QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTTSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETTAM+TDI  APAEIDRCIRTTY+ QRPVYLG+PAN  DLKVPA+L
Sbjct: 121 DFTVFHRMSSNISETTAMLTDITAAPAEIDRCIRTTYIAQRPVYLGIPANFFDLKVPANL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L TPIDLSL  N+ EAE E +  +LEL+K +KNP+I+ DACASRHDVKAET KLI++TQF
Sbjct: 181 LNTPIDLSLHENEPEAEKEALGMVLELVKKSKNPIIVVDACASRHDVKAETNKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+EQHPR+GGVYVGTLS P VKEAVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGTLSRPEVKEAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y TK++VEFHSDY++IK ATFPGVQMKF L KL   +                       
Sbjct: 301 YDTKSVVEFHSDYVRIKKATFPGVQMKFLLDKLNYIIPNYVQSYKPRPVPTRVPDNAPIG 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             T LKQ W+WNQ+ KFL+EGD+VI ETGTS FGIN+T FP N   ISQVLWGSIGF TG
Sbjct: 361 PSTSLKQAWLWNQLSKFLKEGDIVIVETGTSGFGINETTFPKNVTCISQVLWGSIGFATG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
             LGA  AAEE+DPK+RVILF GDGSLQLTVQEISTM+RWNLKPYLFVLNN GYTIEKLI
Sbjct: 421 CTLGATMAAEELDPKRRVILFTGDGSLQLTVQEISTMIRWNLKPYLFVLNNKGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTA YNEIQ W+HL LL TFGAKDYEN+RV+TTG W ++T +K+FN+NS+IR+IE+ML
Sbjct: 481 HGPTAAYNEIQHWEHLKLLETFGAKDYENYRVSTTGAWNEMTGDKKFNENSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           PVMDAP +L+ Q +LTA+IN+K 
Sbjct: 541 PVMDAPESLIKQGELTAQINSKH 563

>KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/562 (72%), Positives = 455/562 (80%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MS ITLGRYLFERL QV+  TIFGLPGDFNL LLD+IYE  GMRWAGN NELNAAYAADG
Sbjct: 1   MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KG++C+ITTFGVGELSALNG+ GSYAE               QAKQ LLHHTLG+G
Sbjct: 61  YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMSANIS+TTAMVTD+ATAP EIDRCIRTTYVTQRPVYLGLPAN+V+  V   L
Sbjct: 121 DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLSL+ ND + E EV+  +L L++ A+NP+ILADAC SRHD K E  +L D TQF
Sbjct: 181 LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGS+ E+HPRFGGVYVGTLSSP VK AVE+ADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y T+N+VEFHSD+ K++NA FP V MKF LQKL+  +                       
Sbjct: 301 YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPL QEW+W Q+G+FL+EGDVV+TETGTSAFGINQT FPNNTYGISQVLWGSIGFTTG
Sbjct: 361 RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           A LGAA AAEE+D  KRVILFIGDGSLQLTVQEIS+MVRW L+PYLFV NN+GYTIEKLI
Sbjct: 421 ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGPTAQYNEIQ+W HL LLPTFGA DYE  RVATTGEW  LT +  FN+NSRIRL+E+ML
Sbjct: 481 HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML 540

Query: 541 PVMDAPSNLVAQAQLTAKINAK 562
            VMDAPS+LV QAQLTA  NA+
Sbjct: 541 EVMDAPSSLVRQAQLTAATNAQ 562

>NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON} 
          Length = 521

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/521 (76%), Positives = 435/521 (83%)

Query: 43  MRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXX 102
           MRWAGNANELNAAYAADGYAR+KGMSCIITTFGVGELSALNGIAGSYAE           
Sbjct: 1   MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGTP 60

Query: 103 XXXXQAKQLLLHHTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRP 162
               QAK LLLHHTLGNGDFTVFHRMS+N+SETTAM+TD+ TAPAEIDRCIRTTY+ QRP
Sbjct: 61  STTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTTAPAEIDRCIRTTYIAQRP 120

Query: 163 VYLGLPANLVDLKVPASLLETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACA 222
           VYLG+PAN  DLKVPA+LL TPIDL L  N+ EAE E ++ ILELIKD+KNP IL DACA
Sbjct: 121 VYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALDMILELIKDSKNPAILVDACA 180

Query: 223 SRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLI 282
           SRHDVKAET KLI++TQFP FVTPMGKG+I+EQHPR+GGVYVGTLS P VK+AVESADLI
Sbjct: 181 SRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYGGVYVGTLSKPEVKKAVESADLI 240

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXX 342
           LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKI+NATFPGVQMKF L KL   + E   
Sbjct: 241 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLDKLNAIIPEVVT 300

Query: 343 XXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPN 402
                               TPLKQ WMWNQ+ KFL+EGDVVI ETGT  FGIN+T FP 
Sbjct: 301 GYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSKFLKEGDVVIVETGTPGFGINETTFPK 360

Query: 403 NTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNL 462
           N  GISQVLWGSIG+ TG  LGA  AAEE+DP KRVILF GDGSLQLTVQEISTM+RWNL
Sbjct: 361 NVIGISQVLWGSIGYATGCTLGATMAAEELDPHKRVILFTGDGSLQLTVQEISTMIRWNL 420

Query: 463 KPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLT 522
           +PYLF+LNNNGYTIEKLIHGPTAQYNEIQSWDHL LL TFGAKDYENHRVATTGEW KLT
Sbjct: 421 RPYLFILNNNGYTIEKLIHGPTAQYNEIQSWDHLKLLETFGAKDYENHRVATTGEWTKLT 480

Query: 523 ENKEFNQNSRIRLIEIMLPVMDAPSNLVAQAQLTAKINAKQ 563
           ENK+FN+NSRIR+IE+MLPVMDAP +L+ Q +LTAKINAK 
Sbjct: 481 ENKDFNKNSRIRVIEVMLPVMDAPESLIKQGELTAKINAKN 521

>KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {ON}
           
          Length = 565

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/562 (73%), Positives = 468/562 (83%), Gaps = 1/562 (0%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MS I+LG YLFERL QV V TIFGLPGDFNL LLDKIY+ PG+RWAGNANELNAAYAADG
Sbjct: 1   MSTISLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDVPGIRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YARIKGM+C++TTFGVGELSALNGIAGSYAE               QA  LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTHSQANGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMSA ISETT M+TD   A  +IDRCIRTTYV QR VYLG+PAN+ D ++P SL
Sbjct: 121 DFDVFHRMSAQISETTEMITDPHKAADQIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDLSLKAN+  +E +V++TIL+ +KDAKNP+I++DACASRHDVK ET++LI+ITQF
Sbjct: 181 LDTPIDLSLKANNPTSERQVLDTILQSVKDAKNPIIISDACASRHDVKEETQQLINITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDE HPR+GG+YVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDETHPRYGGIYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKN+VEFHSD++KIKNA FPGVQM+  L+KLL  +                       
Sbjct: 301 YETKNVVEFHSDHMKIKNAVFPGVQMEPLLRKLLKEIPAVVKGYNPVAVPAKIPANDKSI 360

Query: 361 XXT-PLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTT 419
             T PL+QEWMWNQ+ +FLQEGD++ITETGTSAFGIN T FP N  GISQVLWGSIGFT 
Sbjct: 361 SATAPLRQEWMWNQLSEFLQEGDIIITETGTSAFGINGTTFPKNAVGISQVLWGSIGFTV 420

Query: 420 GACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKL 479
           GA LGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM++WNLKPYLF+LNNNGYTIEKL
Sbjct: 421 GALLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIKWNLKPYLFILNNNGYTIEKL 480

Query: 480 IHGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIM 539
           IHGPTA+YNEIQSWDHL LLPT GAKDYE  RVAT GEW KLT++KEFN+NSRIR+IE+M
Sbjct: 481 IHGPTAEYNEIQSWDHLKLLPTLGAKDYEAVRVATVGEWNKLTQDKEFNKNSRIRVIEVM 540

Query: 540 LPVMDAPSNLVAQAQLTAKINA 561
           LPVMDAP +L+ Q +LT KINA
Sbjct: 541 LPVMDAPQSLIEQGKLTEKINA 562

>CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
           cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
           cerevisiae YGR087c PDC6
          Length = 564

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/563 (68%), Positives = 447/563 (79%), Gaps = 1/563 (0%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           M+EITLGRYLFERL Q+ + TIFGLPGDFNL+LLDKIYE  G+RWAGNANELNAAYAADG
Sbjct: 1   MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+KGM+C++TTFGVGELSALNGIAGSYAE               +AKQLLLHHTLGNG
Sbjct: 61  YARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTVSRAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF  FHRMS+ ISETT +V+D  TAPAEIDRCIR  Y+TQRPVYLG+PAN+ D KV + L
Sbjct: 121 DFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQRPVYLGIPANMFDSKVSSKL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           L+TPIDL+L+ N  +AE EV++ I+ +IK +K P+ILADAC SRHDVK ETK+LI++TQF
Sbjct: 181 LDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILADACTSRHDVKKETKRLIEVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSIDE  PRFGGVYVG LS P VK  VE +DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFVEESDLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSV-AEXXXXXXXXXXXXXXXXXXXX 359
             T+N++EFHSD++KI+NATFPGVQMKF L+KLL  + A                     
Sbjct: 301 LNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLLEELPAVVKGRTDNRVVPRQKEPSTTL 360

Query: 360 XXXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTT 419
                +KQEWMW  VGKFLQEGDVV+TETGTS FGI ++ FP NT GISQVLWGSIG+  
Sbjct: 361 NGKDAIKQEWMWKHVGKFLQEGDVVVTETGTSGFGIVESKFPRNTVGISQVLWGSIGYAL 420

Query: 420 GACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKL 479
           G+ +GAAFAA+E+DPKKRVILFIGDGSLQLTVQE+ST  RW L PY+FVLNNNGYTIE+L
Sbjct: 421 GSTVGAAFAAQEIDPKKRVILFIGDGSLQLTVQELSTAARWGLTPYIFVLNNNGYTIERL 480

Query: 480 IHGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIM 539
           IHG T  YN+IQSWDH  +LP FGAK+YEN RVAT GEW  +  +K+FN+N ++R+IE+M
Sbjct: 481 IHGETQGYNDIQSWDHSLILPAFGAKNYENKRVATYGEWNDMVNDKQFNKNDKLRMIEVM 540

Query: 540 LPVMDAPSNLVAQAQLTAKINAK 562
           LP MD P NL  QA+LTA INAK
Sbjct: 541 LPTMDGPENLKKQAKLTASINAK 563

>Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AAL073W
          Length = 563

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/563 (63%), Positives = 442/563 (78%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           MSEI++GRYLFERL+QV VKTIFGLPGDFNLSLLDK+YE PG+RWAGNANELNAAYAADG
Sbjct: 1   MSEISIGRYLFERLNQVGVKTIFGLPGDFNLSLLDKLYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNG 120
           YAR+ GM C++TTFGVGELSA+NGIAGSYAE               QAK+LLLHHTLG+G
Sbjct: 61  YARVNGMGCLVTTFGVGELSAINGIAGSYAECISVLHVVGVPSTMVQAKRLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFT FHRM   I++TTA+++D ATA +EIDRCI+T  +T  PVYLG+PAN+    + ASL
Sbjct: 121 DFTAFHRMYQRITKTTAILSDDATAASEIDRCIKTCIMTHGPVYLGVPANMATATIDASL 180

Query: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           LETPIDLS + ND +AE EV++ +L LI++A+NP+IL+DACASR+D+K E K LIDITQF
Sbjct: 181 LETPIDLSPELNDQDAENEVIDAVLHLIQNARNPIILSDACASRYDIKEEIKTLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P++VTPMGK S++EQHPR+GGVY G++S P VK+AVESADLILS+G+LL+D NTG+FS S
Sbjct: 241 PTYVTPMGKSSVNEQHPRYGGVYAGSISKPEVKKAVESADLILSIGSLLADMNTGNFSQS 300

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX 360
           Y TK+IVEFHS +  IKNATF GVQMKF LQKL   V +                     
Sbjct: 301 YSTKDIVEFHSTFTMIKNATFNGVQMKFVLQKLAEKVGDVVQNYVPVPIASKPSPNKPLD 360

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
             TPL Q+W+W +V  FL+EGD+VI E+GT AFGIN+   P  T  ISQ+LWGSIG+T G
Sbjct: 361 PLTPLAQQWLWKEVSTFLKEGDIVIAESGTPAFGINEVTLPTGTRCISQLLWGSIGYTVG 420

Query: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480
           ACLG   A +E+DP +RVILFIGDGSLQL VQE+STM+RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGICLATQEIDPSRRVILFIGDGSLQLAVQELSTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540
           HGP AQYN+IQ W+HL LLP FGAK+YE  R++T G W +LT++ EFN++S+IRLIE++L
Sbjct: 481 HGPEAQYNDIQPWNHLQLLPDFGAKNYEAVRISTVGGWSQLTQDPEFNESSKIRLIELIL 540

Query: 541 PVMDAPSNLVAQAQLTAKINAKQ 563
           P +D+   LV QA++   IN+K+
Sbjct: 541 PRLDSTDALVKQAKMITDINSKR 563

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/548 (59%), Positives = 421/548 (76%), Gaps = 1/548 (0%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           I+LG YLF+RL Q+ V+TIFGLPGDFN++LLDKIYE PG+RWAGN NELNAAYAADGYAR
Sbjct: 14  ISLGHYLFQRLRQLQVQTIFGLPGDFNMALLDKIYEVPGLRWAGNTNELNAAYAADGYAR 73

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFT 123
           IKG+ C++TTFGVGELSA+NGIAGS+AE               Q K+LLLHHTLGNGD+ 
Sbjct: 74  IKGLGCLVTTFGVGELSAINGIAGSFAEHVAVLHVVGMPASHAQVKKLLLHHTLGNGDYA 133

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLET 183
           VFHRM+AN++  T +++D  TA  EID+C++  +  QRPVYLG+P NL ++ V  S+L+ 
Sbjct: 134 VFHRMAANMAAYTTVLSDSETATKEIDKCLKIAWKRQRPVYLGIPMNLANMIVDGSMLQI 193

Query: 184 PIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 243
           P+DLSLK ND E E +VVN+I++ +K AKNPVI+ADAC +RHDV  ET++L+D+TQFP F
Sbjct: 194 PLDLSLKRNDPEVEKDVVNSIVQEMKRAKNPVIIADACVTRHDVIQETRRLVDLTQFPVF 253

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+IDEQHPRFGGVYVG++SSP V+E V+ AD IL  G +LSDFNT SF++SYK 
Sbjct: 254 VTPMGKGAIDEQHPRFGGVYVGSMSSPEVREVVDFADFILVAGTVLSDFNTSSFNFSYKA 313

Query: 304 KNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXT 363
           KN+V  ++++ K+KNA +P +++KF LQ LL S++                         
Sbjct: 314 KNVVLLYANHAKLKNAMYPDMKLKFVLQSLLQSLSNITLPYKPQPVPEMIKPRVTLQDNV 373

Query: 364 PLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACL 423
           PL+QEW+WNQ+  +  EGD+VITETGTSAFGINQT FPNNT  ISQVLWGSIG++ GACL
Sbjct: 374 PLRQEWVWNQISHWFHEGDIVITETGTSAFGINQTRFPNNTRAISQVLWGSIGYSLGACL 433

Query: 424 GAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIH-G 482
           GA+FA EE+  K RVILF+GDG+LQLTVQEISTM+RW LKPYLFV+NN GYTI++L+H  
Sbjct: 434 GASFAVEELGTKNRVILFVGDGALQLTVQEISTMIRWGLKPYLFVMNNKGYTIDRLLHKS 493

Query: 483 PTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIMLPV 542
            TA Y++IQ WD+L LLP FGA +Y+  +V T G+++KL  + +F  + ++++IE++LP 
Sbjct: 494 STAGYHDIQPWDNLKLLPAFGAVNYDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVLPS 553

Query: 543 MDAPSNLV 550
           MDAP  L+
Sbjct: 554 MDAPPALL 561

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/549 (50%), Positives = 388/549 (70%), Gaps = 1/549 (0%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYA 62
           EI L +Y+  RL Q+ + TIFG+PG FN+ LL +I   P M+WAGN NELNAAYAADGY+
Sbjct: 14  EIPLAQYMLHRLRQLGIATIFGVPGGFNVPLLREICNVPQMKWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
           RIK ++C++TTFGVGELSA+NG+AGS+AE               Q ++LLLHHTLGNG++
Sbjct: 74  RIKHLACLVTTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGNY 133

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLE 182
            VFHR+ +++++ T+++TD  T   E+D+CI   +  QRPVYLG+P N+ D  V ++LL 
Sbjct: 134 KVFHRLGSDVTQYTSVLTDTETCSKEVDKCISIAFTKQRPVYLGVPTNISDTLVSSALLN 193

Query: 183 TPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 242
            P+DLS    + E + + VN IL  +   ++P I+ DAC SRH+V AE ++L+++TQFP 
Sbjct: 194 IPLDLSAHEGNTEVQEDFVNAILSAMYKCRSPAIVVDACVSRHNVVAEVRQLVELTQFPV 253

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKG+I+E HPRFGG +VG++S P V+E V+ +D +L VGALLSDFN+ SF ++YK
Sbjct: 254 FCTPMGKGAINEHHPRFGGTFVGSISPPQVREVVDFSDFVLVVGALLSDFNSSSFHFAYK 313

Query: 303 TKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXX 362
            KN     S Y ++KNA +P +++K AL+ LL  +                         
Sbjct: 314 AKNTALLFSSYARLKNAMYPDLELKTALRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMSN 373

Query: 363 TPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGAC 422
            PL+QEW+WNQ+  + +EGD+VITETGTSAFG+NQ+ FPNNT  I+Q LWGS+G++ GAC
Sbjct: 374 VPLRQEWVWNQISNWFREGDIVITETGTSAFGVNQSKFPNNTRCITQALWGSVGYSVGAC 433

Query: 423 LGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHG 482
           LGA+FAA E     RVILF+GDG+LQLTVQE+STM+RW LKP +FV+NN+GYTI++L+H 
Sbjct: 434 LGASFAAREEGNNSRVILFVGDGALQLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLHR 493

Query: 483 PT-AQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIMLP 541
            + A Y++IQ+WD+L LLP FGA DY+   V T G+++ L  +  F  N++I+++E++LP
Sbjct: 494 KSNAGYHDIQAWDNLKLLPLFGALDYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVLP 553

Query: 542 VMDAPSNLV 550
            MDAP  L+
Sbjct: 554 PMDAPPALM 562

>Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080C
           (THI3) - alpha-ketoisocaproate decarboxylase [contig
           204] FULL
          Length = 610

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/549 (50%), Positives = 384/549 (69%), Gaps = 1/549 (0%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYA 62
           +ITL ++L  RL Q+ + TIF +PG F++  + +IY+TP M+WAGN NELNAAYAADGY+
Sbjct: 14  DITLAQFLVHRLRQLGITTIFAVPGGFSMPFIMQIYQTPQMQWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
           RIK + C+ TTFGVGELSA+NG+AG++AE               Q KQLL HHTLGNGD+
Sbjct: 74  RIKRLGCLATTFGVGELSAVNGVAGAFAEHVGLLHVVGMPPVAAQVKQLLWHHTLGNGDY 133

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLE 182
            VFHR+ +++++   ++ D      E+D+CI      QRPVYLG+P N+ ++ V + LL 
Sbjct: 134 QVFHRLGSDVAQYATVLRDAEACAQEVDKCIIIALTKQRPVYLGVPVNMNNVLVSSVLLN 193

Query: 183 TPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 242
            P+DL   A + + E   VNT+L  I    NP I+ADAC SRH+V+AE K L+D+TQFP 
Sbjct: 194 VPLDLEPHATNPDTERRFVNTVLNAIYKCSNPAIIADACVSRHEVEAELKHLVDLTQFPV 253

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKGSIDEQHPRFGG +VG++SSP V+E V+ +D +L VGALLS+FNT SF ++Y+
Sbjct: 254 FCTPMGKGSIDEQHPRFGGTFVGSISSPQVREVVDFSDFVLVVGALLSEFNTSSFHFAYR 313

Query: 303 TKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXX 362
           TKN V   SDY K+KNA +P + +K  L+ +L  +                         
Sbjct: 314 TKNSVLLFSDYAKLKNAIYPDLNLKTVLRAILAKLDPSKITYRPEQVPDVIKPRIKLMSN 373

Query: 363 TPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGAC 422
            PL+QEW+W Q+ ++ +EGD+VITETGTSAFG+NQ  FP++T  I+Q LWGS+G++ GAC
Sbjct: 374 VPLRQEWVWGQISRWFREGDIVITETGTSAFGVNQAKFPSHTRCIAQALWGSVGYSVGAC 433

Query: 423 LGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHG 482
           LGA+FAA E     RVILF+GDG+LQLTVQEISTM+RW L P +F++NN+GYTI++L+H 
Sbjct: 434 LGASFAAREEGCNSRVILFVGDGALQLTVQEISTMIRWGLTPIIFLMNNSGYTIDRLLHK 493

Query: 483 PT-AQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIMLP 541
            + A Y++IQ+WD+L +LPTFGA +YE   V T G+++ L  + +F  N +I+++E++LP
Sbjct: 494 KSNAAYHDIQTWDNLRILPTFGALNYEARAVRTVGDFLHLIHDTQFAVNDKIKMVEVVLP 553

Query: 542 VMDAPSNLV 550
            MDAP  L+
Sbjct: 554 PMDAPPALM 562

>ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {ON}
           similar to uniprot|Q07471 Saccharomyces cerevisiae
           YDL080C THI3 Probable decarboxylase required for
           expression of enzymes involved in thiamine biosynthesis
           may have a role in catabolism of amino acids to
           long-chain and complex alcohols
          Length = 584

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/546 (50%), Positives = 377/546 (69%), Gaps = 1/546 (0%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           IT+  Y F RL Q++V TIFGLPG+FN  L+DK+Y   G+RWAGN NELNAAYAADGYAR
Sbjct: 12  ITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKLYGIEGLRWAGNTNELNAAYAADGYAR 71

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFT 123
           +KG+ CII+TFGVGELSA+NGIAGSYAE               Q +QLLLHHTLGNGD+T
Sbjct: 72  LKGLGCIISTFGVGELSAINGIAGSYAEHVGLLHVVGMPPTSAQTRQLLLHHTLGNGDYT 131

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLET 183
           VFHRM+  +S  +A++ D      E+D CIR  Y+ QRPVY+G+P NLV + V +  L  
Sbjct: 132 VFHRMATEVSCHSAVIIDTELCAQEVDECIRNAYIFQRPVYMGIPVNLVSMPVDSDRLNE 191

Query: 184 PIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 243
           PIDLS+  ND   E EV++ IL     A NPVI+ADAC +RH ++AET++L   T+FP F
Sbjct: 192 PIDLSVPPNDTSKENEVIDQILTHFYKATNPVIVADACVTRHRIEAETEELCRRTKFPLF 251

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGS+DE  P+FGGVY G++SSP+V+E V+ AD ++ +G +L+DF T +F ++Y+ 
Sbjct: 252 VTPMGKGSVDEGLPQFGGVYTGSISSPSVREVVDFADCLIVIGCMLADFETTTFHFNYRA 311

Query: 304 KNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXT 363
             +V  +   +K K+AT+P + +K  L  LL ++ E                        
Sbjct: 312 NELVLLYPTSVKFKHATYPDLSIKPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPTTH 371

Query: 364 PLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACL 423
           PL+QEW+WNQ+ ++  EGDV+ITETGTSAFGINQT+FP +T GISQ LWGS+G++ GACL
Sbjct: 372 PLRQEWVWNQISQWFMEGDVIITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGACL 431

Query: 424 GAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGP 483
           GAA A +E     RV+LF+GDG+ QLT QE+ST++RW L PY+F++NN GY++++ +H  
Sbjct: 432 GAAMAVDEKPRTHRVVLFVGDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLHS- 490

Query: 484 TAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIMLPVM 543
            A Y +IQ W++ +L   FGAKDYE+ ++ T G++  +  +  F+   RIR++EIMLP M
Sbjct: 491 NASYYDIQQWNYSTLPSVFGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLPPM 550

Query: 544 DAPSNL 549
           D P  L
Sbjct: 551 DVPQAL 556

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/554 (49%), Positives = 384/554 (69%), Gaps = 7/554 (1%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL+Q+++ TIFGL G+F++ LLDK+Y  P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAE               Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLET 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+L + ++ L T
Sbjct: 135 VFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 243
           P+DL L  ND + E EV++ IL  I  ++NP I+ DAC SR ++  ETK+L +  +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXT 363
           KN    +S  +K+KNAT+P + +K  LQK+L ++ E                        
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACL 423
            L+QEW+WN++  + Q GD++ITETG SAFG+NQT FP NT GISQ LWGS+G+T GACL
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEVDP------KKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIE 477
           GA FA +E++       K RVILF+GDG+ QLTVQE+ST+V+W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGPT-AQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLI 536
           + +H  + A Y +IQ W++L LL  FG  +YE  ++ T GE+  +  +  F  N +IR+I
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMI 554

Query: 537 EIMLPVMDAPSNLV 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/554 (49%), Positives = 382/554 (68%), Gaps = 7/554 (1%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL+Q+++ TIFGL G+F++ LLDK+Y+ P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAE               Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLET 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+L + +  L T
Sbjct: 135 VFHRIASDVACYTTLIVDSDLCADEVDKCIQKAWIEQRPVYMGMPVNQVNLPIESERLNT 194

Query: 184 PIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 243
           P+DL L  ND + E EV+  IL  I  +KNP I+ DAC SR ++  E K+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSFIYKSKNPAIIVDACTSRQNLIEEAKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXT 363
           KN    +S  +K+KNAT+P + +K  LQKLL ++ E                        
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKILLQKLLATLDESKLSYRPDEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACL 423
            L+QEW+WN++ ++ Q GD++ITETG SAFG+NQT FP NT GISQ LWGS+G+T GACL
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEVDP------KKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIE 477
           GA FA +E++       K RVILF+GDG+ QLTVQE+ST+V+W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGPT-AQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLI 536
           + +H  + A Y +IQ W++L LL  FG  +YE  ++ T GE+  +  +  F  N +IR+I
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMINDANFAVNDKIRMI 554

Query: 537 EIMLPVMDAPSNLV 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {ON}
           Anc_2.390 YDL080C
          Length = 606

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/567 (49%), Positives = 389/567 (68%), Gaps = 8/567 (1%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           I++  YLF RL Q+ ++TIFGLPG FN +LLDK+ E PG+RWAGN NELNAAYAADGY+R
Sbjct: 13  ISIAEYLFHRLKQLHIETIFGLPGAFNATLLDKLNEIPGLRWAGNTNELNAAYAADGYSR 72

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFT 123
           +KG+ CIITTFGVGELSA+NG+AGS+AE               Q KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGCIITTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDYK 132

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLET 183
           VFHRM++ ++  + ++ D      E+D CI   +  Q+PVY+G+P NLVD  V +  L T
Sbjct: 133 VFHRMASEVTCYSTVINDKDLCGDEVDDCIAKAWTLQKPVYMGIPVNLVDTSVNSQRLNT 192

Query: 184 PIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 243
            ++L+L +ND + E E+V  IL+ +  +KNPVI+ADAC +RH +  ET +L   T FP F
Sbjct: 193 ALNLNLPSNDEQTENELVKQILQQLYKSKNPVIIADACVTRHRIVPETVELCQRTNFPIF 252

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPM KG+IDE  P FGGV++G++SSP V+E V  AD ++ +G +LSDF+T SF ++YKT
Sbjct: 253 ATPMSKGAIDETLPNFGGVFMGSISSPEVREVVNFADFLIVIGCMLSDFSTSSFHFNYKT 312

Query: 304 KNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXT 363
           K  V  +   +K K+A +P +++K  +  LL ++ E                        
Sbjct: 313 KECVLLYPTSVKFKHAIYPDLRIKSLMANLLRNLNESKIKYQSQPTPQMIIPRSELPSRH 372

Query: 364 PLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACL 423
            L+ EW+WNQ+  + QEGD++ITETGTSAFGINQTHFP+++ GISQ LWGS+G+T GACL
Sbjct: 373 SLRHEWVWNQMSHWFQEGDIIITETGTSAFGINQTHFPHSSRGISQALWGSVGYTLGACL 432

Query: 424 GAAFAAEEVDPKK------RVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIE 477
           GA+FAA E+   +      RVILF+GDG+ QLTVQE+STM+RW L PY+FV+NN GY+++
Sbjct: 433 GASFAANEMARDQVTAVPHRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQGYSVD 492

Query: 478 KLIHGPT-AQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLI 536
           + +H  + A Y +IQ+W++L L+P FGA+ YE  ++ T G+++++  +  F  N +IR++
Sbjct: 493 RFLHHRSNASYYDIQTWEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDKIRML 552

Query: 537 EIMLPVMDAPSNLVAQAQLTAKINAKQ 563
           EIMLP MD P  L+ +  LT + N K+
Sbjct: 553 EIMLPPMDVPQALMDR-WLTEQENKKR 578

>KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/557 (49%), Positives = 375/557 (67%), Gaps = 9/557 (1%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYA 62
           +IT+  YLF RL Q+ VKTIFGLPG+FN+ LLDKIY  P MRWAGNANELNAAYAADGY+
Sbjct: 16  QITITDYLFHRLRQLKVKTIFGLPGEFNMPLLDKIYRIPDMRWAGNANELNAAYAADGYS 75

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
           RIK + C++TTFGVGELSA+NG+AGS+AE               Q KQLLLHHTLGNGD+
Sbjct: 76  RIKRLGCLVTTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDY 135

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLE 182
            VF+RM+ +++  T +V D      E+D+C+   +  Q+P YLG+P N VDL V +  L+
Sbjct: 136 NVFYRMANDVTCHTGLVADSDLCCMEVDKCVEMAWREQKPAYLGIPVNQVDLTVDSVRLD 195

Query: 183 TPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 242
           TP++L  + N+ E E +VV TIL+ +   +NP I+ DAC  RHD+  ETK+   +T FP+
Sbjct: 196 TPLNLESEPNNQEIENDVVKTILKKLYTCENPAIIVDACVIRHDLVEETKQFRQMTNFPT 255

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG++DE    FGGV+ G+LSSP+V+E V+ AD I+ +G+LL++F+T +F + YK
Sbjct: 256 FVTPMGKGAVDESLSNFGGVFTGSLSSPSVREVVDFADFIIVIGSLLAEFSTPTFHFFYK 315

Query: 303 TKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXX 362
           TKN    HS  +K+KNAT+P + +K  +Q LL  +                         
Sbjct: 316 TKNYALIHSSSVKLKNATYPDIHIKHLMQVLLSRLDTSKISCTFRNTPPINVSRPKLSGN 375

Query: 363 TPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGAC 422
             LKQEW+WN++  + Q+GD++ITE GTSAFGINQT FP  T GISQ LW S G++ GAC
Sbjct: 376 QLLKQEWVWNELSHWFQQGDIIITEIGTSAFGINQTRFPPRTKGISQALWASSGYSVGAC 435

Query: 423 LGAAFAAEEVDP--------KKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGY 474
           LGA+FAA+E+          + RV+LF+GDG+ Q+T+QEISTM+RW L PY+F+LNN GY
Sbjct: 436 LGASFAAQELQEENPGDASLQHRVLLFVGDGAFQITMQEISTMIRWKLTPYIFLLNNQGY 495

Query: 475 TIEKLIHGPT-AQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRI 533
           ++++ +H  + A Y ++Q W +L     FGA DYE  ++ T G+   +  +K F ++ +I
Sbjct: 496 SVDRFLHHRSKASYYDVQPWHYLKFFDAFGADDYETRKIVTLGDLRDVMNDKHFCKDDKI 555

Query: 534 RLIEIMLPVMDAPSNLV 550
           R++EIMLP  D P  LV
Sbjct: 556 RMLEIMLPSTDVPQVLV 572

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/554 (49%), Positives = 385/554 (69%), Gaps = 7/554 (1%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RL+Q+++ TIFGL G+F++ LLDK+Y+ P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAE               Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLET 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+L + ++ L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIKMAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 243
           P+DL L  ND + E EV+  IL ++  ++NP I+ DAC SR ++  ETK+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSIMYKSQNPAIIVDACTSRQNLIEETKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXT 363
           KN    +S  +K+KNAT+P + +K  LQKLL S+ E                        
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKLLLQKLLASLDESKLSYRPSEQPNMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACL 423
            L+QEW+WN++ ++ Q GD++ITETG SAFG+NQT FP NT GISQ LWGS+G+T GACL
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEVDP------KKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIE 477
           GA FA +E++       K RVILF+GDG+ QLTVQE+ST+V+W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGPT-AQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLI 536
           + +H  + A Y +IQ W++L LL  FG  +YE  ++ T GE+  L  +  F  N +IR+I
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCANYETKKIITVGEFRSLINDPNFAINDKIRMI 554

Query: 537 EIMLPVMDAPSNLV 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/554 (49%), Positives = 385/554 (69%), Gaps = 7/554 (1%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           I++  YLF RL+Q+++ TIFGL G+F++ LLDK+Y  P +RWAGN+NELNAAYAADGY+R
Sbjct: 15  ISISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAE               Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLET 183
           VFHR++++++  T ++ D      E+D+CIR  ++ QRPVY+G+P N V+L + ++ L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIRKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 243
           P+DL L  ND + E EV++ IL  +  ++NP I+ DAC SR ++  E+K+L    +FP F
Sbjct: 195 PLDLQLPKNDPDVEKEVISRILSFMYKSQNPAIIVDACTSRQNLIEESKELCSRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETIPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXT 363
           KN    +S  +K+KNAT+P + +K  LQKLL S+ E                        
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKLLASLDESKLSYRPNEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACL 423
            L+QEW+WN++  + Q GD++ITETG SAFG+NQT FP NT GISQ LWGS+G+T GACL
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEVDP------KKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIE 477
           GA FA +E+        K RVILF+GDG+ QLTVQE+ST+V+W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHGPT-AQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLI 536
           + +H  + A Y +IQ W++L LL  FG  +YE  ++ T GE+  + ++ EF  N +IR+I
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMIDDPEFAINDKIRMI 554

Query: 537 EIMLPVMDAPSNLV 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQVLL 568

>TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {ON}
           Anc_2.390 YDL080C
          Length = 688

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/593 (47%), Positives = 388/593 (65%), Gaps = 43/593 (7%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYA 62
           E+T+  YLF RL Q++V TIFGLPG+FN+SLLDK+Y   GMRWAGNANELNA+YAADGY+
Sbjct: 18  ELTVSEYLFHRLKQLNVNTIFGLPGEFNMSLLDKLYNVEGMRWAGNANELNASYAADGYS 77

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
           R+K + C++TTFGVGELS +NGIAGS++E               Q  QLL+HHTLGNGD+
Sbjct: 78  RLKKLGCLMTTFGVGELSVINGIAGSFSENVGIIHIVGMPPIQIQRSQLLMHHTLGNGDY 137

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLE 182
            +FHR+S +I   +A+VT       EID+C+   +++Q+PVYLGLP NLV +KV ++LL 
Sbjct: 138 NIFHRLSDDIYCYSAVVTHPNLCIQEIDKCLSKAWLSQKPVYLGLPENLVSVKVKSTLLN 197

Query: 183 TPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 242
           TP+DL L  ND + E   ++ IL+ I  AKNP I+ADAC +RH V+ ET+ LI+ T+FP 
Sbjct: 198 TPLDLKLPNNDKDNENIAIDQILKKIYSAKNPAIIADACVTRHSVEKETQMLIEKTKFPY 257

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG +DE   +FGGV+VG++SS  V+E V+ ADLI+ +G L SDF T SF ++YK
Sbjct: 258 FVTPMGKGGVDEYSKQFGGVFVGSISSAKVREIVDFADLIIVIGNLQSDFKTTSFHFTYK 317

Query: 303 TKNIVEFHSDYIKIKNATFPGVQMKFALQKLL---------------------GSVAEXX 341
           TK+IV   S  +K+KN  +P + +K  L KL+                      ++    
Sbjct: 318 TKDIVMISSSCVKLKNGLYPELHIKEFLGKLVDNIVTTKITYKPIISPIMNIPNNITSEE 377

Query: 342 XXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFP 401
                                T LKQEW+WN+   + +EGD++ITETGTSAFGINQT FP
Sbjct: 378 SFESLTNYSKTPDKNDSNVNKTLLKQEWVWNEFSLWFREGDIIITETGTSAFGINQTKFP 437

Query: 402 NNTYGISQVLWGSIGFTTGACLGAAFAAEEV---DP---KKRVILFIGDGSLQLTVQEIS 455
           N T GISQ LWGS G++ GACLGA+FAAEE+   +P   K RVILF+GDG+ QLT+QE+S
Sbjct: 438 NRTIGISQTLWGSTGYSVGACLGASFAAEEIHQSNPNIEKPRVILFVGDGAFQLTMQELS 497

Query: 456 TMVRWNLKPYLFVLNNNGYTIEKLI----------------HGPTAQYNEIQSWDHLSLL 499
           TMV+WNL PY+F++NN GY++++ +                      Y +IQ WD+L+L 
Sbjct: 498 TMVKWNLDPYIFLMNNQGYSVDRFLTHQSRRNNSNANNILKSNNNNDYFDIQLWDYLNLF 557

Query: 500 PTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIMLPVMDAPSNLVAQ 552
             F A +YE ++V +  + +K+  +K F+   RIR++EI+LP MD P +L+ +
Sbjct: 558 NLFNAMNYETYKVLSCNDLLKILNSKSFSNEHRIRMVEIILPPMDVPKSLMER 610

>CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080c THI3
           or uniprot|P06169 Saccharomyces cerevisiae YLR044c PDC1
           or uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
           or uniprot|P26263 Saccharomyces cerevisiae YGR087c PDC6
          Length = 638

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/581 (46%), Positives = 378/581 (65%), Gaps = 19/581 (3%)

Query: 2   SEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGY 61
           S+I++  YLF RL+Q+ + TIFGLPGDFN+ LLDK+Y  P MRWAGN NELNAAYAADGY
Sbjct: 11  SQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGD 121
           +R+K + C+ITTFGVGELSA+NG+AGSYAE               Q KQLLLHHTLGNGD
Sbjct: 71  SRLKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLL 181
           ++VF+R++ +I+  TA++ D      E+D CIR  +  Q+PVYLG+P N VD+ V +S L
Sbjct: 131 YSVFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQVDIPVDSSRL 190

Query: 182 ETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFP 241
             PIDLS+     E + +V++ +L+ +  A  P+I+ DAC  RHD   ET  L ++T FP
Sbjct: 191 NNPIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKETHALCELTNFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +  FGGVY G+LSSP V+E  + AD +L +GA+L +F+T +F + +
Sbjct: 251 VFVTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPEFSTSTFHFGF 310

Query: 302 KTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXX 361
           K KN        +KIK ATFP + +K  LQ L+ ++                        
Sbjct: 311 KKKNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVDIIAPKMEPSD 370

Query: 362 XTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGA 421
              L+QEW+WN++  + +E D++ITETG+SAFGINQT FP NT GI+Q LWGS+GF   +
Sbjct: 371 SNLLRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQALWGSVGFALCS 430

Query: 422 CLGAAFAAEE------------------VDPKKRVILFIGDGSLQLTVQEISTMVRWNLK 463
           CLGA FA EE                  +  + R ILF+GDG+ QLTVQE+ST++RW LK
Sbjct: 431 CLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQELSTIIRWKLK 490

Query: 464 PYLFVLNNNGYTIEKLIHGPT-AQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLT 522
           PY+F++NNNGY++++ +H  + A Y ++Q W++L LL  FG   +E  ++ T  ++ +L 
Sbjct: 491 PYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSDFKELL 550

Query: 523 ENKEFNQNSRIRLIEIMLPVMDAPSNLVAQAQLTAKINAKQ 563
            ++ F +  +IR+IEIMLP  D P  L+A+ Q   +++ K+
Sbjct: 551 ADESFAKPDKIRMIEIMLPQSDVPKTLIARWQAEKELSNKR 591

>NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {ON}
           Anc_2.390
          Length = 625

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/568 (46%), Positives = 378/568 (66%), Gaps = 15/568 (2%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYA 62
           +IT+  YLF RL Q+ ++TIFGL G++N+ L+DK+Y+   +RWAGNANELNAAYAADGYA
Sbjct: 12  QITISEYLFHRLKQLHIETIFGLSGEYNMPLIDKLYQVHNLRWAGNANELNAAYAADGYA 71

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
           R+KG+  +ITTFGVGELSALNG+AGS+AE               Q KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGVLITTFGVGELSALNGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLE 182
           +VFHR++++I+    ++ D      E+D+CI   ++ QRPVY+G+P N V+L V +  L+
Sbjct: 132 SVFHRIASDIAVYNTVIDDTDLCFQEVDKCITLAWMEQRPVYMGMPVNQVNLLVDSKFLD 191

Query: 183 TPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 242
            P+DL +  N  E  +E+ N IL+ I   K+P I+ DAC  RH+   E ++    T+FP 
Sbjct: 192 IPLDLDMFENATEVNSEITNKILQKIYKCKHPAIVVDACTIRHECIDEVEEFCRRTKFPV 251

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG+I+E  P FGGV++G+LSSP+V+E V+ AD I+ +G++LS+F+T +F + +K
Sbjct: 252 FVTPMGKGAINENTPHFGGVFMGSLSSPSVREVVDFADFIIVIGSMLSEFSTSTFHFVFK 311

Query: 303 TKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXX 362
            K+ V   SD +KIKN+ +  + +K  ++ LL S+ E                       
Sbjct: 312 VKDSVLLFSDLVKIKNSVYANIHIKPLMKSLLHSLDESKIKYIFEEAPSMILPKTKIPDD 371

Query: 363 TPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGAC 422
             L+QEW+WN++  + +EGD++ITE GTSAFGINQT FPN   GISQ LWGS G++ GAC
Sbjct: 372 VLLRQEWVWNEISHWFREGDIIITEIGTSAFGINQTRFPNEAQGISQSLWGSSGYSLGAC 431

Query: 423 LGAAFAAEEVD--------------PKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFV 468
           LG +FA +E +               K RVILF+GDG+ QLT+QE+ST++RWNL PY+FV
Sbjct: 432 LGTSFAIQEFEREHNHNFHRHTQNVEKHRVILFVGDGAFQLTMQELSTIIRWNLTPYIFV 491

Query: 469 LNNNGYTIEKLIHG-PTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEF 527
           LNN GY++++ +H    A Y +IQ W++L L+ TF AK+YE  ++ T G++  + ++  F
Sbjct: 492 LNNEGYSVDRFLHPEANASYYDIQPWNYLDLMATFNAKNYETKKIVTVGDFRDMVQDPLF 551

Query: 528 NQNSRIRLIEIMLPVMDAPSNLVAQAQL 555
             N +IR++EI+LP  D P  LV   +L
Sbjct: 552 AINDKIRMVEILLPSTDVPQALVDTWKL 579

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/557 (47%), Positives = 374/557 (67%), Gaps = 10/557 (1%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYA 62
           EIT+  YLF RL Q+ V+TIFGLPG+FN+ LLD++Y  PG++WAGNANELNA YAADGYA
Sbjct: 12  EITIADYLFHRLKQLHVETIFGLPGEFNMPLLDRLYNIPGLKWAGNANELNATYAADGYA 71

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
           R+KG+ CIITTFGVGELSA+NGIAG++AE               Q KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGCIITTFGVGELSAINGIAGAFAEHVGVLHVVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLE 182
            VFHRM+ ++S  + ++ D      E+D+CI   Y+ Q+PVYLG+P N V+LKV ++ L 
Sbjct: 132 RVFHRMANDVSFYSRIINDTDLCSNEVDKCIELAYLKQKPVYLGVPVNQVNLKVNSAKLN 191

Query: 183 TPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 242
             +   +  N+++ E E +N IL+ I   ++P I+ DAC +R D   ET++ I +T FP 
Sbjct: 192 KELRFRVLKNNLDMENEAINLILKKIYTCESPAIVVDACVNRQDTVKETEQFIRLTNFPV 251

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKGSIDE  P FGGV+ G++SSP V+E V+ AD ++ +G+LL++F+T +F + YK
Sbjct: 252 FVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADFVIVIGSLLTEFSTSAFHFFYK 311

Query: 303 TKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSV--AEXXXXXXXXXXXXXXXXXXXXX 360
           +KN V    D ++ K + +P + +K  ++ +L  +   +                     
Sbjct: 312 SKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGKISFRPTSDCNNPMIVPKSKPS 371

Query: 361 XXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420
               L+QEW+W++   + QEGD++ITE GTS+FGINQ  FP++T GISQ LWGS G++ G
Sbjct: 372 DDQLLRQEWVWHEFSHWFQEGDIIITELGTSSFGINQIRFPSHTKGISQALWGSSGYSMG 431

Query: 421 ACLGAAFAAEE-----VDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYT 475
           +CLGA FA  E        ++RVILFIGDG+ Q+T+QEISTM+RWNL PY+F+LNN GY+
Sbjct: 432 SCLGACFATLESQSASTSTRQRVILFIGDGAFQITMQEISTMIRWNLTPYIFLLNNQGYS 491

Query: 476 IEKLIHGP--TAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRI 533
           I++ +H    T  Y ++Q W++LS    FGA DYE  ++ T G+  ++  N++F++  RI
Sbjct: 492 IDRFLHHRKNTTLY-DVQQWNYLSFFKVFGATDYETRKIVTLGDLRQMLGNEDFSRADRI 550

Query: 534 RLIEIMLPVMDAPSNLV 550
           R+ EIMLP MD P  +V
Sbjct: 551 RMAEIMLPSMDVPKAIV 567

>TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON}
           Anc_2.390 YDL080C
          Length = 635

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/586 (46%), Positives = 383/586 (65%), Gaps = 24/586 (4%)

Query: 2   SEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGY 61
           ++ITL  YLF RL+Q  + T+FGLPG+FN+ L+DK+   P ++WAGNANELNAAYAADGY
Sbjct: 11  NDITLADYLFHRLNQFKIHTVFGLPGEFNMPLIDKLLTIPDLKWAGNANELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGD 121
           ARIKG+ C++TTFGVGELS++NGIAGSYAE               Q  QLLLHHTLGNGD
Sbjct: 71  ARIKGIGCLLTTFGVGELSSINGIAGSYAEHVGVLHIIGMPPSSIQTSQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLL 181
           +TVFHR+++ ++  + ++ D      EID  I   +  QRPVYLG+P N +   + ++LL
Sbjct: 131 YTVFHRIASELACYSTVLNDTDYLTKEIDLSIVKAWTLQRPVYLGIPMNFISYPIKSNLL 190

Query: 182 ETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFP 241
              +D +L++N+  ++ +V+  IL+ I   K PVI+ DAC +RH+++ ET++L   T+FP
Sbjct: 191 NKDLDFTLESNNEISQDDVIELILKNIYRCKKPVIVVDACVTRHNIEKETEELFRRTKFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSY 301
             VTPM KGS+DE  P F GV+ G++SSP V+E ++S DL+L +G  L +F T SF +SY
Sbjct: 251 VLVTPMAKGSVDESLPEFAGVFCGSISSPQVREVLDSVDLLLVIGCTLPEFTTSSFHFSY 310

Query: 302 KTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXX 361
           K+K+ +   SDYIK +N TF  + +K  ++KLL ++                        
Sbjct: 311 KSKHCIFIFSDYIKYRNTTFADLNIKQLIKKLLLALDVSKIKNFQLQENNNGNIYIPNIK 370

Query: 362 XTP---LKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFT 418
             P   L+QEW+WNQ+  + Q+GD++ITETGT+AFGINQT FP+N  GISQ LWGS G++
Sbjct: 371 LNPTLLLRQEWVWNQLSHWFQDGDIIITETGTTAFGINQTKFPHNARGISQSLWGSTGYS 430

Query: 419 TGACLGAAFAAEEVD--------------------PKKRVILFIGDGSLQLTVQEISTMV 458
            GACLGA+FA  E+                     PK RVILFIGDG+ QLTVQE+ST++
Sbjct: 431 LGACLGASFALSEIRKEQQVINNITQNVFPLFKDPPKHRVILFIGDGAFQLTVQELSTII 490

Query: 459 RWNLKPYLFVLNNNGYTIEKLIHGPT-AQYNEIQSWDHLSLLPTFGAKDYENHRVATTGE 517
           RW L PY+F++NN+GY+ ++ +H  + A Y +I  WD+L LL  FGAK YE+ ++ T G+
Sbjct: 491 RWGLTPYIFIMNNHGYSGDRFLHHRSDAGYYDIPQWDYLGLLEVFGAKIYESKKIITVGD 550

Query: 518 WIKLTENKEFNQNSRIRLIEIMLPVMDAPSNLVAQAQLTAKINAKQ 563
           + K+  N  F  +S +R+IEI+LP MD P  L+ + +L  +   K+
Sbjct: 551 FEKMVNNPNFAIDSVLRMIEIVLPPMDVPQALMDKWRLEQEEEKKK 596

>NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390
          Length = 621

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/564 (46%), Positives = 373/564 (66%), Gaps = 15/564 (2%)

Query: 2   SEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGY 61
           S IT+  Y+F RL Q+ ++TIFGLPG+FN+ L+DK+Y+ P +RWAG+ANELNAAYAADGY
Sbjct: 11  SYITIAEYIFHRLKQLKIETIFGLPGEFNMPLIDKLYKIPQLRWAGDANELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGD 121
           +R+KG+  ++TTFGVGELSA+NG+AGS+AE               Q KQLLLHHTLGNGD
Sbjct: 71  SRLKGLGVLVTTFGVGELSAINGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLL 181
           + VF R+++ ++  T ++ D      E+D+CI   +  Q+PVY+G+P N VD+ V +  L
Sbjct: 131 YNVFWRIASEVACHTVIINDTDLCFMEVDKCIEIAWKRQKPVYIGIPVNQVDIPVRSLHL 190

Query: 182 ETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFP 241
             P+ LS   N  +   +VV  +L+ I  + +PVI+ D C  RH    E ++ I  T+FP
Sbjct: 191 NVPLTLSPDMNLNDIGNDVVQLLLQKIYKSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +P F GV+ G++SSP+V+E V+ AD ++ +G +L+ FNT +F + Y
Sbjct: 251 VFVTPMGKGAIDENNPNFKGVFTGSISSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGY 310

Query: 302 KTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXX 361
           K+KN    +SD IK  NAT+P V +K  LQ LL ++ E                      
Sbjct: 311 KSKNRALLYSDSIKFNNATYPDVYLKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPD 370

Query: 362 XTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGA 421
              L+QEW+WN++  + QEGD++ITETGTSAFGINQT FPN   GISQ LWGS+G++ GA
Sbjct: 371 DELLRQEWVWNEISHWFQEGDIIITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGA 430

Query: 422 CLGAAFAAEEVD--------------PKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLF 467
           CLG+ FA +E                 K RVILF+GDG+ QLT+QE+ST+VRW L PY+F
Sbjct: 431 CLGSLFAVQEFQRDHNHDFHHHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIF 490

Query: 468 VLNNNGYTIEKLIHGPT-AQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKE 526
           +LNN+GY++++++H  + A Y +IQ WD+L+L+ TF A D +  ++ T G+   +  + E
Sbjct: 491 ILNNHGYSVDRILHHRSDASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPE 550

Query: 527 FNQNSRIRLIEIMLPVMDAPSNLV 550
           F  ++RIR+IE+MLP MD P  LV
Sbjct: 551 FAVDNRIRMIEVMLPSMDVPKALV 574

>Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii ADR254W
          Length = 592

 Score =  506 bits (1303), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 257/560 (45%), Positives = 358/560 (63%), Gaps = 12/560 (2%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYA 62
           +I LG+YLF RL+Q++V TIFGLP +FN  LLD+IY+ P MRW GNANELNA+YAADGY+
Sbjct: 13  QIPLGKYLFHRLNQLNVTTIFGLPSEFNSPLLDQIYQIPSMRWCGNANELNASYAADGYS 72

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
           RIK +SC++TTFGVGE+S LNGIAGS++E               Q K+LLLHHTLGN D+
Sbjct: 73  RIKRLSCLVTTFGVGEMSVLNGIAGSFSEHVAVLHVVGMPPSSAQLKKLLLHHTLGNSDY 132

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLE 182
            +FHR++++I   TA++ +       ID CI   Y  Q+PVY G+P NL    V +  L+
Sbjct: 133 DIFHRLASDICVHTAVLKESDNICDVIDNCIVRCYNQQQPVYCGIPVNLAGHLVDSKSLD 192

Query: 183 TPIDLSLKAND--VEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
           +P+ L    N    +A  E+V+ +LE I  A++PVI+AD CASRHD   E  ++   T F
Sbjct: 193 SPLHLMRGFNQPISDAVEELVDILLEKIYSAQHPVIVADGCASRHDCIEELTEIAQKTGF 252

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P   TPMGKGS DEQ  R+ GVY+G++SSP V+E V+ AD +L  GAL +D+ T S+ + 
Sbjct: 253 PLCCTPMGKGSFDEQSKRYVGVYMGSISSPQVREVVDFADFVLVAGALTADYATSSYHFC 312

Query: 301 YKTKNIVEFHSDYIKIKNA-TFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXX 359
           YK KNIV     Y K+    T+P V++K  LQ L   +                      
Sbjct: 313 YKPKNIVLLFDKYAKVSGTKTYPDVRLKDVLQLLARCLDPTKLQYIQEEIPESSCLRVKP 372

Query: 360 XXXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTT 419
              TPL+QEWMW ++  + + GDV++TE GTS  G+NQ  FP+ T  +SQ LWGS+G++ 
Sbjct: 373 DANTPLRQEWMWARLSHWFRPGDVIVTEMGTSGLGVNQIKFPSGTKVVSQPLWGSLGYSV 432

Query: 420 GACLGAAFAAEEVD-----PKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGY 474
           GACLG   A +E          R+ILF+GDG+LQLTVQEIST+++W L PY+FV+NN GY
Sbjct: 433 GACLGVLIAVQEESRGNRLKDNRIILFVGDGALQLTVQEISTIIKWGLAPYIFVINNQGY 492

Query: 475 TIEKLI----HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQN 530
           TI++L+    H  TA Y  IQ W++LS++P FG  +Y+  +V   G+  +L +++ F+  
Sbjct: 493 TIDRLLSRDTHHATADYYNIQPWNNLSIIPAFGGTNYDVRKVVKVGQLDQLLKDQRFSNQ 552

Query: 531 SRIRLIEIMLPVMDAPSNLV 550
             ++++EI+LP MDAP  L+
Sbjct: 553 DILKMVEIILPSMDAPQALL 572

>ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL080C (THI3)
          Length = 581

 Score =  487 bits (1253), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 237/553 (42%), Positives = 333/553 (60%), Gaps = 6/553 (1%)

Query: 2   SEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGY 61
           S I L  YLF RL Q+ V T FGLP D+N+ LLD +     M    N NELNA+YAADGY
Sbjct: 12  SSIPLAEYLFHRLRQLGVTTGFGLPSDYNMFLLDGLENVADMHLCCNTNELNASYAADGY 71

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGD 121
           AR++ +SC+++TFGVGELS +NGIAGS+AE               Q ++LLLHHTLGNGD
Sbjct: 72  ARMQRLSCLVSTFGVGELSVVNGIAGSFAEHVAVLLIVGMPPASAQRRKLLLHHTLGNGD 131

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLL 181
           + VF R++++I   + +V    TA   +D CI   Y  Q+PVY G+P NL +  +P++ L
Sbjct: 132 YDVFRRLASDICTYSTVVRSAHTAAEVLDHCIARCYRDQKPVYCGVPINLAEAMLPSAPL 191

Query: 182 ETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFP 241
           + P  L L         E+V  +L+ I  AK+PV++ DAC +RH    + ++L   T FP
Sbjct: 192 DVP--LPLLDEPCAPLDELVALLLDKIYAAKHPVLVVDACVARHGCMQQLQRLAQATDFP 249

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSY 301
              TPMGKG +DEQ  RF GVYVG+LS+P V+E V+ AD +L VGAL ++F T +F ++Y
Sbjct: 250 VCCTPMGKGIVDEQGARFAGVYVGSLSAPQVREVVDFADFVLVVGALTAEFCTFAFHFAY 309

Query: 302 KTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXX 361
           K KNI   H+ + ++    FP   ++  L  L+                           
Sbjct: 310 KPKNIGLVHARHARVGARGFPDAPLRALLGLLVQRWTPRASANAREPVPEPSALRVAPNP 369

Query: 362 XTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGA 421
            TPL+ EW+W ++ ++   GD++++ETGTSAFG+ QT  P     +SQ LWGS+G++ GA
Sbjct: 370 ATPLRHEWLWARLSRWFAPGDILVSETGTSAFGVLQTRLPPGVCVVSQPLWGSVGYSVGA 429

Query: 422 CLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI- 480
           CLG   A     P +RV+LF+GDG+LQLTVQE+STMVR  L P +FVLNN GY+ ++L+ 
Sbjct: 430 CLGVLVATRAAAPPRRVVLFVGDGALQLTVQELSTMVRLRLAPLIFVLNNRGYSADRLLN 489

Query: 481 ---HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIE 537
              H   A+Y ++Q W +L+L P FGA  Y+   V T GE   L  +  F Q S ++++E
Sbjct: 490 RARHRANARYYDVQPWHNLALAPAFGASAYDPRAVTTVGELDALLSDPAFAQPSVLKMVE 549

Query: 538 IMLPVMDAPSNLV 550
           + LP MD P  L+
Sbjct: 550 VALPSMDGPPALL 562

>Kpol_1046.9 s1046
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 bp, 598 aa] {ON}
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 nt, 599 aa]
          Length = 598

 Score =  427 bits (1098), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 227/564 (40%), Positives = 330/564 (58%), Gaps = 48/564 (8%)

Query: 2   SEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGY 61
           S IT+  YLF RL Q+D++TIFGLPG+FN+ L+DK+Y+ P +RWAGNANELNAAYAADGY
Sbjct: 12  SSITVAEYLFHRLKQMDIRTIFGLPGEFNMPLIDKLYKIPSLRWAGNANELNAAYAADGY 71

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTL---- 117
           AR+K + C+ITTFGVGELSALNGIAGS++E               +   L L+H++    
Sbjct: 72  ARLKRLGCLITTFGVGELSALNGIAGSFSEHLGILHVV-------RMPPLRLNHSIVLIL 124

Query: 118 -GNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKV 176
             NGD+           +      DI   P    R +    +     ++     L     
Sbjct: 125 FRNGDY-----------KFPMKARDILVTPRISHRNLWDEMIKPNQAWISSAGILAYRYW 173

Query: 177 PASLLETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLID 236
             S +           +++  T  +++     K+          C S + V+ +      
Sbjct: 174 RGSKIPKGKGADXXXKNLQCRTSYLSSRSLRFKEQ------CRRCNSDYSVRKQ------ 221

Query: 237 ITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGS 296
             +FP FV P  +    E + +FGGV+ G++SSP V+E V+ ADL++ +G  L DF+T S
Sbjct: 222 --KFPYFV-PQWERVQHENNDQFGGVFSGSISSPHVREVVDFADLVIVIGCTLPDFHTSS 278

Query: 297 FSYSYKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXX 356
           F +SY+ K++V   S Y+KI+N  +P + +K  L  LL  V                   
Sbjct: 279 FHFSYRAKDVVLITSTYVKIRNRLYPDLNIKPLLNTLLSRVDSSLIKYDSIKPMVVPTSK 338

Query: 357 XXXXXXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIG 416
                 + L+QEW+WN++  + QE DV+ITETGTSAFGINQT FP  ++GISQ LWGS+G
Sbjct: 339 LPSK--SVLRQEWVWNEISHWFQEKDVIITETGTSAFGINQTRFPKQSHGISQCLWGSVG 396

Query: 417 FTTGACLGAAFAAEEVDPK-------KRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVL 469
           ++ GACLGA+FA +E+           RVILF+GDG+ QLT+QE+STM++WNLKPY+F++
Sbjct: 397 YSLGACLGASFAVDELYESGKTNGIMPRVILFVGDGAFQLTMQEVSTMIKWNLKPYIFLM 456

Query: 470 NNNGYTIEKLI-HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFN 528
           NN GY+I++ + H   A+Y +IQ W++L+LL  FGA DYE  ++ T  ++  + ++  F 
Sbjct: 457 NNQGYSIDRFLSHRSNAKYYDIQQWEYLNLLQVFGAIDYEAKKIVTVEDFQNILKDANFA 516

Query: 529 QNSRIRLIEIMLPVMDAPSNLVAQ 552
           +N +IR+IEIMLP MD P +L+ Q
Sbjct: 517 RNDKIRMIEIMLPPMDVPQSLMEQ 540

>KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]
           {ON} uniprot|O74722 Kluyveromyces lactis PDC Pyruvate
           decarboxylase
          Length = 578

 Score =  327 bits (837), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/555 (33%), Positives = 299/555 (53%), Gaps = 38/555 (6%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           I L  YLF RL Q++ +T+FG+  +++ + L +     G++W    N+LN ++A D Y R
Sbjct: 27  IPLPEYLFHRLFQLNCRTVFGV-ANYSTAKLYQAIAASGIQWIQTINQLNTSFAVDAYGR 85

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGN--GD 121
             G+SC +T+    EL  +NG  GS+ E               Q   L   H L    GD
Sbjct: 86  AIGVSCYVTSES-AELGHVNGFFGSFCEYVPIL----------QVVVLEQSHDLERLIGD 134

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLL 181
            ++FH              D+   P+EID C+RT +  +RPVY+GL +      VP+S L
Sbjct: 135 VSIFH--------------DVVDDPSEIDSCVRTLFWGKRPVYMGLRSKDATKLVPSSSL 180

Query: 182 ETPI--DLSLKANDVEAET--EVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDI 237
              I   + +K    + +T   V++ I+  +  +  P+I+ DA   R++  +  +  +  
Sbjct: 181 NGNIADKMGIKNTFFQTDTIKRVIDKIIAEVYASSRPLIVVDALIDRYNYNSTIQNFLTE 240

Query: 238 TQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSF 297
           T  P   T M KGSIDE  P F G ++GT+S P V+E + +AD  L +G ++ +F     
Sbjct: 241 TGIPFVTTLMSKGSIDESLPNFVGTFLGTMSQPIVREYMNNADCTLILGCMIENFKNSYC 300

Query: 298 SYSYKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXX 357
            ++YK+KN +   +D +KI+N   P + +   L +L+ S+                    
Sbjct: 301 RFNYKSKNQILLWNDRVKIENNIIPDILLHELLPQLIASLDTTKIVNSRPVTIPNMIPRV 360

Query: 358 XXXXXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGF 417
                T L+QE++W ++  +L++GDV+I+E+GTSA G+ Q  FP+NT  +SQ +W S G+
Sbjct: 361 EPQPVTFLRQEYLWFKMSTWLKQGDVIISESGTSAIGLLQQKFPDNTRLVSQAIWNSSGY 420

Query: 418 TTGACLG--AAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYT 475
           + GACLG  AA+       K R+IL +GDGSLQ T QE+ST++    KPY+FV+NN GYT
Sbjct: 421 SIGACLGILAAYRDMGTLDKHRIILMVGDGSLQFTFQELSTILTHGFKPYIFVINNQGYT 480

Query: 476 IEKLIHGP----TAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNS 531
           +++ ++       A Y +IQ W+ L L   F +++Y   R  + GE   L  +KEFN++ 
Sbjct: 481 VDRTLNREKTHLNATYFDIQPWELLKLPSLFYSQEYFKRRCMSVGELNSLLSDKEFNKSD 540

Query: 532 RIRLIEIMLPVMDAP 546
           +++++E++LP MD P
Sbjct: 541 QLKIVELILPSMDVP 555

>CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380w
          Length = 649

 Score =  321 bits (822), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 203/602 (33%), Positives = 299/602 (49%), Gaps = 56/602 (9%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYE---TPGMRWAGNANELNAAYAAD 59
           EIT G Y+F RL     K++FG+PGDFNL+LL+ +Y+      +RW GN NELNAAYAAD
Sbjct: 30  EITFGEYVFRRLLSCGTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAAD 89

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQL---LLHH 115
           GY+R    + C+ITT+GVGELSALNG+AGS+AE                 K      +HH
Sbjct: 90  GYSRYTNKIGCLITTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVHH 149

Query: 116 ---TLGNGDF------TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLG 166
               L + +F      T +  +   +      + DI  A   +D+ I   Y   +P YL 
Sbjct: 150 LIPALNDSNFVSPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYLF 209

Query: 167 LPANLVDLKV--------PASLLETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILA 218
           +PA+  D+ V        P   LE  I   +   + + E  +V  + +LI ++ NP IL 
Sbjct: 210 IPADFADMMVSTRNLVARPTITLEQAIAPLVGCGESQLEA-IVAKVAQLIYNSSNPCILG 268

Query: 219 DACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVES 278
           D    R+ V  +   LI   Q  +F T MGK  IDE +P + G+Y G   S +V E    
Sbjct: 269 DVLTDRYGVSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFSK 328

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTK---NIVEFHSDYIKIKNAT------FPGVQMKFA 329
            DLIL  G   ++ N G ++  Y      N+VEFHSDYI+  N+         GV     
Sbjct: 329 CDLILHFGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVHV 388

Query: 330 LQKLLGSVA--EXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITE 387
           L +L  ++   +                         + QE++ + + ++L  GDV++ E
Sbjct: 389 LNRLQPAIQADKLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVCE 448

Query: 388 TGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFA-----------AEEVDPKK 436
           TG+  FG+    FP+N   +SQ  + SIG    A LG                EE++ + 
Sbjct: 449 TGSVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYEP 508

Query: 437 RVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHL 496
           ++ILF GDGS Q+T+QE+STM+  N+K  +F+ NN+GYTIE+ I GPT  YN+I  W+  
Sbjct: 509 KLILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWNWT 568

Query: 497 SLLPTF----GAKDYENHRVATTGE--WIKLTENKEFNQN---SRIRLIEIMLPVMDAPS 547
            +   F    G+K    ++V +T E    +L E K+   N    +I L+E+ + V+D P 
Sbjct: 569 KMFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVLDFPE 628

Query: 548 NL 549
            L
Sbjct: 629 QL 630

>SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 637

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/600 (32%), Positives = 302/600 (50%), Gaps = 50/600 (8%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIY----ETPGMRWAGNANELNAAYAAD 59
           I  G+Y+FERL     K++FG+PGDFNLSLL+ +Y    +   ++W G  NELNAAYAAD
Sbjct: 32  IPFGQYVFERLISAGTKSVFGVPGDFNLSLLEHMYSRTVQRKDLKWFGTCNELNAAYAAD 91

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHT-- 116
           GY+R    + C+ITT+GVGELSA+NG+AG++AE               +  +  +HH   
Sbjct: 92  GYSRYTNKIGCVITTYGVGELSAINGVAGAFAENVKVLHIVGVTPSKFRNDETFIHHNVH 151

Query: 117 -----LGNGDFT-----VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
                + N +F       +H M    IS +T  V ++  A  ++D+ +   Y   +P Y+
Sbjct: 152 HLIPAMDNPNFRGPNHRSYHDMIDGRISCSTEFVDNVDQACDQLDKVVNDIYKYSKPGYI 211

Query: 166 GLPANLVDLKVPASLLETPIDLSL-----KANDVEAETEVVNTILELIKDAKNPVILADA 220
            +PA+  D  V A  L T   ++L     +  + E    +   I++L+  +K P ++ D 
Sbjct: 212 FIPADFADKMVNAQNLITTPTITLENVISQGFNQEVVDSMATKIIDLLYKSKTPAVIGDV 271

Query: 221 CASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESAD 280
              R     E +  + IT+  +F + MG+  +DE  P F GVY G  SSP + +A+ S D
Sbjct: 272 LCDRFGCVNEIRNFVRITKMWAFSSFMGRSILDESEPNFHGVYNGAESSPHIIQAIGSCD 331

Query: 281 LILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDYIKI------KNATFPGVQMKFALQKL 333
           LIL  G L ++ N G +S+S+      VE HSDY+              GV     L ++
Sbjct: 332 LILHFGVLKNEINNGHYSFSFNANATEVELHSDYLNFVDYKSGNEVLVKGVHFVSVLNRI 391

Query: 334 LGSVAEXXXXXXXXXXXXXXXXXXXXXXXTP---LKQEWMWNQVGKFLQEGDVVITETGT 390
           +  +                         +P   + Q+++ N + ++L  GDV + ETG+
Sbjct: 392 IQLIDVTKINLKYPDLTVNPEMATPAGIHSPESQITQKFLQNAMSEYLSPGDVFVVETGS 451

Query: 391 SAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEE-------------VDPKKR 437
             F +    FP N   ISQ  + SIG    +CLG   A ++             +D   +
Sbjct: 452 FQFVVRDFQFPTNVKYISQGFYLSIGMALPSCLGIGCAMKDYPGSHICDAGVSTLDYTPK 511

Query: 438 VILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHLS 497
           +IL  GDG+ Q+T+QE+++ +R+ +   +F+ NN+GYT+E+ I GPT  YN+I  W    
Sbjct: 512 LILCEGDGAAQMTIQELTSFLRYQIPVEIFLWNNHGYTVERAIRGPTRSYNDIMEWKWTK 571

Query: 498 LLPTFGAKD---YENHRVATTGEWIKLTEN-KEFNQNSRIRLIEIMLPVMDAPSNLVAQA 553
           LL  FG  D    E  +V   GE+  +  + K   + S++RLIE+ML +MD P  L+A A
Sbjct: 572 LLEAFGDFDGSISEACKVKNVGEFKDVVGSLKHSKERSKVRLIEVMLGMMDIPKQLLAMA 631

>YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}
           ARO10Phenylpyruvate decarboxylase, catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde,
           which is the first specific step in the Ehrlich pathway
          Length = 635

 Score =  311 bits (798), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 209/611 (34%), Positives = 302/611 (49%), Gaps = 52/611 (8%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIY----ETPGMRWAGNANELNAAYAAD 59
           I  G Y+F+RL  +D K++FG+PGDFNLSLL+ +Y    E+ G+RW G  NELNAAYAAD
Sbjct: 25  IPFGEYIFKRLLSIDTKSVFGVPGDFNLSLLEYLYSPSVESAGLRWVGTCNELNAAYAAD 84

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLL----LH 114
           GY+R    + C+ITT+GVGELSALNGIAGS+AE                         LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSSNFSDRNLH 144

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P Y+
Sbjct: 145 HLVPQLHDSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKPGYI 204

Query: 166 GLPANLVDLKVPASLLETPIDLSLKANDVEAE----TEVVNTILELIKDAKNPVILADAC 221
            +PA+  D+ V    L     +S +   V       ++++N I   I  +K P IL D  
Sbjct: 205 FVPADFADMSVTCDNLVNVPRISQQDCIVYPSENQLSDIINKITSWIYSSKTPAILGDVL 264

Query: 222 ASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADL 281
             R+ V     KLI  T   +F T MGK  IDE +P + G Y G      V E  E  DL
Sbjct: 265 TDRYGVSNFLNKLICKTGIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYEHFELCDL 324

Query: 282 ILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIKNA------TFPGVQMKFALQKLL 334
           +L  G  +++ N G ++++YK    I++FH +YI++ +        F G+     L++L 
Sbjct: 325 VLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRLVDTRQGNEQMFKGINFAPILKELY 384

Query: 335 GSV------AEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITET 388
             +       +                       + + Q  +   + KFL  GDVV+ ET
Sbjct: 385 KRIDVSKLSLQYDSNVTQYTNETMRLEDPTNGQSSIITQVHLQKTMPKFLNPGDVVVCET 444

Query: 389 GTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEE------------VDPKK 436
           G+  F +    FP+    ISQ  + SIG    A LG   A ++             D K 
Sbjct: 445 GSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIAMQDHSNAHINGGNVKEDYKP 504

Query: 437 RVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHL 496
           R+ILF GDG+ Q+T+QE+ST+++ N+   + + NNNGYTIE+ I GPT  YN++ SW   
Sbjct: 505 RLILFEGDGAAQMTIQELSTILKCNIPLEVIIWNNNGYTIERAIMGPTRSYNDVMSWKWT 564

Query: 497 SLLPTFGAKD--YENHRV--ATTGEWIKLTENKEFNQNSRIRLIEIMLPVMDAPSNLVAQ 552
            L   FG  D  Y N  +    +   +KL E K  N+ S I L+E+ L  +D P  L   
Sbjct: 565 KLFEAFGDFDGKYTNSTLIQCPSKLALKLEELKNSNKRSGIELLEVKLGELDFPEQLKCM 624

Query: 553 AQLTA-KINAK 562
            +  A K N K
Sbjct: 625 VEAAALKRNKK 635

>Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  311 bits (796), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 211/610 (34%), Positives = 305/610 (50%), Gaps = 54/610 (8%)

Query: 6   LGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIY----ETPGMRWAGNANELNAAYAADGY 61
            G Y+F RL  +  K++FG+PGDFNLSLL+ +Y    E+ G++W G  NELNAAYAADGY
Sbjct: 27  FGEYIFRRLFSIGTKSVFGVPGDFNLSLLEYLYAPSVESDGLQWVGTCNELNAAYAADGY 86

Query: 62  ARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXX----XXXXXXXXXXQAKQLLLHH- 115
           +R    + C+ITT+GVGELSALNGIAGS+AE                     K+  LHH 
Sbjct: 87  SRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSTDSRSNNFKERNLHHL 146

Query: 116 --TLGNGDFT-----VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGL 167
              L + +F      V+H M   N++ + A + DI TA  ++D  IR  Y   +P Y+ +
Sbjct: 147 VPRLHDSNFKGPNHKVYHDMIKDNVACSVAYLEDIETACDQVDAVIRDIYRYSKPGYVFV 206

Query: 168 PANLVDLKVPA-SLLETPIDLSLKANDVEAETEVVNTILEL---IKDAKNPVILADACAS 223
           PA+  D+ V   +L+  P           +ET++ N I ++   +  ++ P IL D    
Sbjct: 207 PADFPDMSVRLDNLINVPHISQQDCITSSSETQLFNIIDKITTWMYSSRTPAILGDVLTD 266

Query: 224 RHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLIL 283
           R+ V     KLI  ++  +F T MGK  IDE +P + G+Y G      V E  ES DLIL
Sbjct: 267 RYGVSDILNKLIYASKIWNFTTVMGKSVIDESNPSYMGLYNGKEGLKQVYEHFESCDLIL 326

Query: 284 SVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKI------KNATFPGVQMKFALQKLLGS 336
             G  +++ N G +S++YK    I++FH +YI+       +   F GV     LQ+L   
Sbjct: 327 HFGVDINEINNGHYSFTYKPNAKIIQFHPNYIRFVDTRYGEEQIFEGVNFVPVLQELYQC 386

Query: 337 V------AEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITETGT 390
           +       +                       T + Q  +   + KFL  GDVV+ ETG+
Sbjct: 387 IDVSKLSLQYDSRVTPYTNETMKLEDPTNDQSTDITQIHLQKVIPKFLNPGDVVVCETGS 446

Query: 391 SAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDP-------------KKR 437
             F +    FP     ISQ  + SIG    A LG   A ++  P             K R
Sbjct: 447 FQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQD-HPNTHINGGNINEGYKPR 505

Query: 438 VILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHLS 497
           +ILF GDG+ Q+T+QE+ST++++++   + + NNNGYTIE+ I GPT  YN+I SW    
Sbjct: 506 LILFEGDGAAQMTIQELSTILKFHIPIEIVIWNNNGYTIERAIMGPTRSYNDIMSWKWTK 565

Query: 498 LLPTFGAKD--YENHRVATTGEWIKLTENKEFNQNS--RIRLIEIMLPVMDAPSNLVAQA 553
           L   FG  D  Y N+ +  T   + L      N ++  RI L+E+ L V+D P  L    
Sbjct: 566 LFEAFGDFDGKYTNNTIIETTSKLALKLKDLKNSSTRDRIELLEVKLGVLDFPEQLRCMV 625

Query: 554 QLTA-KINAK 562
           +  A K N K
Sbjct: 626 EAAALKRNKK 635

>NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON}
           Anc_5.456
          Length = 637

 Score =  305 bits (782), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 205/613 (33%), Positives = 308/613 (50%), Gaps = 56/613 (9%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETP-----GMRWAGNANELNAAYAA 58
           I  G YL +R+     K+IFG+PGDFNLSLL+ +Y TP     G+RW G  NELNAAYAA
Sbjct: 28  IPFGEYLLQRILTAGTKSIFGVPGDFNLSLLEYLY-TPSLISQGLRWIGTCNELNAAYAA 86

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLL----L 113
           DGY+R    MSC+ITT+GVGELSA+NG+AG++AE                         +
Sbjct: 87  DGYSRYSNKMSCLITTYGVGELSAMNGVAGAFAEDVKVLHIVGVTRSVDSRSDDYHTRNI 146

Query: 114 HH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVY 164
           HH    L + +F      V+  M  + ++ + A + +I TA  E+D+ I   Y   +P Y
Sbjct: 147 HHLVPKLKDSNFIGPNHRVYSEMVRDKLACSVAYLDNIETACDEVDKVIFDIYKYSKPGY 206

Query: 165 LGLPANLVDLKV-PASLLETPIDLSLKANDVEAET----EVVNTILELIKDAKNPVILAD 219
           + +PA+  D+ V P++L+  P+ ++L+    E  +    EV   +L+ I D+K P I+ D
Sbjct: 207 IFVPADFSDMLVNPSNLVSNPV-ITLENAIPEVPSLELEEVTQLLLQCIYDSKTPAIIGD 265

Query: 220 ACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESA 279
               R     E  KLI +T   +F T MGK  IDE +P++ G+Y G     +V E     
Sbjct: 266 VLTDRFGCAPELNKLIKMTSMWNFSTVMGKSVIDESNPKYMGLYNGNEGICSVTERFLQC 325

Query: 280 DLILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKI------KNATFPGVQMKFALQK 332
           DL+L  G  +++ N G ++Y Y +   IVE H +Y++       +   F GV     L++
Sbjct: 326 DLVLHFGINVNEINNGHYTYKYNENAKIVELHPEYVRFFDFKINEEKLFKGVHFVPILKR 385

Query: 333 LLGSVAEXXX-----XXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITE 387
           LL  +                                + Q  + N++  +  +GDVV+ E
Sbjct: 386 LLEKLEPTNLNFNYPTNVARFSQEEICLPQESSSELKVTQTHLQNKIPSYFNDGDVVVCE 445

Query: 388 TGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKK----------- 436
           TG+  F +    FP+    ISQ  + SIG    A +G   A ++  PK            
Sbjct: 446 TGSFQFALRDFIFPSQLKYISQGFFLSIGMALPASMGVGIAMQDF-PKSHLIANGKEHSY 504

Query: 437 --RVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWD 494
             R+ILF GDG+ Q+TVQE++TM+R  +   + +LNNNGYTIE+ I GPT  YN+I  W 
Sbjct: 505 QPRLILFEGDGAAQMTVQELTTMLRNKIPIEIILLNNNGYTIERAIKGPTRSYNDIMPWK 564

Query: 495 HLSLLPTFGAKDYE---NHRVATTGEWIKLTENKEF-NQNSRIRLIEIMLPVMDAPSNLV 550
              L   FG  D +   N  V T  E  ++ E+ ++  +++ I L+E+ L VMD P  L 
Sbjct: 565 WTKLFEAFGDFDNKYTMNTLVETRSELDRILEDLKYKKRDNLIELLEVKLDVMDFPKQLQ 624

Query: 551 AQAQLTAKINAKQ 563
           +     A   +K+
Sbjct: 625 SMVDAAAFKRSKK 637

>Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  305 bits (780), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 205/616 (33%), Positives = 302/616 (49%), Gaps = 56/616 (9%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIY----ETPGMRWAGNANELNAAY 56
           ++ I+ G Y+F RL     K++FG+PGDFNLSLL+ +Y    E+ G++W G  NELNAAY
Sbjct: 22  LATISFGEYIFRRLLSTGTKSVFGVPGDFNLSLLEYLYAPSVESAGLKWIGTCNELNAAY 81

Query: 57  AADGYARI-KGMSCIITTFGVGELSALNGIAGSYAEXXXXX----XXXXXXXXXXQAKQL 111
           AADGY+R    + C++TTFGVGELSALNG+AGS+AE                     +  
Sbjct: 82  AADGYSRYSNNIGCLVTTFGVGELSALNGVAGSFAENVKVLHIVGVAKSIDSRSDNFRDR 141

Query: 112 LLHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRP 162
            +HH    L   +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P
Sbjct: 142 NMHHLVPQLHGSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKP 201

Query: 163 VYLGLPANLVDLKVPA-SLLETPI----DLSLKANDVEAETEVVNTILELIKDAKNPVIL 217
            Y+ +PA+  D+ V   +L+  P     D     + ++   ++++ I   +  +K P IL
Sbjct: 202 GYIFVPADFADMSVTCENLINVPHISQQDCITYPSQIQL-FDILDRITSWMYSSKTPAIL 260

Query: 218 ADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVE 277
            D    R+ V     KLI  T   +F T MGK  IDE +P++ G Y G      V E  E
Sbjct: 261 GDVLTDRYGVSEILNKLIYATGIWNFSTVMGKSVIDEANPKYMGQYNGKEGLRQVYEHFE 320

Query: 278 SADLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIKNA------TFPGVQMKFAL 330
           S DL+L  G  +++ N G ++++YK    I++FH +YI+  +        F G+     L
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRFVDTKYGHEQMFEGINFAPVL 380

Query: 331 QKLLGSV------AEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVV 384
            +L   +       +                         + Q  +   + KFL  GDVV
Sbjct: 381 MELYKGIDVSRLSLQYDSGVTSYTNETMQLEDPTNDQSNNITQVHLQKVMPKFLSPGDVV 440

Query: 385 ITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDP---------- 434
           + ETG+  F +    FP     ISQ  + SIG    A LG   A ++             
Sbjct: 441 VCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDFPNAHISDENIGE 500

Query: 435 --KKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQS 492
             K R+ILF GDG+ Q+T+QE+ST+++ ++   +F+ NNNGYTIE+ I GPT  YN++ S
Sbjct: 501 GYKPRLILFEGDGAAQMTIQELSTILKCHITIDIFIWNNNGYTIERAIMGPTRAYNDVMS 560

Query: 493 WDHLSLLPTFGAKDYENHRVATTGEW-----IKLTENKEFNQNSRIRLIEIMLPVMDAPS 547
           W    LL  FG  D   H  +T  E+     +KL E K  N    I L+E+ L V+D P 
Sbjct: 561 WKWTKLLEAFGDFD-RKHTNSTVIEYPSKLAMKLEELKSSNTRDGIELVEVKLGVLDFPE 619

Query: 548 NLVAQAQLTA-KINAK 562
            L       A K N K
Sbjct: 620 QLKCMVDAAALKRNKK 635

>Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {ON}
           complement(31361..33253) [1893 nt, 631 aa]
          Length = 630

 Score =  300 bits (769), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 196/591 (33%), Positives = 299/591 (50%), Gaps = 49/591 (8%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIY------ETPGMRWAGNANELNAAYA 57
           +  G Y+F+RL+    K+IFG+PGD+NL+LL+ +Y      +T  + W G  NELNAAYA
Sbjct: 24  LRFGDYIFKRLNSCGTKSIFGVPGDYNLNLLELMYPNGTANKTSEINWIGCCNELNAAYA 83

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHT 116
           ADGY+R    + CI+TT GVGELSA+NGI+GS+AE                      HH 
Sbjct: 84  ADGYSRYTNKLGCIVTTCGVGELSAMNGISGSFAEHVKVLHIVGIPSTEKFKTGGNFHHL 143

Query: 117 LGN--------GDFTVFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGL 167
           L N         ++ VF  M   ++S +T  + ++ TA  E D  IR  Y   +P Y+ +
Sbjct: 144 LPNFKESNLNKPNYKVFAEMVQGSVSCSTKFIENLDTACQEFDDLIRDIYKYSKPGYMFV 203

Query: 168 PANLVDLKV-PASLLETPI-----DLSLKANDVEAETEVVNTILELIKDAKNPVILADAC 221
           P N   L V P +L ETP       +++  + +E    + + I   +  A+ P I+AD  
Sbjct: 204 PENYFKLYVNPKNLYETPSITLQDCITMSPDKMEMADGLTDFIFSYLYHAEKPAIIADTL 263

Query: 222 ASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADL 281
             R+   +   + I  T   +F T MGK  +DE    + GVY G      V++A+ + DL
Sbjct: 264 TDRYSGSSLLNEFIQKTNIWNFSTLMGKSILDESTETYKGVYNGKDGCEKVQKAISTCDL 323

Query: 282 ILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDYIKI------KNATFPGVQMKFALQK 332
           IL  G   ++ N+G+++   Y  K   I+EFH  YI++          F GV+  + L++
Sbjct: 324 ILHFGVEKNEVNSGTYTFEDYYSKVSFIIEFHPQYIRMIDMQSKSTQLFGGVEFTYILKR 383

Query: 333 LLGSV-AEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITETGTS 391
           +L  V                            + Q+ +   +  +++ GDVV+ +TGT 
Sbjct: 384 MLKMVNPSNLHLNYPTSDESSTKTDQEAVANNQITQDHISTTMESYIKPGDVVLCDTGTF 443

Query: 392 AFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEV------------DPKKRVI 439
            F +    F +    +SQ  + SIG+   + LG   A  +             + K R+I
Sbjct: 444 QFSLRDFKFSSQVKLVSQFFYLSIGYALPSALGVGIAMRDYPNSHIKDEQLKENTKPRLI 503

Query: 440 LFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHLSLL 499
           LF GDG+ Q+TVQE+STM+R+ +   +F+ NN+GYTIE+ I GPT  YN+IQ W+   L 
Sbjct: 504 LFEGDGAAQMTVQELSTMLRYEVPMDIFLWNNDGYTIERAIQGPTRSYNDIQPWNWTYLF 563

Query: 500 PTFG-AKD--YENHRVATTGEWIK-LTENKEFNQNSRIRLIEIMLPVMDAP 546
             FG AK+   +NH+V TT E    LTE +  +QN+ I  +E+ L +MD P
Sbjct: 564 KAFGDAKENFAKNHKVETTKELDNILTELRSKDQNN-INFVEVTLGIMDMP 613

>Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  300 bits (768), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 205/610 (33%), Positives = 304/610 (49%), Gaps = 55/610 (9%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIY----ETPGMRWAGNANELNAAY 56
           ++ I  G Y+F RL  +  K++FG+PGDFNLSLL+ +Y    E+ G+RW G  NELNAAY
Sbjct: 22  LATIPFGEYIFRRLLSIGTKSVFGVPGDFNLSLLEYLYSPNVESAGLRWVGTCNELNAAY 81

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXX----XXXXXXXXXXQAKQL 111
           AADGY+R    + C+ITT+GVGELSALNGIAGS+AE                     K+ 
Sbjct: 82  AADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSNNFKER 141

Query: 112 LLHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRP 162
            LHH    + N +F      V+H M  + ++ + A + DI TA  ++D  IR  +   +P
Sbjct: 142 NLHHLVPQVHNSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACVQVDNVIRDIFKYSKP 201

Query: 163 VYLGLPANLVDLKVPA-SLLETP----IDLSLKANDVEAETEVVNTILELIKDAKNPVIL 217
            Y+ +PA+  D+ V A +L++ P     D      +V+   ++++ I   +  +K P IL
Sbjct: 202 GYIFVPADFADMSVAADNLVKVPHISQQDCITYPPEVQL-LDIIDKITSWMYSSKTPAIL 260

Query: 218 ADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVE 277
            D    R+ V     +LI  T+  +F T MGK  IDE +P + G Y G      V +  E
Sbjct: 261 GDVLTDRYGVSNILNELIYTTKIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYKHFE 320

Query: 278 SADLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIKNA------TFPGVQMKFAL 330
           S DL+L  G  +++ N G ++++YK    I++FH +YI+  +        F GV     L
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPEYIRFVDTKYGDEQMFEGVNFVPVL 380

Query: 331 QKL--LGSVA----EXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVV 384
           ++L  L  VA    +                       + + Q  +   +  FL  GDVV
Sbjct: 381 KELYKLIDVARLSLQYDSNVTSYTNETMQIEDLTDDQSSIITQAHLQKVMPGFLNPGDVV 440

Query: 385 ITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEV------------ 432
           + ETG+  F +    FP     ISQ  + SIG    A LG   A ++             
Sbjct: 441 VCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDYSNAHINGSNVKE 500

Query: 433 DPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQS 492
           D K R+ILF GDG+ Q+T+QE+ST+++ N+   + + NNNGYTIE+ I GPT  YN+I S
Sbjct: 501 DYKPRLILFEGDGAAQMTIQELSTILKCNVPLEIIIWNNNGYTIERAIMGPTRSYNDIMS 560

Query: 493 WDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFN-----QNSRIRLIEIMLPVMDAPS 547
           W    L   FG  D   H  +T  E+      K        + ++I L+E+ L V+D P 
Sbjct: 561 WKWTKLFEAFGDFD-GKHTSSTLIEFPSKLALKLKELKNSARRNQIELLEVKLGVLDFPE 619

Query: 548 NLVAQAQLTA 557
            L    +  A
Sbjct: 620 QLKCMVEAAA 629

>KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]
           {ON} similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 625

 Score =  297 bits (761), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 193/601 (32%), Positives = 296/601 (49%), Gaps = 51/601 (8%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYET----PGMRWAGNANELNAAYAA 58
            I LG+Y+FER+     +TIFG+PGDFNLSLL+ IY       G++W G  NELNAAYAA
Sbjct: 21  RIPLGQYIFERIVSSGTRTIFGVPGDFNLSLLEHIYNPEVALKGIKWIGTCNELNAAYAA 80

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTL 117
           DGY+R    + C+ITT GVGELSALNGIAG++AE                       H +
Sbjct: 81  DGYSRYTNKIGCLITTLGVGELSALNGIAGAFAEDVKILHIVGVAPSQFYEGSAQSSHNV 140

Query: 118 GNGDFTVF--------HRM-----SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVY 164
            +    VF        HR+        +S ++  + DI++A  +ID  I   Y   +P Y
Sbjct: 141 HHLVPAVFDSNIHAPNHRVYRDMVDKRVSCSSLFLDDISSACDQIDTVISDIYRYSKPGY 200

Query: 165 LGLPANLVDLKVPASLLETPIDLSLK-------ANDVEAETEVVNTILELIKDAKNPVIL 217
           + +PA+  D  V A  LE    + L+        ND + + E+   ILE +  +  P I+
Sbjct: 201 IFIPADFTDKLVDARNLEKRPAILLRDVVSGFCINDHKCQ-ELAEYILESMYSSSRPAII 259

Query: 218 ADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVE 277
           AD    R+D+ +  ++L++ T   +F + MGK  +DE +  F GVY G+ S   V +  +
Sbjct: 260 ADILCDRYDLTSSLRELVNKTHVWNFASSMGKSILDENNLGFRGVYNGSESQDQVLKDFQ 319

Query: 278 SADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKI------KNATFPGVQMKFAL 330
           + D +L VG + ++ NTG +SY +    NIVE H  Y+        KN    G      L
Sbjct: 320 TCDFLLHVGVVKNEMNTGHYSYKFSNHSNIVELHPSYVNFIDADTGKNRYVTGQYFFKVL 379

Query: 331 QKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITETGT 390
             +   +                         + +   ++     KFL  GDV + +TG+
Sbjct: 380 DMMTQMIDPTKLHLGYQESIPSRTQEYCGPPHSSVTHSYLQTHFPKFLSSGDVFVVDTGS 439

Query: 391 SAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEV-------------DPKKR 437
             FG+    FP++   ISQ  + SIG      LG     ++              + + R
Sbjct: 440 FQFGVRDYRFPSDLKYISQSFYLSIGMALPCALGVGLGMQDYPSNHIISSALVQRNYQPR 499

Query: 438 VILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHLS 497
           +IL  GDG+ Q+T+QE+++ +R+ +   LF+ NN GYT+E+ I GP   YN+I +W+   
Sbjct: 500 LILCEGDGAAQMTIQELTSFLRYKVPIDLFIWNNGGYTVERAIKGPNRPYNDIMAWEWTE 559

Query: 498 LLPTFGAKDYEN---HRVATTGEWIKLTEN-KEFNQNSR-IRLIEIMLPVMDAPSNLVAQ 552
           LL  FG    EN    +V++  +  +L +  +  ++ S+ +RL+E+ML VMD P  L A 
Sbjct: 560 LLRVFGDPKLENSVSQKVSSADQMSELLKTFRSSDKRSKLVRLVEVMLGVMDFPEQLKAM 619

Query: 553 A 553
           A
Sbjct: 620 A 620

>ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR380W (ARO10)
          Length = 629

 Score =  296 bits (759), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 192/594 (32%), Positives = 299/594 (50%), Gaps = 50/594 (8%)

Query: 2   SEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYE----TPGMRWAGNANELNAAYA 57
           +E+ LG Y+F RL     KT+FG+PGDFN+ LL+ +Y       G++W G  NELNAAYA
Sbjct: 28  AEMPLGEYMFRRLMSAGTKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAAYA 87

Query: 58  ADGYAR-IKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLL---L 113
           ADGY+R    + C++TT GVGELSALNG+AG++AE               Q    L   +
Sbjct: 88  ADGYSRYCNKIGCVVTTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHGNV 147

Query: 114 HH---TLGNGDF-----TVFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVY 164
           HH    L N +F      V+  M S  +S     + D+ TA  +ID  IR  +   +P Y
Sbjct: 148 HHLVPRLRNSNFKAPNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKPGY 207

Query: 165 LGLPANLVDLKV--------PASLLETPIDLSLKANDVEAETEVVNTILELIKDAKNPVI 216
           L +PA++ ++KV        P  +LE+ +   L+  ++ A   +   IL+ +  +  P I
Sbjct: 208 LFVPADMPNMKVSSRNLVQAPTIMLESAV---LERTNLAACDRIGIEILQHLYQSSTPAI 264

Query: 217 LADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAV 276
           L D    R  +  + ++L+++T   +F T MGK  +DE  P + GVY G   S      +
Sbjct: 265 LCDGLCDRFGLTGDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGA-GSKERNALL 323

Query: 277 ESADLILSVGALLSDFNTGSFSYSYKTKN-IVEFHSDYIKI----KNATFPGVQMKFALQ 331
           +  DLIL +G +  + NT  +++ +  ++ I+E H +Y+ +    +        +   L+
Sbjct: 324 QECDLILYLGPVKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLPVLR 383

Query: 332 KLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITETGTS 391
            +L  +                          P+ Q  + + + + L  GDV++ +TGT 
Sbjct: 384 SILAHLNVANLSFNYPTAKKRVPREHQYAADEPITQGMLQHMIPECLNPGDVMVVDTGTF 443

Query: 392 AFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEE-----VDPK-------KRVI 439
            F +    FP +   ISQ  + SIG    A LG A A  E     + PK        R++
Sbjct: 444 QFSVFDMKFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTPRLV 503

Query: 440 LFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHLSLL 499
           L  GDG+ Q+T+QE+ST +R+ L   + + NN+GYT+E++I GPT  YN+I SWD   LL
Sbjct: 504 LCEGDGAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWTKLL 563

Query: 500 PTFGAKD---YENHRVATTGEWIK-LTENKEFNQNSRIRLIEIMLPVMDAPSNL 549
             FG  D    E+ RV      I+ L+  K   + S+IRL+E++L  MD  + L
Sbjct: 564 RVFGDFDGTRSESVRVKDFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATL 617

>KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {ON}
           Anc_5.456 YDR380W
          Length = 635

 Score =  288 bits (737), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 187/609 (30%), Positives = 307/609 (50%), Gaps = 61/609 (10%)

Query: 2   SEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYE----TPGMRWAGNANELNAAYA 57
            +I  G Y+F+R+     K++FG+PGDFNL LL+ +Y+      G+RW G  NELNAAYA
Sbjct: 23  DQIRFGEYIFQRILSCGTKSVFGVPGDFNLPLLEYLYDDSIINQGLRWIGTCNELNAAYA 82

Query: 58  ADGYARI-KGMSCIITTFGVGELSALNGIAGSYAEXXXXX----XXXXXXXXXXQAKQLL 112
           ADGY+R  +G+ C+ITT+GVGELSA+NGIAG++AE                     KQ  
Sbjct: 83  ADGYSRYSQGIGCLITTYGVGELSAMNGIAGAFAENVKLLHIVGVARSIDSQHDDFKQRN 142

Query: 113 LHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPV 163
           LHH    L + +F+     +++ M  + IS +T  + +I TA  ++D+ I   Y   +P 
Sbjct: 143 LHHLVPQLNDSNFSGPNHKIYYEMVKDRISCSTEYLENIDTACDQVDKVIMDIYRYSKPG 202

Query: 164 YLGLPANLVDLKVPA-SLLETPI----DLSLKANDVEAETEVVNTILELIKDAKNPVILA 218
           Y+ +P + V++ V   +LL+ P     D  L+ + +    ++ N IL+ I  +K+P I+ 
Sbjct: 203 YIFVPCDFVNMMVDTKNLLQRPKITFQDCILQDDKLNQIDQITNLILDQIYSSKSPAIIG 262

Query: 219 DACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVES 278
           D    R+       + I +T+  +F T  GK  I+EQ+P + G+Y G   +  V +    
Sbjct: 263 DVLTDRYHGNKLLNEFITLTKIWNFTTFNGKSIINEQNPYYMGLYNGNEGAETVIDRFLK 322

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKI------KNATFPGVQMKFALQ 331
            DLI++VG  +++ N G +++SY+    ++E H  YI++      +   F G+     L+
Sbjct: 323 CDLIINVGIDINEINHGHYTFSYRQNAKLIEMHPTYIRLYDTGSHEETLFKGINFIHVLK 382

Query: 332 KLLGSVA------EXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVI 385
           ++L  +       +                         + Q ++   V  +L +GDV++
Sbjct: 383 RMLIKIDIKRFDFDYDPSVTKFDPTIELKFPSADPDSNKITQNFLAQNVPDYLNDGDVLV 442

Query: 386 TETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPK---------- 435
            ETG   F       P+    I+Q  + SIG    A LG   A ++  P+          
Sbjct: 443 VETGAFQFATRDFLLPDQLKYITQGFYLSIGTALPAALGVGIAMQDY-PRCHLYGKIPET 501

Query: 436 --KRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSW 493
              R+IL  GDG+ Q+TVQE+S+ +R+N+   + +LNN+GYTIE+ I GPT  YN+I +W
Sbjct: 502 YNPRLILMEGDGAAQMTVQELSSFIRYNIPIEIILLNNDGYTIERAILGPTRSYNDIMAW 561

Query: 494 DHLSLLPTFGAKDYENHRVATTGEWI--------KLTENKEFNQNSRIRLIEIMLPVMDA 545
           +   +    G  D++N   AT    I        K  + K   + ++I  IE++L V+D 
Sbjct: 562 NWTKIFEALG--DFDNK--ATVNTTIKSPSKLLNKFKQLKNETERNKIEFIEVILGVLDY 617

Query: 546 PSNLVAQAQ 554
           P  L +  +
Sbjct: 618 PEQLKSMVE 626

>Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..11375)
           [1911 nt, 637 aa]
          Length = 636

 Score =  287 bits (735), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 197/608 (32%), Positives = 299/608 (49%), Gaps = 60/608 (9%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPG---MRWAGNANELNAAYAAD 59
           +I LG YL  RL  +  K+ FG+PGDFNL LL+ +Y   G   + W G  NELNA+YAAD
Sbjct: 16  KIPLGEYLVRRLLSIGSKSAFGVPGDFNLPLLEFLYNKDGDEIINWIGCCNELNASYAAD 75

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLL----LH 114
           GY+R    + C+ITT+GVGELSA+NGI GSYAE                  + L    LH
Sbjct: 76  GYSRYTNKIGCLITTYGVGELSAINGITGSYAENIKILHIVGVAPTFISEDENLKYKNLH 135

Query: 115 H--------TLGNGDFTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
           H         + + +F ++++M  + IS  +  +TDI T+  +ID  I   +   +P Y+
Sbjct: 136 HLIPDKEFPNINSPNFKIYYQMVKDKISCASEYLTDIETSCDKIDDVIVQIFKHSKPGYI 195

Query: 166 GLPANLVDLKVPA-SLLETP-IDLS--LKANDVEAETEVVNTILELIKDAKNPVILADAC 221
            +P++  +  V + +L+  P I+LS  L    +E    + N I++LI ++++P I+ D  
Sbjct: 196 FIPSDFSNKLVSSKNLINVPSINLSDCLNKTPMEKIDNLTNEIIDLIGNSQSPAIIGDVL 255

Query: 222 ASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADL 281
             R          I +T+F +F T MGK  IDE    + G Y+G      V   +   D+
Sbjct: 256 TDRFGCTKLLNDFIQMTKFWNFSTMMGKSVIDESGQAYMGTYIGLGGLTTVYNKILKCDI 315

Query: 282 ILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKIKNAT---------FPGVQMKFALQ 331
            L  G  +++ N+G++S+ + K   I+E + +Y+KI             +P V M   L+
Sbjct: 316 FLIFGLEMNEMNSGNYSFKFPKGSQIIEINPNYLKITKCHDTENQIVDFYPNVSMTHILE 375

Query: 332 KLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQE--------WMWNQVGKFLQEGDV 383
              G +A+                        PL+QE         +  ++  FL  GDV
Sbjct: 376 ---GLIAKVNIHDANTNYDKSVKSYDTSELVLPLQQEDEEKITQVHLQRELPNFLNPGDV 432

Query: 384 VITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPK-------- 435
           ++ ETG+  F +    FP+N   ISQ  + SIG    A LG   A ++  PK        
Sbjct: 433 LVCETGSFQFAVQDFKFPSNLKYISQGFYLSIGMALPAALGVGIAMKDY-PKFHLNDHSL 491

Query: 436 -----KRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEI 490
                 R+IL  GDG+ Q+TVQE++TM+R  +   +F+ NNNGYT+E+ I GP   YN+I
Sbjct: 492 ARNYTPRLILLEGDGAAQMTVQELTTMLRHKIPMEIFLWNNNGYTVERAIEGPFRSYNDI 551

Query: 491 QSWDHLSLLPTFGAKDYENHRVATTGEWIKLTEN----KEFNQNSRIRLIEIMLPVMDAP 546
             W+   LL   G  + E +R  T  +  +L+E     KE   N+ I+LIE+ L   D P
Sbjct: 552 MPWNWTKLLNVLGDPNNEFNRCVTIDKKSQLSEKFKELKEGKDNNCIQLIEVQLDTHDIP 611

Query: 547 SNLVAQAQ 554
             L    Q
Sbjct: 612 RQLDFMVQ 619

>ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {ON}
           similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 613

 Score =  283 bits (723), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 188/605 (31%), Positives = 297/605 (49%), Gaps = 50/605 (8%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETP----GMRWAGNANELNAAYAA 58
            I  G YLF++L Q   K+IFG+PGD+NL LL+ +Y+      G RW    NELNAAYAA
Sbjct: 15  RIPFGEYLFKKLVQSGSKSIFGVPGDYNLPLLEHLYDDSVKDIGCRWIACCNELNAAYAA 74

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTL 117
           DGY+R    ++ +ITT+GVGELSA+NG+AGS AE                A +   HH +
Sbjct: 75  DGYSRYTNKLATLITTYGVGELSAINGVAGSSAENVKVLHIVGVVKS--DAPECNYHHLI 132

Query: 118 ---------GNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLP 168
                    G      +  +   ++ +   + DI TAP ++D+ I   Y   +P YL +P
Sbjct: 133 PQLQHSNFIGPNRKICYDMVKDRVACSAEYLEDIETAPEKVDKVITEIYKHSKPGYLFVP 192

Query: 169 ANLVDLKVPASLLETPIDL--SLKANDVEAETEVVNTILELIKDAKNPVILADACASRHD 226
           A+  D  V  + L   I+L  S++    E    +V+ +L+ I  ++ P ILAD    R  
Sbjct: 193 ADFADKLVDTTCLNNEINLCNSIERTPSEKLDSIVDGVLQWIYQSQTPAILADGNVDRFG 252

Query: 227 VKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVG 286
           + ++  + I+ TQ  +F T MGK  IDE +PR+ G+Y G   +  V+    S DLIL  G
Sbjct: 253 LISQLNQFIERTQMVNFTTIMGKSIIDETNPRYQGLYAGKSCTDLVRSKFLSCDLILHFG 312

Query: 287 ALLSDFNTGSFSYSYKTK-NIVEFHSDYIKI-----------KNATFPGVQMKFALQKLL 334
              ++ N  +  + Y  +  ++EFH  YI++           +N  F  V      Q++ 
Sbjct: 313 VEKNEVNYCAQGFPYGPQAKVIEFHQSYIRLFDTLNGDEQLFENVNFVDVLTALH-QRID 371

Query: 335 GSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFG 394
            S                          + + Q ++  +  + L  GD+++++TG+  FG
Sbjct: 372 ISKLNLQYDKAIFTTYEPSQLNLPEEDTSDVTQIYLQKKFPEILAPGDILVSDTGSFQFG 431

Query: 395 INQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDP-------------KKRVILF 441
           +     P  +  ++Q  W SIG    A LG     ++                K +++L 
Sbjct: 432 VRDYKLPTQSKFMAQSTWLSIGMGLPAALGVGIGMQDYPRIHICDQSKVPAGYKPKLVLG 491

Query: 442 IGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHLSLLPT 501
           +GDG+ Q+TVQE++TM+R+++   +FV NNNGYTIE+ I G  + YN+I  W    L   
Sbjct: 492 VGDGAAQMTVQELTTMLRYHVDINVFVWNNNGYTIERAIMGENSDYNDIMPWRWTKLFEA 551

Query: 502 FGAKD--YENHRVATTGEWIKLTENKEFNQNSR-IRLIEIMLPVMDAPSNLVAQAQLTAK 558
           FG  D  Y N  +  T + +   + ++ N+  + I L+E+ L VMD P+ L  Q  L+  
Sbjct: 552 FGDFDGKYSNSSLVKTRQELD-QKIEDINKGGKGIELVEVKLGVMDYPAQL--QMMLSNM 608

Query: 559 INAKQ 563
            NAK+
Sbjct: 609 KNAKK 613

>TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5.456
           YDR380W
          Length = 648

 Score =  281 bits (720), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 199/628 (31%), Positives = 304/628 (48%), Gaps = 77/628 (12%)

Query: 2   SEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIY-------ETPGMRWAGNANELNA 54
           + ITL  Y+F RL      ++FG+PGDFNL LL+ +Y       E   + W G  NELNA
Sbjct: 15  NSITLAEYIFRRLRSSGTYSLFGVPGDFNLPLLESLYHKTADGKEVELLNWIGCCNELNA 74

Query: 55  AYAADGYAR-IKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXX-XXXXQAKQLL 112
           AYAADGY+R    + C++TTFGVGE+SALNGI G+  E                 + Q  
Sbjct: 75  AYAADGYSRYTNKIGCLVTTFGVGEISALNGIVGAAVENVKVLNIVGIPPTHILNSSQYN 134

Query: 113 LHHTLGN--------GDFTVFHRMSAN-ISETTAMV--TDIATAPA-----EIDRCIRTT 156
           +HH++ N         ++  +  M  N I+     +  +DI    +     +ID+ I+  
Sbjct: 135 IHHSIPNLKNSNSGVPNYKTYCDMVLNNITNNVEFLELSDIKNQNSNQVCNKIDQLIKNI 194

Query: 157 YVTQRPVYLGLPANLVDLKVPAS----LLETPIDLSLKANDVE----AETEVVNTILELI 208
           +++ +P YL +P+N+ ++ V ++    L +  +D +LK+         E +++  I +L+
Sbjct: 195 FISSKPGYLFVPSNMTNMMVSSANLTLLPQINLDWALKSTRSNLSETIENDIIEEISQLL 254

Query: 209 KDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLS 268
             +K P IL D    R D + +  +LI      +F T +GK  IDE + RF G Y G  S
Sbjct: 255 YKSKKPCILCDVFIDRFDCRIQVNQLISKLNIWNFSTMLGKSIIDEDNDRFMGTYNGVTS 314

Query: 269 SPAVKEAVESADLILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKIK------NATF 321
              VK+  ES DLIL +G   ++ NTG +S+SY     I+E   DYIKI       +   
Sbjct: 315 DSYVKDNFESCDLILHLGIETNEMNTGCYSFSYLPDAVIIEVGKDYIKISKHDGKISKII 374

Query: 322 PGVQMKFALQKLL-------------GSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQE 368
             + ++  +QKLL              +V                           + Q+
Sbjct: 375 NDIMLRDVIQKLLHFIDDSKCTYSFDNNVESFPTYKNKLISKKSLENNVESKAQQTVTQD 434

Query: 369 WMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFA 428
            +  ++     +GDVV+ ETG+  F I    FP  T  I+Q  + SIG    A LG    
Sbjct: 435 DLQVEIQTLFDKGDVVVVETGSFQFAIPDMIFPKETKLINQGFYLSIGMALPASLGVGIG 494

Query: 429 ------------AEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTI 476
                       +E+  PKK +ILF GDG+ Q+T+QE+S+++R+ +   +F+ NNNGYT+
Sbjct: 495 MRDYPNCHINDNSEDATPKK-LILFEGDGAAQMTIQELSSLLRYRIPIDIFIWNNNGYTV 553

Query: 477 EKLIHGPTAQYNEIQSWDHLSLLPTFGAKDYE-----NHRVATTGEW-IKLTENKEFNQN 530
           E++  G    YN+I  W  ++LL  FG  D+E     +  ++T  E   K+ E K  N  
Sbjct: 554 ERIFEGEKRSYNDIMPWKWVNLLKVFG--DHEKTFSKSTTISTVQELRCKIDELKNANPQ 611

Query: 531 SRIRLIEIMLPVMDAPSNL---VAQAQL 555
             I LIE+ L  MD P NL   V Q +L
Sbjct: 612 KIIELIEVKLGEMDIPKNLKHIVEQMKL 639

>TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {ON}
           Anc_5.456 YDR380W
          Length = 640

 Score =  280 bits (717), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 194/617 (31%), Positives = 307/617 (49%), Gaps = 83/617 (13%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIY---------ETPGMRWAGNANELNA 54
           IT G Y+F+RL  +  K++FG+PGDFNL LL+ +Y         E   +RW G  NELN+
Sbjct: 23  ITFGHYIFQRLLSLGTKSVFGVPGDFNLPLLEYLYDDFQSPDTKEKTSIRWVGGCNELNS 82

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQ----AK 109
           AY+ADGY+R    +SC+ITTFGVGELSA+NG++GS+AE                     K
Sbjct: 83  AYSADGYSRYTNKISCLITTFGVGELSAINGVSGSFAENIKVLHIVGVPSTKITESPVQK 142

Query: 110 QLLLHHTLGNGD--------FTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQ 160
              LHH + + D          V+H M  + IS +T +++DI  A   +D+ I   Y   
Sbjct: 143 NWNLHHLVPSMDCPNFNPPNHNVYHDMIKDKISCSTHILSDITKAADMVDQVILDIYKYS 202

Query: 161 RPVYLGLPANLVDLKVPA-SLLETP---IDLSLKANDVEAE------TEVVNTILELIKD 210
           RP YL +P+N  D+ V   +L++ P   +D +L  N +++        ++   IL+++  
Sbjct: 203 RPGYLFVPSNFPDMLVSTKNLIDRPTITMDDALALNSIDSNFSLSHMKDLTRRILKILYK 262

Query: 211 AKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSP 270
           ++ P ++ D    R+  K    + I+ T+  +FVTP+ K +IDE +  + G+Y G  S+ 
Sbjct: 263 SETPAVVCDMLVDRYGGKKLINEFINRTKIRNFVTPLSKSTIDETNENYVGLYNGKQSNA 322

Query: 271 AVKEAVESADLILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKI--------KNATF 321
            V E  E++DL+L  G   ++ NTG +S+SY     +++ +  Y+++            +
Sbjct: 323 KVIEHFENSDLVLHYGVFSNEVNTGVYSHSYGPNTTLIQLNPTYLRVVEYENGHHSELIY 382

Query: 322 PGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQ-- 379
             V     L++LL  +                         T +KQE + N  GK  Q  
Sbjct: 383 RDVNFLHILKQLLKDI------------DLSKLNFKYQPLATRVKQETIENSDGKITQAS 430

Query: 380 ----------EGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAA 429
                      GD+++ +TG   F I    F +    I+Q  + SIG      LG   A 
Sbjct: 431 LGQAFPSTFNPGDILVADTGAFQFSIRDFVFHSQMKYITQGFYLSIGMALPCALGVGVAM 490

Query: 430 EEVD----------PKK---RVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTI 476
           ++            PK    R+IL  GDG+ Q+TVQE+STM+R  +   +++ NN+GYTI
Sbjct: 491 QDYPLEHVYDKSKLPKNYTPRLILCEGDGAAQMTVQELSTMIREKISIEIYLWNNDGYTI 550

Query: 477 EKLIHGPTAQYNEIQSWDHLSLLPTFG---AKDYENHRVATTGEWI-KLTENKEFNQNSR 532
           E+ I GPT  YN+I +W+  +LL +FG    K   +  + T  + + KL + KE + N  
Sbjct: 551 ERAIMGPTRSYNDIAAWNWTTLLNSFGDINGKLTNSVTIETQSDLVAKLKDLKEGDNNKC 610

Query: 533 IRLIEIMLPVMDAPSNL 549
           I  +E+ML  +D P  L
Sbjct: 611 IEFMEVMLGKVDYPPQL 627

>KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {ON}
           Anc_5.456 YDR380W
          Length = 637

 Score =  280 bits (716), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 190/602 (31%), Positives = 290/602 (48%), Gaps = 60/602 (9%)

Query: 3   EITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETP----GMRWAGNANELNAAYAA 58
           +I LG+YLF+R+     K+IFG+PGDFNL LL+ +YE      G+RW G  NELNAAYAA
Sbjct: 27  KIPLGKYLFQRVLSAGTKSIFGVPGDFNLPLLEHLYERDLVEQGLRWIGTCNELNAAYAA 86

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTL 117
           DG++R    + C+ITT+GVGELSALNG+AG++AE               + +   +HH +
Sbjct: 87  DGFSRYSNKIGCLITTYGVGELSALNGVAGAFAENVKMLHIVGVAKSSAKHENKNIHHLI 146

Query: 118 GNGDFTVFHR---------MSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLP 168
            N   + F R         +   +  +   + +I  A  +ID+ IR  Y   +P Y+ +P
Sbjct: 147 PNLHDSNFKRPNHKVYYEMVKDRVCCSAEYLENIDQACDQIDKVIRDIYRYSKPGYIFIP 206

Query: 169 ANLV-DLKVPASLLETP-IDL--SLKANDVEAETEVVNTILELIKDAKNPVILADACASR 224
            + V +L    +LL TP IDL  SL   D     EV   I + I  + NP ++ D    R
Sbjct: 207 VDFVNELVETTNLLVTPVIDLESSLARPDEVTVIEVAQMIADWIYQSGNPGLVGDVLTDR 266

Query: 225 HDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILS 284
           +D        I +T+  +F T  GK  IDE +P + G+Y G      V +     DL+L+
Sbjct: 267 YDATKMLNDFIQLTKMWNFTTVNGKSIIDESNPWYMGLYNGDEGVSTVIDRFHKCDLVLN 326

Query: 285 VGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIKNAT------FPGVQMKFALQKLLGSV 337
            G  +++ N G +++ YK    IVE H  Y++  +        F G+   F L++L+  +
Sbjct: 327 FGLDINEINHGHYTFKYKPNSKIVELHPTYVRFLDTEYGTERLFKGLNFVFVLKELINRI 386

Query: 338 --------AEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITETG 389
                    +                       + + Q  +   +  +L  GD+V+ ETG
Sbjct: 387 NPKECMFSYDLSVRKFCSEEIKTPEDGNDDAEASTITQNKLSKMIPDYLNPGDIVVCETG 446

Query: 390 TSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAA-------------FAAEEVDPKK 436
           +  F +     P     +SQ  + SIG    A +G               F A + + K 
Sbjct: 447 SFQFAMRDIVLPPQVKYMSQGFFLSIGTALPAAVGVGIALQDYPNQHINNFGAVDHNYKP 506

Query: 437 RVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHL 496
           R+IL  GDG+ Q+TVQE+++M+R+ +   + + NNNGYT+E+ I GPT  YN+I  WD  
Sbjct: 507 RLILLEGDGAAQMTVQELTSMIRFQIPIEIMLWNNNGYTVERAILGPTRSYNDIMPWDWT 566

Query: 497 SLLPTFGAKDYENHRVATTGEWIKLTE---------NKEFNQNSRIRLIEIMLPVMDAPS 547
            L   FG  D+E     +T   I+ T            E N++  I ++E+ L VMD P 
Sbjct: 567 KLFAAFG--DFEGKYTRSTA--IETTSKLLLKLNQLKNEGNRDI-IEMVEVKLGVMDYPH 621

Query: 548 NL 549
            L
Sbjct: 622 QL 623

>TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {ON}
           Anc_5.456 YDR380W
          Length = 675

 Score =  280 bits (717), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 196/607 (32%), Positives = 295/607 (48%), Gaps = 60/607 (9%)

Query: 2   SEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYE-----TPG--MRWAGNANELNA 54
           ++I  G Y+F+RL  V VK+IFG+PGD+N+ LL+ +Y+     T G  + W G  NELNA
Sbjct: 60  AQIPFGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVDTAGDKLEWVGCCNELNA 119

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXX-----QA 108
           AYAADGY+R    + C+ITT+GVGEL A++G+AG++AE                    + 
Sbjct: 120 AYAADGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVKVLHIVGIVDYEVNDLGPEM 179

Query: 109 KQLLLHHTLGN--------GDFTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVT 159
           +   LHH L           D+ V+  M  + ++ +   + D+ TA  ++D+ I   Y  
Sbjct: 180 RSHNLHHLLPRLNDSNFVGPDYRVYAEMVKDKVACSVEYLDDLETACDKVDKVIEDIYKY 239

Query: 160 QRPVYLGLPANLVD-LKVPASLLETP---IDLSLKANDVEAETEVVNTILELIKDAKNPV 215
            +P YL +P + VD L    +L+E P   +   ++ + V+    V   IL L+  + +P 
Sbjct: 240 SKPGYLFVPRSFVDELVSTKNLIEKPTITLRECIEKSPVDEAKIVTEKILRLLNQSASPA 299

Query: 216 ILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEA 275
           ++ D    R+ ++ E    I+      F T  GK  IDE  P + G Y G  S+P V E 
Sbjct: 300 VIGDMFTDRYGLRVELNDFINKANIVGFSTVQGKSIIDESSPLYMGAYNGMTSAPTVSEK 359

Query: 276 VESADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKI------KNATFPGVQMKF 328
           + + DL+L  G   ++ N G++++ +K+   IVE H  YI+       K   + GV    
Sbjct: 360 LLACDLVLHFGIEKNEVNYGNYNFPHKSDAKIVELHPQYIRFYDNTTKKEEIYKGVSFVD 419

Query: 329 ALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXX---------XXTPLKQEWMWNQVGKFLQ 379
            L  LL    E                                + + Q  +   +  +L 
Sbjct: 420 ILD-LLNQSPELSELSFQYNSKFKAYTIEELNLDERDFGNDETSDITQGTLQKSMPNYLN 478

Query: 380 EGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEV------D 433
            GDV+I++TGT  F I     P+    I+Q  + SIG    A LG   A  +       D
Sbjct: 479 PGDVLISDTGTFQFAIRDFSLPSQVKYITQGFYLSIGMALPAALGVGIAMRDYPMHHVWD 538

Query: 434 PKK-------RVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQ 486
            +K       +VILF GDG+ Q+TVQE+STM+R  +   +F+ NNNGYTIE++I GPT  
Sbjct: 539 VEKIPFGYEPKVILFEGDGAAQMTVQELSTMIRHQVPIEIFLWNNNGYTIERVIEGPTRP 598

Query: 487 YNEIQSWDHLSLLPTFGAKDYENHR--VATTGEWI--KLTENKEFNQNSRIRLIEIMLPV 542
           YN+IQ W    LL  FG  D ++ R  V  T   +  KL+E K  +    I  +E+ L  
Sbjct: 599 YNDIQPWKWTKLLEAFGDFDGKHSRATVLETRSQLENKLSELKYKDHRRGIDFMEVKLAT 658

Query: 543 MDAPSNL 549
           MD PS L
Sbjct: 659 MDVPSQL 665

>KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 631

 Score =  273 bits (699), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 184/599 (30%), Positives = 297/599 (49%), Gaps = 52/599 (8%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETP----GMRWAGNANELNAAY 56
           +  I  G Y+FERL     K+IFG+PGDFNL LL+ +Y+      G++W G  NELN AY
Sbjct: 29  VKNIPFGHYVFERLLNSGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGAY 88

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXX----XXXXXXXXXXQAKQL 111
           AADGY+R    + C+ITT+GVGELSALNG+AG++AE                   Q +  
Sbjct: 89  AADGYSRYTNKLGCVITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRSH 148

Query: 112 LLHHTLGNGDF-------TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVY 164
            +HH +   D          F  +   +  ++A + DI TA   +D+ I       +P Y
Sbjct: 149 NVHHLVPAIDSQQPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPGY 208

Query: 165 LGLPANLVDLKVP-ASLLETPI---DLSLKANDVEAETEVV-NTILELIKDAKNPVILAD 219
           + +P +  D  V   +L++ PI   D  +++   E  T++  + +L+ I ++  P + +D
Sbjct: 209 VFIPVDFADKLVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFSD 268

Query: 220 ACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESA 279
               R +++ E ++ I+     ++ T MGK ++DE++P++ G+Y G  +   ++  V+S+
Sbjct: 269 LLVDRFNLRKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDSS 328

Query: 280 DLILSVGALLSDFNTGSFSYSYK--------TKNIVEFHSDYIKIKNATFPGVQMKFALQ 331
           DLIL  G   ++ N G +S+ +         + NI++F    IK KNA+        ++ 
Sbjct: 329 DLILHFGPAKNEINCGYYSFHFNENARIIELSNNIIQFID--IKDKNASTVEEANFVSVL 386

Query: 332 KLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITETGTS 391
           K +    +                         + Q+ +   +  +  +GDV+I ETG+ 
Sbjct: 387 KYVNDNLDKSKLSFSYPPVPKSNHSCEYDNNDSITQKSLKEIIPNYFNDGDVLIVETGSF 446

Query: 392 AFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEE------VD----PKK---RV 438
            FG+    F      I+Q  + SIG    A LG      +      VD    PK    R+
Sbjct: 447 QFGVPNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVPKDYIPRL 506

Query: 439 ILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHLSL 498
           IL  GDG+ Q+T+QE ++ +R+ +   + V NNNGYT+E+ I+GPT  YN+I  +   +L
Sbjct: 507 ILCEGDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIAPFKWTAL 566

Query: 499 LPTFGAKDYENH-----RVATTGEWIKLTEN-KEFNQNSRIRLIEIMLPVMDAPSNLVA 551
           L  FG  D+EN       V    E ++L    K   + + I+L E+MLPVMD P  L A
Sbjct: 567 LNVFG--DFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIPQELNA 623

>TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa]
           {ON} Anc_5.456 YDR380W
          Length = 638

 Score =  271 bits (694), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 181/614 (29%), Positives = 297/614 (48%), Gaps = 74/614 (12%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIY----ETPGMRWAGNANELNAAYAAD 59
           + LG YL+ +L+Q+  KTIFG+PGDFNLSLL+ +Y    +  G++W G  NELNAAYAAD
Sbjct: 26  LPLGEYLYLKLAQIGTKTIFGVPGDFNLSLLELLYTQKVKDSGLKWVGCCNELNAAYAAD 85

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLG 118
           GY+R    + C++TT+GVGELSALNGIAG++AE                     +HH + 
Sbjct: 86  GYSRYTNRVGCVVTTYGVGELSALNGIAGAFAENIKLLHVVGVPPTKYNTLNHNIHHLVP 145

Query: 119 NGDFT--------VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPA 169
              ++        V+  M +  +    A +TD+  A  +I+  I+  +    P Y+ +P 
Sbjct: 146 RLKYSNLLAPNKEVYMEMVNEKVCCFYANITDLNQARWQIEIAIKHIFQYNLPAYIFIPT 205

Query: 170 NLVDLKVPAS---------------LLETPIDLSLKANDVEAETEVVNTILELIKDAKNP 214
           +  D  +P S               ++E P+  SL+         V + IL L+  +K P
Sbjct: 206 DFQDALIPISVNEHLSREDIMPIEEIVEIPLLPSLEM------VSVCDYILSLLYSSKTP 259

Query: 215 VILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKE 274
            I+ D    R  V  +   LI  T+  +F T M KG ++E +P + GVY G LS   + +
Sbjct: 260 CIIGDILVERFGVTKQINDLIHKTKLWNFSTFMSKGVLNESNPYYQGVYFGKLSQDHIVK 319

Query: 275 AVESADLILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDYIKIKN------ATFPGVQMK 327
            ++  DLI+  G + ++ NTG +S++YK  ++ ++ H DY++I          + G++ +
Sbjct: 320 KIQMCDLIIHFGVVENEINTGYYSFNYKPDSVLIQIHPDYVRITQFQHNIRTDYKGIEFR 379

Query: 328 FALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQE--------WMWNQVGKFLQ 379
                 +  V +                        PL+QE        ++   + +++ 
Sbjct: 380 ----TFVDMVTKGVQPNSINTTYNRLFSPSSHAYLFPLEQEEDGPISHDYLETIIPRYIN 435

Query: 380 EGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEE-------- 431
            GDVV+ ETG+  F +  T   ++   I+Q  + SIG    A LG   A  +        
Sbjct: 436 PGDVVVCETGSIQFTMVNTRLSSDVEYITQGFYLSIGMAIPASLGIGMAMRDYPNLHLSK 495

Query: 432 ------VDP--KKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGP 483
                 V P  K R+IL  GDG+ Q+TVQEI+ ++++ +   + +LNN GYTIE+ I G 
Sbjct: 496 KSSHSNVPPNYKPRLILLEGDGAAQMTVQEITNIIKYKIPIEILLLNNQGYTIERAIKGA 555

Query: 484 TAQYNEIQSWDHLSLLPTFGAKDYENHR----VATTGEWIKLTENKEFNQNSRIRLIEIM 539
             ++N+I  W+   LL   G    E        +TT  + KL + K++        +E++
Sbjct: 556 DKEFNDICEWNWPQLLNGLGGNLDETKNKYKFFSTTELYEKLKQLKDYPGKETFSFVEVI 615

Query: 540 LPVMDAPSNLVAQA 553
           L  ++ P+ L+  A
Sbjct: 616 LNKLNIPTTLIKMA 629

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score =  270 bits (689), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 180/573 (31%), Positives = 288/573 (50%), Gaps = 33/573 (5%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIY--ETPGMRWAGNANELNAAYAA 58
           MS + LG YLF RLSQV  KT+FG+PGDFNL+LL+ +Y  +   ++W GNANELNA YAA
Sbjct: 1   MSTMQLGTYLFYRLSQV-TKTVFGVPGDFNLNLLEHVYNFDESQIKWCGNANELNAGYAA 59

Query: 59  DGYARIKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLL---HH 115
           DGY+RI    C ITT+GVGELSALN ++G++AE               +     L   HH
Sbjct: 60  DGYSRINKFGCFITTYGVGELSALNAVSGAFAENAPVLHIVGTSSMLAKRGACPLNQIHH 119

Query: 116 ------TLGNGDFTVFHRMSANISETTAMVTD--IATAPAEIDRCIRTTYVTQRPVYLGL 167
                 T    D  V+ +++   S  T  ++D  +     +ID  I + +   +P YL +
Sbjct: 120 LIPPKKTYEAPDHKVYEKLAEPFSIHTESLSDENLEKIQDQIDSVIESIFCHMKPGYLFI 179

Query: 168 PANLVDLKVPASL-LETPIDLSLKAN-DVEAETEVVNTILELIKDAKNPVILADACASRH 225
           P+NL D ++P  L  +   D   K   D  A +E+V+  L+ I  ++NP  + D    R 
Sbjct: 180 PSNLPDAEIPVDLNKQLNFDFITKLRVDPHATSEMVSLTLKRIYSSRNPGFIVDQFM-RF 238

Query: 226 DVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSV 285
           D++ +    ++   F  + T   +G  DE  P F GV+   LS+    E ++  D IL +
Sbjct: 239 DLE-KLNLFLEKFNFYCYNTTTARGFADESLPNFHGVFNNELSTNGTLEILDQNDFILHL 297

Query: 286 GALLSDFNTGSF----SYSYKTKNIVEFHSDYIKI--KNATFPGVQMKFALQKLLGSVAE 339
           G   ++ N  S+    S     K+++    DY ++        G+      ++LL  +  
Sbjct: 298 G---TNINEVSYFVGGSTPLDKKDVIFIGKDYAQVGTNGHIITGINCHVFFEELLQRMNS 354

Query: 340 XXXXXXXXXXXXXXXXX--XXXXXXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQ 397
                                      + Q  +   V   L+E DV+I E  +  F +  
Sbjct: 355 KTMPKVKTRKSTALYNNGYTVDDDSKTVTQANLSQVVSAQLRENDVIINEMCSFMFEMPN 414

Query: 398 THFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTM 457
             +      + Q  +GSIG+   A LGA+ A ++     RVILF GDGS Q+T+QE+++ 
Sbjct: 415 IKYSKGCQFVGQPFYGSIGYALPATLGASLAIKDYKKSGRVILFQGDGSAQMTLQELASY 474

Query: 458 VRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNE-IQSWDHLSLLPTFGAKDYE---NHRVA 513
           +R+ + P +F+LNN+GY++E++I GPT  YN+ I  WD  ++L  FG ++ +   +++V 
Sbjct: 475 IRFEIDPIIFMLNNSGYSVERVIKGPTRSYNDIIVDWDWCNILSVFGDRNGDRSTSYKVE 534

Query: 514 TTGEWIKLTENKEFNQNSRIRLIEIMLPVMDAP 546
             GE   +   +    + +I+++EI+L  MD P
Sbjct: 535 KLGELKNVLTKRLDYSDGKIKMVEIILDRMDVP 567

>TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {ON}
           Anc_5.456 YDR380W
          Length = 651

 Score =  264 bits (674), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 180/599 (30%), Positives = 293/599 (48%), Gaps = 58/599 (9%)

Query: 2   SEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYE-----TPG-MRWAGNANELNAA 55
           + I  G+Y+F RL     K++FG+PGD+NL+LL+++Y+     TP  ++W G  NELNAA
Sbjct: 36  NRIPFGKYIFRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELNAA 95

Query: 56  YAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLH 114
           YAADGY+R    + C+ITT+GVGELSA+NGIAG++ E                      H
Sbjct: 96  YAADGYSRYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRNFH 155

Query: 115 HTLGNGD--------FTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
           H + N +        + +   M  N IS +T  + +IATA  + D  +R  +   +P +L
Sbjct: 156 HLIPNKENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPGFL 215

Query: 166 GLPANLVDLK--------VPASLLETPIDLS-LKANDVEAETEVVNTILELIKDAKNPVI 216
            +P    +L         VP   LE  I  S +  + ++  T++     +LI  +K P I
Sbjct: 216 FIPEEFSNLMVSDANLFLVPKITLEDSIIPSPISYDSIDRLTQITK---DLIYQSKRPAI 272

Query: 217 LADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAV 276
           + D    R        +LI  T   +F T MGK  I+E +  + G++ G      V + +
Sbjct: 273 IGDILVDRFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKI 332

Query: 277 ESADLILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDYIKIKNAT------FPGVQMK 327
              DLIL  G   ++ N+G ++   Y  K   I+EFHS+YIKIK+ +      +  +   
Sbjct: 333 RQCDLILHFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFI 392

Query: 328 FALQKL--LGSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVI 385
             L++L  +   ++                         + Q+++ + + K L  GD+++
Sbjct: 393 HVLKRLNKILDTSKLLFDYPYISKNIQTECSDDEKSNKVITQDYIKDAILKLLNPGDILL 452

Query: 386 TETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEE------------VD 433
            +TGT  F +     P     ISQ  + SIG    A LG     ++            + 
Sbjct: 453 CDTGTFQFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDDSIIK 512

Query: 434 PKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSW 493
            + ++IL  GDG+ Q+T+QEIST++R+ +   +F+ NN+GYTIE+ I GPT  YN+IQ W
Sbjct: 513 TQPKLILCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDYNDIQPW 572

Query: 494 DHLSLLPTF--GAKDY-ENHRVATTGEWIKL---TENKEFNQNSRIRLIEIMLPVMDAP 546
           +   L+ +F    K + + ++V    E+  L    +   FN++S +  IE+ L  +D P
Sbjct: 573 NWTMLIKSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDS-LNFIEVQLGRLDVP 630

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score =  251 bits (640), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 166/566 (29%), Positives = 261/566 (46%), Gaps = 21/566 (3%)

Query: 5   TLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL Q  +K  F +PGD+NL LLDK+ E P +      NELN ++AA+GYAR 
Sbjct: 3   TVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVNCCNELNCSFAAEGYART 62

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E                +   LLHHT+G  ++  
Sbjct: 63  KGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTNDSSDHRLLHHTIGTHNYDY 122

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLETP 184
            + M+  I+     +     AP+ ID  IR     ++P Y+ +P N+      +++   P
Sbjct: 123 QYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYIEVPTNMA-----SAICAPP 177

Query: 185 IDLSLKANDVEAETEV----VNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240
             +S   N V    +V    VN  ++ I     P +LA       D +    +L +  + 
Sbjct: 178 GPISSLVNSVPTPKDVLSQAVNASVDFINSHLKPTLLAGPKLKCADAQKAFLRLAEALKC 237

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
              V P  K    E HP+F GVY G +S+      +E +DL +  G + +D++T  ++  
Sbjct: 238 AVAVQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTICAGCIFTDYSTTGWTAL 297

Query: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXX-XXXXXX 359
             + + +E  +D ++    +F  + +   L  L   V+E                     
Sbjct: 298 QPSSHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKSLIEYNRLRQSPPLIKAA 357

Query: 360 XXXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTT 419
                + ++ M  Q+ + +     +  ETG S F   Q   P       ++ WG IG++ 
Sbjct: 358 DPKAAITRKEMARQIQQLITPKTTLFAETGDSWFNGVQMDLPKGALFEVEMQWGHIGWSV 417

Query: 420 GACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKL 479
            A LG A  A    P +R+I  +GDGS Q+T QE+S MVR      +F++NN GYTIE  
Sbjct: 418 PASLGYAVGA----PDRRIITMVGDGSFQMTAQEVSLMVRLRKPIIIFLINNYGYTIEVE 473

Query: 480 IH-GPTAQYNEIQSWDHLSLLPTFGAKD--YENHRVATTGEWIKLTENKEFNQNSRIRLI 536
           IH GP   YN I++W++ +L+  F A +   +  +  T GE     E  + N  S   LI
Sbjct: 474 IHDGP---YNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAIEKAQANV-SGPTLI 529

Query: 537 EIMLPVMDAPSNLVAQAQLTAKINAK 562
           EI +   D  + L+      A  NA+
Sbjct: 530 EIQINRDDCTNELITWGHFVALANAR 555

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score =  239 bits (610), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 163/566 (28%), Positives = 265/566 (46%), Gaps = 21/566 (3%)

Query: 5   TLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RLS+V ++  F +PGD+NL+LLDK+   P +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E                    LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLETP 184
              M+  I+     +     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 IDLSLKANDVEAE--TEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 242
           I+  L  +  E +  T  V+   +LI     P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP++ GVY G +S+      ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXX 362
             + +E  SD +K  +  +  +++   L  L   V++                       
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVPPAIKAAEP 360

Query: 363 T-PLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGA 421
           +  + ++ M  Q+   +     +  ETG S F   Q   P       ++ WG IG++  A
Sbjct: 361 SAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWSVPA 420

Query: 422 CLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIH 481
           C G +  A    P + ++  +GDGS Q+TVQE++ M+R      +F++NN GYTIE  IH
Sbjct: 421 CFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEVEIH 476

Query: 482 -GPTAQYNEIQSWDHLSLLPTFGAKD--YENHRVATTGEWIKLTEN-KEFNQNSR-IRLI 536
            GP   YN I++W++ +L+  F A D   +  +V T  E   L+E  K+   N+R   LI
Sbjct: 477 DGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAE---LSEAIKKAKSNTRGPTLI 530

Query: 537 EIMLPVMDAPSNLVAQAQLTAKINAK 562
           EI +   D  + L++     A  NA+
Sbjct: 531 EIQINRDDCTNELISWGHYVALANAR 556

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  239 bits (610), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 161/565 (28%), Positives = 263/565 (46%), Gaps = 19/565 (3%)

Query: 5   TLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RLS+V ++  F +PGD+NL+LLDK+   P +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E                    LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLETP 184
              M+  I+     +     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 IDLSLKANDVEAE--TEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 242
           I+  L  +  E +  T  V+   +LI     P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP++ GVY G +S+      ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXX 362
             + +E  SD +K  +  +  +++   L  L   V++                       
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVPPAIKAAEP 360

Query: 363 T-PLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGA 421
           +  + ++ M  Q+   +     +  ETG S F   Q   P       ++ WG IG++  A
Sbjct: 361 SAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWSVPA 420

Query: 422 CLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIH 481
           C G +  A    P + ++  +GDGS Q+TVQE++ M+R      +F++NN GYTIE  IH
Sbjct: 421 CFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEVEIH 476

Query: 482 -GPTAQYNEIQSWDHLSLLPTFGAKD--YENHRVATTGEWIKLTENKEFNQNSR-IRLIE 537
            GP   YN I++W++ +L+  F A D   +  +V T  E  +    K+   N+R   LIE
Sbjct: 477 DGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELAEAI--KKAKSNTRGPTLIE 531

Query: 538 IMLPVMDAPSNLVAQAQLTAKINAK 562
           I +   D  + L++     A  NA+
Sbjct: 532 IQINRDDCTNELISWGHYVALANAR 556

>NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa]
           {ON} Anc_5.456
          Length = 561

 Score =  232 bits (591), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 166/554 (29%), Positives = 264/554 (47%), Gaps = 57/554 (10%)

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLL---- 112
           ADG++R    + C+ITT+GVGELSALNGIAG+++E                  Q      
Sbjct: 3   ADGFSRYSNKIGCLITTYGVGELSALNGIAGAFSENVKVLHIVGVARSVHSRSQDYNNQN 62

Query: 113 LHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPV 163
           LHH    L + +F      V+  M  + ++ +   + DI TA  E+D+ I   Y   +P 
Sbjct: 63  LHHLVPRLHDSNFVGPNHKVYLEMIKDRVACSVTYLEDINTACDEVDKVIMDIYRYSKPG 122

Query: 164 YLGLPANLVDLKV-PASLLETPIDLSLKANDVEAET----EVVNTILELIKDAKNPVILA 218
           Y+ +P +  D+ V P++L + P +++L+     A +    E+V  +L+ I ++K P I+ 
Sbjct: 123 YVFVPVDFSDMLVDPSNLFKRP-EITLENCVSYAPSPVVDELVRMVLQYIYESKCPSIIG 181

Query: 219 DACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVES 278
           D    R    +    LI +T   +F T MGK  IDE +  + G+Y G  S   V E    
Sbjct: 182 DVLCDRFGASSMVNNLIQLTSMWNFATVMGKSIIDESNVMYMGLYNGNESIETVTERFLQ 241

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIKNAT------FPGVQMKFALQ 331
           +DL+L  G  + + N G ++ +YK    ++EFHS+YI+  +A+      F GV     L+
Sbjct: 242 SDLVLHFGIQVHEINNGHYTINYKEDAKVIEFHSEYIRFFDASTGNEKVFKGVNFVQVLE 301

Query: 332 KLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXTP-----LKQEWMWNQVGKFLQEGDVVIT 386
           +L+ ++                          P     + Q ++   V  +L  GDV++ 
Sbjct: 302 RLIQTINVNKLNFEYPSNIEKFATDEVNLPTEPTEITKVTQNYLQKSVPHYLNPGDVLVC 361

Query: 387 ETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEV-------------- 432
           ETG+  F I     P+    I+Q  + SIG    A  G   A ++               
Sbjct: 362 ETGSFQFAIRDFVLPSQLKYITQGFFLSIGMALPAAFGVGIAMQDYPRCHISKDHPSHVE 421

Query: 433 ---DPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNE 489
              D + R+IL  GDG+ Q+T+QE+++MVR+ +   + +LNNNGYTIE+ I GPT  YN+
Sbjct: 422 IPDDYEPRLILIEGDGAAQMTIQELTSMVRFQVPIEIMILNNNGYTIERAIRGPTRSYND 481

Query: 490 IQSWDHLSLLPTFGAKDYENHRVAT------TGEWIKLTENKEFNQNSRIRLIEIMLPVM 543
           + SWD   LL  FG  D++  R  +      +   +KL + K   + + I L+EI L  M
Sbjct: 482 VMSWDWTKLLEAFG--DFKKQRTVSAKIETRSKLAMKLKQLKNKGKLNLIELVEIKLDTM 539

Query: 544 DAPSNLVAQAQLTA 557
           D P  L +     A
Sbjct: 540 DFPKQLQSMVDAAA 553

>Skud_7.383 Chr7
           complement(638760..638846,638850..638882,638886..638903,
           638917..639036) [258 bp, 86 aa] {ON} YGR087C (REAL)
          Length = 86

 Score = 84.3 bits (207), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 56/92 (60%), Gaps = 6/92 (6%)

Query: 386 TETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKKRVILFIGDG 445
           TETG S    NQ     + + ISQVLW  I F  GA L    +AE++DP  R ILF GD 
Sbjct: 1   TETGASTLASNQAILLKDAHDISQVLWRPIRFANGATL----SAEDIDPG-RAILFSGDR 55

Query: 446 SLQLTVQEISTMVRWNLKPYLFVLNNNGYTIE 477
            L LTVQE+ T +RW LKPYLFV NN+   +E
Sbjct: 56  PL-LTVQEMPTTIRWRLKPYLFVPNNDKRHVE 86

>YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}
           ILV2Acetolactate synthase, catalyses the first common
           step in isoleucine and valine biosynthesis and is the
           target of several classes of inhibitors, localizes to
           the mitochondria; expression of the gene is under
           general amino acid control
          Length = 687

 Score = 75.9 bits (185), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 82/312 (26%), Positives = 131/312 (41%), Gaps = 34/312 (10%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +S+ +V T+FG PG   L + D I+ +    +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A ++A+                         +G   F
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTS----------AIGTDAF 201

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   MV  +   P  I+      T     PV + LP +     V A+
Sbjct: 202 QEADVVGISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAA 256

Query: 180 LLETPI------------DLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRH-D 226
           +L  PI             L+ +A D E   + +N   +LI  AK PV+   A    H D
Sbjct: 257 ILRNPIPTKTTLPSNALNQLTSRAQD-EFVMQSINKAADLINLAKKPVLYVGAGILNHAD 315

Query: 227 VKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVG 286
                K+L D  Q P   T  G GS D++ P+   + +G         AV++ADLI++VG
Sbjct: 316 GPRLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAVQNADLIIAVG 374

Query: 287 ALLSDFNTGSFS 298
           A   D  TG+ S
Sbjct: 375 ARFDDRVTGNIS 386

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P+  VI   GD S  +T+ E+S+ V+      + +LNN
Sbjct: 520 GGLG-TMGYGLPAAIGAQVAKPESLVIDIDGDASFNMTLTELSSAVQAGTPVKILILNN 577

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 132/301 (43%), Gaps = 20/301 (6%)

Query: 7   GRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + + +V T+FG PG   L + D IY +   ++    +E  A + A+GYAR  G
Sbjct: 95  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSDAFKFVLPKHEQGAGHMAEGYARASG 154

Query: 67  MS-CIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTVF 125
            +  ++ T G G  + +  +A + A+                         +G   F   
Sbjct: 155 KTGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTS----------AIGTDAFQEA 204

Query: 126 H--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVD--LKVPASL 180
               +S + ++   MV  +A  P  I+         +  PV + LP ++    L+ P  +
Sbjct: 205 DVVGISRSCTKWNVMVRSVAELPLRINEAFEIANSGRPGPVLVDLPKDVTAAILRNPIPI 264

Query: 181 LET-PIDLSLKANDVEAET-EVVNTILELIKDAKNPVI-LADACASRHDVKAETKKLIDI 237
             T PI   LK+   EA T E +N   +LI  AK PV+ + +   +  D     K+L D 
Sbjct: 265 KSTLPITSQLKSVAEEAYTMESINRAADLINLAKRPVLYVGNGIMNNPDGPRLLKELSDR 324

Query: 238 TQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSF 297
            Q P   T  G G+ D++ P+   + +G         A+++ADL++++GA   D  TG+ 
Sbjct: 325 AQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLVIALGARFDDRVTGNI 383

Query: 298 S 298
           +
Sbjct: 384 A 384

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P   VI   GD S  +T+ E+S+ V+  +   + +LNN
Sbjct: 518 GGLG-TMGYGLPAAIGAQVARPDAIVIDIDGDASFNMTLTELSSAVQAGVPIKILLLNN 575

>Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 130/311 (41%), Gaps = 32/311 (10%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +S+ +V T+FG PG   L + D I+ +    +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A ++A+                         +G   F
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTT----------AIGTDAF 201

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   MV  +   P  I+      T     PV + LP +     V A+
Sbjct: 202 QEADVVGISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAA 256

Query: 180 LLETPI--DLSLKANDVEAET---------EVVNTILELIKDAKNPVILADACASRH-DV 227
           +L  PI    +L +N +   T         + +N   +LI  AK PV+   A    H D 
Sbjct: 257 ILRNPIPTKTTLPSNALNQLTSHTQDEFVMQSINKAADLINLAKKPVLYVGAGILNHIDG 316

Query: 228 KAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGA 287
               K+L    Q P   T  G GS D++ P+   + +G         A+++ADLI++VGA
Sbjct: 317 PRLLKELSGRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGA 375

Query: 288 LLSDFNTGSFS 298
              D  TG+ S
Sbjct: 376 RFDDRVTGNIS 386

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P+  VI   GD S  +T+ E+S+ V+      + VLNN
Sbjct: 520 GGLG-TMGYGLPAAIGAQVAKPESLVIDIDGDASFNMTLTELSSAVQAGTPVKILVLNN 577

>NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.441
           YMR108W
          Length = 684

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 116/515 (22%), Positives = 195/515 (37%), Gaps = 82/515 (15%)

Query: 7   GRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + + +V T+FG PG   L + D IY +    +    +E  A + A+GYAR  G
Sbjct: 92  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSEAFNFVLPKHEQGAGHMAEGYARASG 151

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+                         +G   F   
Sbjct: 152 KPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTS----------AIGTDAFQEA 201

Query: 126 H--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPASLLE 182
               +S + ++   MV  +A  P  I+         +  PV + LP +     V A++L 
Sbjct: 202 DVVGISRSCTKWNVMVKSVAELPLRINEAFEIAMSGRPGPVLVDLPKD-----VTAAILR 256

Query: 183 TPIDL-------------SLKANDVEAETEVVNTILELIKDAKNPVI-LADACASRHDVK 228
            PI +             S+   D  A++  +N   +LI  AK PV+ + +   +  D  
Sbjct: 257 EPIPIKSTLPSGTLTQIKSIAQEDFLADS--INRAADLINLAKKPVLYVGNGIFNNEDGP 314

Query: 229 AETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGAL 288
              K+L +  Q P   T  G G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 315 RLLKELSERAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAVGAR 373

Query: 289 LSDFNTGSFSYSYKTKNIVEFHSDYIKIKNATFPGVQMKFALQ-KLLGSVAEXXXXXXXX 347
             D  TG         NI +F  +  +  N    G+ + F +  K +  V E        
Sbjct: 374 FDDRVTG---------NIAKFAPEARRAANEGRGGI-IHFEISPKNINKVVEAQVAVEGD 423

Query: 348 XXXXXXXXXXXXXXXTPLKQEWMW----NQVGK-----FLQE------------------ 380
                           P+K+   W    NQ  K     +++E                  
Sbjct: 424 AAANIDKMLPAIF---PIKERTEWFKEINQWKKDYPYDYMKEVPGGKLKPQTVISKLSKV 480

Query: 381 ----GDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKK 436
               G  VI  TG     +         +  S +  G +G T G  L +A  A+   P+ 
Sbjct: 481 ANATGRPVIVTTGVGQHQMWTAQHWTWKHPRSFITSGGLG-TMGYGLPSAIGAQVAHPEA 539

Query: 437 RVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
            VI   GD S  +T+ E+S+ V+      + +LNN
Sbjct: 540 LVIDIDGDASFNMTLTELSSAVQAGTPVKIMILNN 574

>KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/311 (24%), Positives = 136/311 (43%), Gaps = 32/311 (10%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D IY++   ++    +E  A + A+GYAR
Sbjct: 87  LTGGQIFNEMMARHNVDTVFGYPGGAILPVYDAIYQSKNFKFVLPKHEQGAGHMAEGYAR 146

Query: 64  IKGMSCII-TTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G   I+  T G G  + +  +A + A+                         +G   F
Sbjct: 147 ASGKPGIVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTT----------AIGTDAF 196

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   M+ ++A  P  I+      T     PV + LP +     V A+
Sbjct: 197 QEADVVGISRSCTKWNVMIKNVAELPVRINEAFEIATSGRPGPVLVDLPKD-----VTAA 251

Query: 180 LLE--TPIDLSLKANDV-----EAETEVV----NTILELIKDAKNPVI-LADACASRHDV 227
           +L    P+  SL +N +     +A+ E V    N   +LI  AKNPV+ +        D 
Sbjct: 252 ILRDAIPVGSSLPSNALSQLTNKAQDEFVLDNINKAADLINLAKNPVLYVGGGILGNEDG 311

Query: 228 KAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGA 287
               K+L +  Q P   + +G G+ D++ P+   + +G         A+++ADLI+++G 
Sbjct: 312 PKLLKQLSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAIGT 370

Query: 288 LLSDFNTGSFS 298
              D  TG+ +
Sbjct: 371 RFDDRVTGNIA 381

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P   VI   GD S  +T+ E+S+ V+      + +LNN
Sbjct: 515 GGLG-TMGYGLPAAIGAQVAKPDALVIDIDGDASFNMTLTELSSAVQAGAPVKILLLNN 572

>KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {ON}
           Anc_2.441 YMR108W
          Length = 693

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 134/312 (42%), Gaps = 33/312 (10%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +S+ +V T+FG PG   L + D IY +   ++    +E  A + A+GYAR
Sbjct: 97  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIYGSENFKFVLPKHEQGAGHMAEGYAR 156

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+                       + +G   F
Sbjct: 157 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPT----------NAIGTDAF 206

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPAS 179
                  +S + ++   MV ++A  P  I+         +  PV + LP +     V A+
Sbjct: 207 QEADVVGISRSCTKWNVMVKNVAELPKRINEAFEIAMSGRPGPVLVDLPKD-----VTAA 261

Query: 180 LLET--PIDLSLKANDVEAET----------EVVNTILELIKDAKNPVI-LADACASRHD 226
           +L    P + +L + +  A T            +N   +LI  AK PV+ + +   +  D
Sbjct: 262 VLREAIPTESTLPSLNGGATTGATVFDEFLAPAINKAADLINLAKKPVLYVGNGILNNED 321

Query: 227 VKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVG 286
                K+L D  Q P   T  G G+ D++ P+   + +G         A+++ADLI++VG
Sbjct: 322 GPRLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVG 380

Query: 287 ALLSDFNTGSFS 298
           A   D  TG+ +
Sbjct: 381 ARFDDRVTGNIT 392

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 410 VLWGSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVL 469
           V  G +G T G  L AA  A+   P   VI   GD S  +T+ E+S+ V+      + +L
Sbjct: 523 VTSGGLG-TMGFGLPAAIGAQVAKPDAMVIDIDGDASFNMTLTELSSAVQAGTPVKILLL 581

Query: 470 NN 471
           NN
Sbjct: 582 NN 583

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 134/309 (43%), Gaps = 28/309 (9%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+ +   ++    +E  A + A+GYAR
Sbjct: 82  LTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYAR 141

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+                    +        D 
Sbjct: 142 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTA-----IGTDAFQEADI 196

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASLL 181
               R   + ++   MV ++A  P  I+   +  T     PV + LP +     V A++L
Sbjct: 197 VGISR---SCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLPKD-----VTAAIL 248

Query: 182 ETPIDL--SLKANDVEAET---------EVVNTILELIKDAKNPVI-LADACASRHDVKA 229
            TPI +  +L +  ++  T         E +    +LI  AKNPV+ +     +  D   
Sbjct: 249 RTPIPVKSTLPSTALQQLTAGVQDQFVIENIKKSADLINIAKNPVLYVGGGILNNVDGPR 308

Query: 230 ETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALL 289
             K+L +  Q P   T  G G+ D++ P+   + +G         AV+++DLI++VGA  
Sbjct: 309 LVKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNSDLIIAVGARF 367

Query: 290 SDFNTGSFS 298
            D  TG+ +
Sbjct: 368 DDRVTGNIT 376

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L +A  A+   P   VI   GD S  +++QE+S+ V+ N    + VLNN
Sbjct: 510 GGLG-TMGYGLPSAIGAQVAKPDALVIDIDGDASFNMSLQELSSAVQANAPVKILVLNN 567

>Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 127/304 (41%), Gaps = 32/304 (10%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +S+ +V T+FG PG   L + D I+ +    +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIHNSDKFTFVLPRHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A ++A+                         +G   F
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTS----------AIGTDAF 201

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   MV  +   P  I+      T     PV + LP +     V A+
Sbjct: 202 QEADVVGISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAA 256

Query: 180 LLETPI--DLSLKANDVEAET---------EVVNTILELIKDAKNPVILADACASRH-DV 227
           +L  PI    +L +N +   T         + +N   +LI  AK PV+   A    H D 
Sbjct: 257 ILRNPIPTKTTLPSNALNQLTSRTQDEFVLQNINKAADLINLAKKPVLYVGAGILNHADG 316

Query: 228 KAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGA 287
               K+L D  Q P   T  G G+ D++ P+   + +G         AV++ADL+++VGA
Sbjct: 317 PRLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLLIAVGA 375

Query: 288 LLSD 291
              D
Sbjct: 376 RFDD 379

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P   VI   GD S  +T+ E+S+ V+      + VLNN
Sbjct: 520 GGLG-TMGYGLPAAIGAQVAKPDSLVIDIDGDASFNMTLTELSSAVQAGTPVKILVLNN 577

>TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.441
           YMR108W
          Length = 710

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 129/310 (41%), Gaps = 23/310 (7%)

Query: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60
           M  +T G    E + + +V T+FG PG   L + D IY +   ++    +E  A + A+G
Sbjct: 111 MIGMTGGEIFNEMMRRKNVDTVFGYPGGAILPVYDAIYNSENFKFVLPRHEQGAGHMAEG 170

Query: 61  YARIKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGN 119
           YAR  G    ++ T G G  + +  +A + A+                         +G 
Sbjct: 171 YARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTS----------AIGT 220

Query: 120 GDFTVFH--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVD--L 174
             F       +S + ++   MV  +   P  I+         +  PV + LP ++    L
Sbjct: 221 DAFQEADVIGISRSCTKWNVMVKSVDELPKRINEAFEIAMSGRPGPVLIDLPKDVTAAVL 280

Query: 175 KVPASLLETPIDLSLKAN-----DVEAETEVVNTILELIKDAKNPVILADA-CASRHDVK 228
           K P  +L   +  +  +N       +  +E +    +LI  AK PVI A A   S  +  
Sbjct: 281 KNPIPVLNNSLPYTAISNINQIIQRKFLSENIQETAKLINMAKKPVIYAGAGILSNLNGP 340

Query: 229 AETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGAL 288
              K+L + +Q P   T    G+ D+Q P+   + +G   S     A+++ADLI+++G  
Sbjct: 341 TLLKELSERSQIPVTTTLQALGAFDQQDPKSLDM-LGMHGSAVANLAIQNADLIIALGGR 399

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 400 FDDRVTGNIS 409

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P+  VI   GD S  +T+ E+S+ V+ N    + +LNN
Sbjct: 543 GGLG-TMGYGLPAAIGAQVAFPEALVIDIDGDASFNMTLTELSSAVQANTPIKIMLLNN 600

>Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W
           (ILV2) - acetolactate synthase [contig 54] FULL
          Length = 679

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 127/302 (42%), Gaps = 34/302 (11%)

Query: 7   GRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + +  V T+FG PG   L++ D IY +    +    +E  A + A+GYAR  G
Sbjct: 87  GQIFHEMMRRHKVDTVFGYPGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYARASG 146

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+                        ++G   F   
Sbjct: 147 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAFQEA 196

Query: 126 H--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRP--VYLGLPANLVDLKVPASLL 181
               +S + ++   MV  +   P  I+       V+ RP  V + LP +     V +++L
Sbjct: 197 DVIGISRSCTKWNVMVKTVEELPRRINEAFEIA-VSGRPGPVLVDLPKD-----VTSAIL 250

Query: 182 ETPIDLS-----------LKANDVEAETEVVNTILELIKDAKNPVI-LADACASRHDVKA 229
           +TPI ++            KA   E     +  + +LI  AK P++ +      R D   
Sbjct: 251 KTPIPVNSTLPFDALSKLTKATAQEFTKANIQKVADLINIAKKPLLYVGGGIFGREDGPK 310

Query: 230 ETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALL 289
             ++L D  Q P   T  G G+ D++ P+   + +G   S     +V++ADLI+++GA  
Sbjct: 311 LLRQLADRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARF 369

Query: 290 SD 291
            D
Sbjct: 370 DD 371

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P   VI   GD S  +T+ E+S+ V+      + VLNN
Sbjct: 512 GGLG-TMGYGLPAAIGAQVAKPDALVIDIDGDASFNMTLMELSSAVQAGAPVKILVLNN 569

>SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 679

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 128/311 (41%), Gaps = 32/311 (10%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + +  V T+FG PG   L + D IY +    +    +E  A + A+GYAR
Sbjct: 84  LTGGQIFHEMMQRHKVDTVFGYPGGAILPVYDAIYNSNAFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+                         +G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVSTT----------AIGTDAF 193

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   MV  I   P  I+      T     PV + LP +     V A+
Sbjct: 194 QEADVVGISRSCTKWNVMVKSIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 248

Query: 180 LLETPI--------DLSLKANDVEAETEVVNTIL---ELIKDAKNPVILADACASRHDVK 228
           +L  PI        D  L+      +   +N+I    +LI  AK P++        H+  
Sbjct: 249 VLRNPIPTKSTLPSDALLQITKRAVDEFTMNSIAKASDLINVAKKPLLYVGGGILGHENG 308

Query: 229 AE-TKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGA 287
            +  K+L +  Q P   T  G G+ D++ P+   + +G   S A   AV++ADLI+++GA
Sbjct: 309 PKFLKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGSAAANTAVQNADLIIALGA 367

Query: 288 LLSDFNTGSFS 298
              D  T + S
Sbjct: 368 RFDDRVTCNIS 378

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P   V+   GD S  +T+ E+S+ V+      + +LNN
Sbjct: 512 GGLG-TMGFGLPAAIGAQVAKPDAIVVDIDGDASFNMTLMELSSAVQARAPVKILLLNN 569

>TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {ON}
           Anc_1.450 YEL020C
          Length = 555

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 105/490 (21%), Positives = 183/490 (37%), Gaps = 55/490 (11%)

Query: 9   YLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARIKGM- 67
           Y  + L Q  V T+FG+ G   + L D +    G+++    NE +A+YAA  Y  + G  
Sbjct: 8   YFTQLLQQYGVDTVFGIVGIPIVELADTMIGK-GIKFIACRNEQSASYAASAYGYLTGKP 66

Query: 68  SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTVFHR 127
             ++   G G + AL GI  S +                          L  G F    +
Sbjct: 67  GVLLVVGGPGLIHALAGIYNSMSNRWPLIVIAGSS------------EDLHKGGFQELDQ 114

Query: 128 MSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLETPIDL 187
           +S  +S+       + T P  I+     TY   R    G P  +  +  P SL+   I+ 
Sbjct: 115 VSL-LSDHLKFTGKLTTDPDVIEL---VTYNAMRLTTTGTPG-VTYIDFPGSLISESIER 169

Query: 188 S------LKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFP 241
           S      +       +TE +  +++L+   +N  IL        +   E +KLI+    P
Sbjct: 170 SPYPVQSISRIQYMPDTESLQRVVKLLSSDQNKRILVVIGKGAVNASNEVRKLINDYNLP 229

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLS----------- 290
              TPM KG + + HP          +S A  +A++ A+++L +GA L+           
Sbjct: 230 FLSTPMAKGVVPDSHP--------LNASSARSKALKEAEIVLVLGARLNWILHFGAPPKW 281

Query: 291 DFNTGSFSYSYKTKNIVEFHSDYIKIKNATFPGVQMKFALQKL-LGSVAEXXXXXXXXXX 349
           D NT         +++ + +   +        G+ +K  ++KL L   A           
Sbjct: 282 DANTIFIQVDCDPESLGQNNQRGVGYSLCGDIGLTVKSLIEKLKLERWAYQGLSRELRSA 341

Query: 350 XXXXXXXXXXXXXTPLKQEWMWNQVGKFLQ----EGDVVITETGTSAFGINQTHFPNN-- 403
                                +N+V + L+    +   +I   G +     +  FP +  
Sbjct: 342 IKLNHEKLAKKEQIVHHGRLNYNKVYQCLRTFIDDSRTIIVSEGANTMDQARISFPTDYP 401

Query: 404 TYGISQVLWGSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLK 463
            + +      ++G   G  + A  A     P K ++L  GD +   +  EI T VR  L 
Sbjct: 402 KHRLDAGTNATMGIGLGYAIAAKIA----RPDKSIVLLQGDSAFGFSAMEIETAVRNRLG 457

Query: 464 PYLFVLNNNG 473
             + V+NN+G
Sbjct: 458 LVIIVMNNSG 467

>TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {ON}
           Anc_2.441 YMR108W
          Length = 691

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 125/304 (41%), Gaps = 32/304 (10%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G    E + + +V T+FG PG   L + D IY +    +    +E  A + A+GYAR
Sbjct: 94  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 153

Query: 64  IKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  IA + A+                         +G   F
Sbjct: 154 ASGKCGVVLVTSGPGATNVITPIADALADGVPMVVFTGQVPTA----------AIGTDAF 203

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   MV  I   P  I+      T     PV + LP +     V AS
Sbjct: 204 QEADVIGISRSCTKWNVMVKRIEDLPKCINEAFEIATSGRPGPVLVDLPKD-----VQAS 258

Query: 180 LLETPIDL--SLKANDVEAETEVVNTIL---------ELIKDAKNPVI-LADACASRHDV 227
           +L+TPI +  ++ +N +   T  V T           ELI  AK P++ +     +  + 
Sbjct: 259 ILKTPIPIKTTIPSNALRHLTRNVQTQFSEVAIKRAAELINIAKKPILYVGGGILNNPEG 318

Query: 228 KAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGA 287
               K+L D  Q P   T    G+ D++ P+   + +G         A+++ADLI++VGA
Sbjct: 319 PRLIKELSDRAQIPVTTTLQALGAFDQEDPKSLDM-LGMHGHAPANLAMQNADLIIAVGA 377

Query: 288 LLSD 291
              D
Sbjct: 378 RFDD 381

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P   VI   GD S  +T+ E+S+ V+      + +LNN
Sbjct: 524 GGLG-TMGYGLPAAIGAQVARPDAIVIDIDGDASFNMTLTELSSAVQAGTPIKILLLNN 581

>KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {ON}
           Anc_2.441 YMR108W
          Length = 680

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 130/309 (42%), Gaps = 30/309 (9%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I+E+   ++    +E  A + A+GYAR
Sbjct: 84  MTGGQIFHEMMIRNNVDTVFGYPGGAILPVYDAIHESSAFKFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLH-HTLGNGD 121
             G    ++ T G G  + +  +A + A+                          LG   
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVLG--- 200

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPASL 180
                 +S + ++   MV ++A  P  I+         +  PV + LP +     V A++
Sbjct: 201 ------ISRSCTKWNIMVKNVAEMPKRINEAFDIAMSGRPGPVLVDLPKD-----VTAAI 249

Query: 181 LETPIDL----------SLKANDVEAET-EVVNTILELIKDAKNPVI-LADACASRHDVK 228
           L  PI +          +L  +  +A T E +    +LI  AK PV+ +     +  +  
Sbjct: 250 LRNPIPVESTLPTSTLKNLVGDMHDAFTKERIEKAAKLINIAKKPVLYVGGGILNNPEGP 309

Query: 229 AETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGAL 288
              K L D  Q P   T  G G+ D++ P+   + +G   S     ++++ADLI+++G  
Sbjct: 310 KLLKTLSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAVANLSIQNADLIIAIGTR 368

Query: 289 LSDFNTGSF 297
             D  TG+ 
Sbjct: 369 FDDRVTGNL 377

>KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]
           {ON} highly similar to uniprot|P07342 Saccharomyces
           cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
           the first common step in isoleucine and valine
           biosynthesis and is the target of several classes of
           inhibitors localizes to the mitochondria expression of
           the gene is under general amino acid control
          Length = 691

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 124/530 (23%), Positives = 193/530 (36%), Gaps = 106/530 (20%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G    E + + +V T+FG PG   L + D IY +    +    +E  A + A+GYAR
Sbjct: 96  MTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFTFVLPKHEQGAGHMAEGYAR 155

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+                A   +        D 
Sbjct: 156 ASGKPGVVLVTSGPGATNVVTPMADALADGVPLVVFTGQV-----ATSAIGTDAFQEADV 210

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASLL 181
               R   + ++   MV  I   P  I+      T     PV + LP +     V A++L
Sbjct: 211 VGISR---SCTKWNVMVKTIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAVL 262

Query: 182 ETPIDL-SLKANDV----------EAETEVVNTILELIKDAKNPVILADACASRHDVKAE 230
             PI + S+  +D           E   E ++   +LI  AK P++   A     ++  +
Sbjct: 263 RNPIPMKSILPSDTLNQLTQRVVDEFTLENISRAADLINRAKKPLLYVGAGILGSEMGPQ 322

Query: 231 -TKKLIDITQFPSFVTPMGKGSID-EQHPRFGGVYVGTLSSPAVKEAVESADLILSVGAL 288
             K+L D  Q P   T  G G+ + E H       VG   + A   A+++ADLI+++GA 
Sbjct: 323 YLKQLSDRAQIPVTTTLQGLGAFNQEDHKSLD--MVGMHGNAAANLAIQNADLIIALGAR 380

Query: 289 LSD---FNTGSFSYSY------KTKNIVEFHSDYIKIKNATFPGVQMK----FALQKLLG 335
             D    N   F+         K   IV F      I       V ++      L+KLL 
Sbjct: 381 FDDRVTLNISKFAPEARKAALEKRGGIVHFEISPKNINKVVEAEVAVEGDVTRNLEKLLP 440

Query: 336 SVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQE--------------- 380
            V                          P + EW   QV K+ QE               
Sbjct: 441 LV-----------------------ESVPERPEWS-AQVAKWKQEYPYAYQKETPGSKIK 476

Query: 381 --------GDVVITETGTSAF---GINQTHFPNNTYGISQVLWGSI-GFTTGACLG---- 424
                    D+V+ ++G  A    G+ Q    +  +      W S   F T   LG    
Sbjct: 477 PQTVISKLSDLVL-KSGRPAIVTTGVGQ----HQMWAAQHWTWKSPRSFITSGGLGTMGY 531

Query: 425 ---AAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
              AA  A+   P   VI   GD S  +T+ E+S+ V+      + +LNN
Sbjct: 532 GLPAAIGAQVARPDAIVIDIDGDASFNMTLMELSSAVQARTPVKVLLLNN 581

>Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}
           complement(20788..22803) [2016 nt, 672 aa]
          Length = 671

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 130/311 (41%), Gaps = 32/311 (10%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G    E + + +V T+FG PG   L + D IY +   ++    +E  A + A+GY+R
Sbjct: 76  LTGGEIFHEMMIRNNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQGAGHMAEGYSR 135

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+                         +G   F
Sbjct: 136 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTS----------AIGTDAF 185

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   MV  +   P  I+      T     PV + LP +     V A+
Sbjct: 186 QEADVIGISRSCTKWNVMVKSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 240

Query: 180 LLETPIDL--SLKANDV---------EAETEVVNTILELIKDAKNPVILADACASRHDVK 228
           +L  PI +  +L +N +         E   E ++    LI  AK PV+        H+  
Sbjct: 241 ILRNPIPVNSTLPSNALNQLVKNAHNEFTEESLSKAASLINIAKRPVLYVGGGILNHEEG 300

Query: 229 AET-KKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGA 287
               ++L +  Q P   + +G G+ D++ P+   +      +PA   A+++ADLI++VGA
Sbjct: 301 PRLLRELSERAQIPVTTSLLGLGAFDQEDPKSLDMLGMHGHAPA-NLAIQNADLIIAVGA 359

Query: 288 LLSDFNTGSFS 298
              D  TG+ +
Sbjct: 360 RFDDRVTGNIA 370

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G++GF   + +GA  A     P   VI   GD S  +T+ E+++ V+ +    + +LNN
Sbjct: 507 GTMGFGLPSAIGAQVA----KPDSMVIDIDGDASFNMTLMEMTSAVQASAPVKVLLLNN 561

>Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 126/305 (41%), Gaps = 34/305 (11%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +S+ +V T+FG PG   L + D I+ +    +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A ++A+                         +G   F
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTS----------AIGTDAF 201

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   MV  +   P  I+      T     PV + LP +     V A+
Sbjct: 202 QEADVVGISRSCTKWNVMVKTVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAA 256

Query: 180 LLETPI------------DLSLKANDVEAETEVVNTILELIKDAKNPVILADA-CASRHD 226
           +L  PI             L+  A D E   + ++   +LI  AK PV+   A   +  D
Sbjct: 257 ILRNPIPTKTTLPSNALNQLTSHAQD-EFVMQSISKAADLINLAKKPVLYVGAGILNNAD 315

Query: 227 VKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVG 286
                K+L +  Q P   T  G GS D++ P+   + +G         AV++ADL+++VG
Sbjct: 316 GPRLLKELSERAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCVTANLAVQNADLLIAVG 374

Query: 287 ALLSD 291
           A   D
Sbjct: 375 ARFDD 379

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L +A  A+   P+  VI   GD S  +T+ E+S+ V+      + +LNN
Sbjct: 520 GGLG-TMGYGLPSAIGAQVAKPESLVIDIDGDASFNMTLTELSSAVQAGTPVKILILNN 577

>Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AEL305C
          Length = 689

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 134/309 (43%), Gaps = 28/309 (9%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G    E + +  V TIFG PG   L + D IY +   ++    +E  A + A+GYA+
Sbjct: 94  LTGGEIFHEMMRRHKVDTIFGFPGGAILPVFDAIYSSDVFKFVLPKHEQGAGHMAEGYAK 153

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+                 +  +        D 
Sbjct: 154 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQV-----PRSAIGTDAFQEADV 208

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASLL 181
               R   + ++   MV  +   P  I+      T     PV + LP +     V AS+L
Sbjct: 209 VGISR---SCTKWNVMVNSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTASVL 260

Query: 182 ETPIDLS--LKANDVE------AETEVVNTIL---ELIKDAKNPVILADACASRHDVKAE 230
           ++PI ++  L +N +E       +   V TI    +LI  AK P++   A    +++  +
Sbjct: 261 KSPIPMTSTLPSNTLEELTRHVVDQHTVKTIANAAKLINMAKKPLLYVGAGILNNELGPK 320

Query: 231 T-KKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALL 289
             K+L +  Q P   T  G G+ D+  P+   + +G   S A   A+++AD+I+++GA  
Sbjct: 321 VLKELAERAQIPVTTTLHGLGAFDQDDPKSLDM-LGMHGSAAANIAIQNADVIVALGARF 379

Query: 290 SDFNTGSFS 298
            D  TG+ +
Sbjct: 380 DDRVTGNVA 388

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P   VI   GD SL +T+ E+ST V+      + +LNN
Sbjct: 522 GGLG-TMGFGLPAAIGAQVARPNALVIDIDGDASLNMTITELSTTVQAGTPVKILLLNN 579

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 126/310 (40%), Gaps = 30/310 (9%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + DV T+FG PG   L + D I+E+    +    +E  A + A+GYAR
Sbjct: 104 LTGGQIFHEMMRRHDVDTVFGYPGGAILPVYDAIHESDAFNFILPRHEQGAGHMAEGYAR 163

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +  + A+                A   +        D 
Sbjct: 164 ATGRPGVVLVTSGPGATNVVTPMTDALADGVPLIVFTGQV-----ATSAIGTDAFQEADV 218

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPASLL 181
               R   + ++   MV ++   P  I+         +  PV + LP +     V A++L
Sbjct: 219 VGISR---SCTKWNVMVKNVEELPKRINEAFEIAMSGRPGPVLVDLPKD-----VTAAVL 270

Query: 182 ETPI------------DLSLKANDVEAETEVVNTILELIKDAKNPVILADA-CASRHDVK 228
             PI             L+ +A D E  +  V    +L+  AK P++   A   +  D  
Sbjct: 271 RNPIPTKSTLPSDSLAQLTKRAQD-EFTSNNVKRAADLVNVAKKPILYVGAGIFNNPDGP 329

Query: 229 AETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGAL 288
              K+L +  Q P   T  G G+ D++  +   + +G         A+++ADLIL+VGA 
Sbjct: 330 RLLKELSERAQIPVTTTLQGLGAFDQEDTKSLDM-LGMHGCATANLAIQNADLILAVGAR 388

Query: 289 LSDFNTGSFS 298
             D  T + S
Sbjct: 389 FDDRVTCNIS 398

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P   V    GD S  +T+ E+S+ V+      + VLNN
Sbjct: 532 GGLG-TMGYGLPAAIGAQIAKPNALVFDIDGDASFNMTLTELSSAVQAKTPIKILVLNN 589

>TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 127/306 (41%), Gaps = 36/306 (11%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I+++    +    +E  A + A+GYAR
Sbjct: 87  LTGGQIFHEMMIRHNVDTVFGYPGGAILPVYDAIHDSKSFNFVLPRHEQGAGHMAEGYAR 146

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+                         +G   F
Sbjct: 147 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTS----------AIGTDAF 196

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRP--VYLGLPANLVDLKVPA 178
                  +S + ++   MV  I   P  I+       V+ RP  V + LP +     V A
Sbjct: 197 QEADVVGISRSCTKWNVMVRSIEELPLRINEAFEIA-VSGRPGPVLVDLPKD-----VTA 250

Query: 179 SLLETPI------------DLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHD 226
           ++L+ PI             L+ +A D      +V T  +L+  AK PV+   A    + 
Sbjct: 251 AILKNPIPTKTTLPSNSLAQLTKRAMDESTNENIVRTA-DLLNKAKTPVLYVGAGILNNP 309

Query: 227 VKAET-KKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSV 285
              +  K+L +  Q P   T    G+ D+Q P+   + +G         A+++ADLIL+V
Sbjct: 310 AGPKLLKELSERAQIPVTTTIQALGAFDQQDPKSLDM-LGMHGCATANMAIQNADLILAV 368

Query: 286 GALLSD 291
           G+   D
Sbjct: 369 GSRFDD 374

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P   VI   GD S  +T+ E+S+ V+      + +LNN
Sbjct: 515 GGLG-TMGYGLPAAIGAQVAKPDALVIDIDGDASFNMTLMELSSAVQAKTPVKILLLNN 572

>KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 678

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 129/302 (42%), Gaps = 34/302 (11%)

Query: 7   GRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + +  V T+FG PG   L++ D IY +    +    +E  A + A+GYAR+ G
Sbjct: 86  GQIFHEMMRRHKVNTVFGYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYARVSG 145

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+                        ++G   F   
Sbjct: 146 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAFQEA 195

Query: 126 H--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR--PVYLGLPANLVDLKVPASLL 181
               +S + ++   MV ++   P  I+       V+ R  PV + LP +     V +++L
Sbjct: 196 DVIGISRSCTKWNVMVKNVEELPRRINEAFEIA-VSGRPGPVLVDLPKD-----VTSAIL 249

Query: 182 ETPIDL--SLKANDVEAETEV---------VNTILELIKDAKNPVI-LADACASRHDVKA 229
            TPI +  +L +N +   T+          +    +LI  AK P+I +      +     
Sbjct: 250 RTPIPVKSTLPSNALSKITKSAAKEFTLANLQRAADLINIAKKPLIYVGGGIFGKEQGPK 309

Query: 230 ETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALL 289
             ++L +  Q P   T  G G+ D++ P+   + +G   S     +V++ADLI+++GA  
Sbjct: 310 LLRELAERAQIPVSTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARF 368

Query: 290 SD 291
            D
Sbjct: 369 DD 370

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L +A  A+   P   VI   GD S  +T+ E+S+ V+      + VLNN
Sbjct: 511 GGLG-TMGYGLPSAIGAQIARPDALVIDIDGDASFNMTLMELSSAVQAGAPVKIVVLNN 568

>NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {ON}
           Anc_2.441 YMR108W
          Length = 689

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 77/315 (24%), Positives = 130/315 (41%), Gaps = 40/315 (12%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V TIFG PG   L + D I+++   ++    NE  A + A+GYAR
Sbjct: 94  LTGGQIFHEMILRNNVDTIFGYPGGAILPVYDAIHDSKSFQFILPKNEQGAGHMAEGYAR 153

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLH-HTLGNGD 121
             G    ++ T G    + +  +A + A+                          LG   
Sbjct: 154 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY---VTQR--PVYLGLPANLVDLKV 176
                 +S + ++   MV  +   P    RCI   +   ++ R  PV + LP +     V
Sbjct: 211 ------ISRSCTKWNVMVRTVDDMP----RCINEAFEIAMSGRPGPVLVDLPKD-----V 255

Query: 177 PASLLETPI------------DLSLKANDVEAETEVVNTILELIKDAKNPVILADA-CAS 223
            A++L  PI             ++  A+D E   E +     LI  AK PV+   A   +
Sbjct: 256 TAAILRNPIPVKSTLPSSALSQITKLAHD-EFTMENIERAAALINIAKKPVLYVGAGILN 314

Query: 224 RHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLIL 283
             D     K+L D  Q P   T  G G+ D++ P+   + +G         AV++ADL++
Sbjct: 315 NVDGPRIIKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLVI 373

Query: 284 SVGALLSDFNTGSFS 298
           ++G    D  TG+ +
Sbjct: 374 ALGTRFDDRVTGNIT 388

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G +G T G  L AA  A+   P+  VI   GD S  +++ E+S+ V+      + +LNN
Sbjct: 522 GGLG-TMGYGLPAAIGAQVAKPEALVIDIDGDASFNMSLTELSSAVQAGTPVKVLILNN 579

>TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}
          Length = 688

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 121/304 (39%), Gaps = 32/304 (10%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G    E + + +V T+FG PG   L + D IY +    +    +E  A + A+GYAR
Sbjct: 91  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 150

Query: 64  IKG-MSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+                         +G   F
Sbjct: 151 ASGKCGVVLVTSGPGATNVITPMADALADGVPMVVFTGQVPTA----------AIGTDAF 200

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   MV  +   P  I+      T     PV + LP +     V AS
Sbjct: 201 QEADVIGISRSCTKWNVMVKRVEDLPKCINEAFEIATSGRPGPVLVDLPKD-----VQAS 255

Query: 180 LLETPIDL-------SLKANDVEAETEV----VNTILELIKDAKNPVI-LADACASRHDV 227
           +L  PI +       +LK     A T+     +    ELI  AK P++ +     +  + 
Sbjct: 256 ILRAPIPIKTTIPSNALKQLTRSAYTQFSEAGIKRAAELINIAKKPILYVGGGILNNPEG 315

Query: 228 KAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGA 287
               K+L D  Q P   T    G+ D+  P+   + +G         A+++ADLI++VGA
Sbjct: 316 PRLIKELSDRAQIPVTTTLQALGAFDQDDPKSLDM-LGMHGYAPANLAIQNADLIIAVGA 374

Query: 288 LLSD 291
              D
Sbjct: 375 RFDD 378

>Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 104/497 (20%), Positives = 190/497 (38%), Gaps = 59/497 (11%)

Query: 8   RYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARIKGM 67
           ++  + L +  + T+FG+ G   + L D +    G+++    NE  A+YAA GY  +   
Sbjct: 7   QHFAQLLQRYGIDTVFGIVGIPIVQLADTMVAN-GIKFIPCRNEQAASYAASGYGYVNDK 65

Query: 68  SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTVFHR 127
             ++    VG    ++ +AG Y                 Q+        +  G F    +
Sbjct: 66  PGVLLI--VGGPGLIHSLAGIYNSMNNRWPLLVIAGSSSQSD-------IHKGGFQELDQ 116

Query: 128 MS------ANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAS-- 179
           +S          + T    D+ T  A ++ CI+ T       Y+ +PA+ ++ + P    
Sbjct: 117 ISLLYPFLKFTGKLTPDNVDMVTQKA-LNHCIQGTAGVS---YIDVPADFIESEKPLEGN 172

Query: 180 ---LLETPIDLSLK--ANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKL 234
                E P+ L+ K    D     E+V  IL    +    VI   A  + H    E ++L
Sbjct: 173 DYIANELPMILTPKKCGPDPSQIKEIVQLILHHRDNNILIVIGKGAVKNSH----EIRRL 228

Query: 235 IDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNT 294
           I+    P   TPM KG + +  P           S A  +A+++AD++L +GA L+    
Sbjct: 229 INKFNLPFLPTPMAKGIVPDSSP--------LNVSSARSQALKTADVVLVLGARLNWILH 280

Query: 295 GSFSYSYKTKNI-VEFHSDYIKI-KNATFPGVQMK------FALQKLLGSVAEXXXXXXX 346
              S  +  ++I ++F S+   +  N   PG  +        ++  L+G +         
Sbjct: 281 FGTSPKWNAESIFLQFDSNPETLGDNNASPGADLSVWGDVGLSVTALMGELERQSPRWKY 340

Query: 347 XXXXXXXXXXXXXXXXTPLKQE----------WMWNQVGKFLQEGDVVITETGTSAFGIN 396
                             L++E           ++  +   + +   ++   G +   I 
Sbjct: 341 SGVNQAMREKIQLNQTRLLEKEKVGGAQLNYHQVYGTLRPLIDDYRTILVTEGANTMDIA 400

Query: 397 QTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEIST 456
           +  FP +     + L      T G  LG A A++    +  V+L  GD +   +  EI T
Sbjct: 401 RVSFPTDVP--RRRLDAGTNATMGIGLGYALASKASHLELDVVLIQGDSAFGFSAMEIET 458

Query: 457 MVRWNLKPYLFVLNNNG 473
            VR  L   + V+NN+G
Sbjct: 459 AVRCQLALIIVVMNNSG 475

>SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 550

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 79/348 (22%), Positives = 142/348 (40%), Gaps = 46/348 (13%)

Query: 164 YLGLPANLV------DLKVPASLLETPIDLSLKANDVEAETEVVNTILELIKDAKNPVIL 217
           Y+ +P NL+      + ++   ++ +P+  S        +  VV+ +  LI + ++  IL
Sbjct: 153 YIDIPGNLITEEDCIEERISGKIIISPVRCS-------PDPLVVSEVARLIANNEHKEIL 205

Query: 218 ADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVE 277
                   +   E ++ +D  Q P   TPM KG + + HP    + V +  S A+++A  
Sbjct: 206 VVIGKGAVNCANEIRRFVDQFQLPFLPTPMAKGVVPDSHP----LNVSSARSLALRKA-- 259

Query: 278 SADLILSVGALLSDFNTGSFSYSYKTKNIVEF-HSDYIKIKNATFPGVQMKFALQKLLG- 335
             D++L +GA L+      F    K K+ V+F   DY   +        + ++L   +G 
Sbjct: 260 --DVVLLLGARLNWIL--HFGEPPKWKDTVKFVQFDYTPEELGHNNVAGLNYSLCGDIGL 315

Query: 336 SVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQE----------WMWNQV----GKFLQEG 381
           S+ E                         LK              +NQV     +++ + 
Sbjct: 316 SLEELGSKLHAFKYRGLNNAIREKIDTNELKLRGKERETRTALLHYNQVYALMRQYITDD 375

Query: 382 DVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKKRVILF 441
           + ++   G +   + +  FP + Y   ++  G+   T G  LG A AA+  D  K VI  
Sbjct: 376 ETILVTEGANTMDVARISFPTD-YPKRKLDAGT-NATMGIGLGYALAAKASDTTKTVICI 433

Query: 442 IGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNE 489
            GD +   +  E+ T VR +L   + V+NN+G     + HG   Q  E
Sbjct: 434 QGDSAFGFSAMELETAVRCSLPLVVVVMNNSG-----IYHGTVDQSVE 476

>AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR108W
           (ILV2)
          Length = 668

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 123/307 (40%), Gaps = 30/307 (9%)

Query: 7   GRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARIKG 66
           G    E + + +V T+FG PG   L + D IY +    +    +E  A + A+GYAR  G
Sbjct: 76  GEIFHEMMRRHNVDTVFGYPGGAILPVYDAIYNSDAFNFVLPKHEQGAGHMAEGYARASG 135

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+                 K  +        D    
Sbjct: 136 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQV-----PKAAIGTDAFQEADVVGI 190

Query: 126 HRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASLLETP 184
            R   + ++   MV  +   P  I+      T     PV + LP +     V A++L +P
Sbjct: 191 SR---SCTKWNVMVNHVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAILRSP 242

Query: 185 I------------DLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAE-T 231
           I             L+ +A D++    + +    LI  A+ PV+   A         E  
Sbjct: 243 IPLASALPSTTLAQLTRQAADIDGVRSLADAS-RLINMAQKPVLYVGAGILNSTRGPEFL 301

Query: 232 KKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSD 291
           ++L +  Q P   T    G+ D++  +   + +G   S A    V++ADLI+++GA   D
Sbjct: 302 RELAEKAQIPVTTTLQALGAFDQEDSKSVDM-LGMHGSAAANLTVQNADLIIALGARFDD 360

Query: 292 FNTGSFS 298
             TG+ +
Sbjct: 361 RVTGNIA 367

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G++GF   A +GA  A     P   VI   GD SL +T+ E+S+ V+      + +LNN
Sbjct: 504 GTMGFGLPAAIGAQVA----KPDAIVIDIDGDASLNMTLMEMSSAVQAGAPVKILLLNN 558

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 106/505 (20%), Positives = 187/505 (37%), Gaps = 56/505 (11%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I+++    +    NE  A + A+GYAR
Sbjct: 95  LTGGQIFHEMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYAR 154

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLH-HTLGNGD 121
             G    ++ T G    + +  +A + A+                          LG   
Sbjct: 155 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 211

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRP--VYLGLPANLVDLKVPAS 179
                 +S + ++   MV  +   P  I+       +++RP  V + LP +     V A+
Sbjct: 212 ------ISRSCTKWNVMVRSVEEMPRRINEAFEIA-MSRRPGPVLVDLPKD-----VTAA 259

Query: 180 LLETPI------------DLSLKANDVEAETEVVNTILELIKDAKNPVILADA-CASRHD 226
           +L  PI             L+  A+D E   E +    +LI  AK PV+   A   +  +
Sbjct: 260 ILRNPIPVKTTLPSGALSQLTKLAHD-EFILENIKKAADLINIAKKPVLYVGAGILNNME 318

Query: 227 VKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVG 286
                K L    + P   T  G G+ D++ P      +G         AV+++DLI++VG
Sbjct: 319 GPRILKDLSQRAKIPVTTTIQGLGAFDQEDP-LSLDMLGMHGCATANLAVQNSDLIIAVG 377

Query: 287 ALLSDF-------------------NTGSFSYSYKTKNIVEFHSDYIKIKNATFPGVQMK 327
               D                    N G   +    KNI +     + ++      ++  
Sbjct: 378 TRFDDRVTGNISKFAPEARRAALEGNGGIIHFEISPKNINKVVEAQVAVEGDAAANIEKM 437

Query: 328 FALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQE-GDVVIT 386
            ++   + + +E                       + LK + +  ++ K     G  VI 
Sbjct: 438 LSMIFPVRARSEWLNTIKQWKKEFPYDYMRETPE-SKLKPQTVITKLSKLANSTGKPVIV 496

Query: 387 ETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGS 446
            TG     +    +       S +  G +G T G  L AA  A+   P+  VI   GD S
Sbjct: 497 TTGVGQHQMWTAQYWTWKNPRSFITSGGLG-TMGYGLPAAIGAQVAKPEALVIDIDGDAS 555

Query: 447 LQLTVQEISTMVRWNLKPYLFVLNN 471
             +++ E+S+ V+      + +LNN
Sbjct: 556 FNMSLTELSSAVQAGTAVKVLILNN 580

>ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {ON}
           similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020C Hypothetical ORF
          Length = 549

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 112/284 (39%), Gaps = 25/284 (8%)

Query: 9   YLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARIKGM- 67
           Y    L    V T+FG+ G   + L D + E  G+++    NE +A+YAA  Y  + G  
Sbjct: 6   YFTRVLQNYGVDTVFGIVGIPIVELADTMIEH-GIKFIACRNEQSASYAASAYGYLTGKP 64

Query: 68  SCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAK-QLLLHHTLGNGDFTVFH 126
             ++   G G + AL GI  S +                +   Q L   +L       + 
Sbjct: 65  GVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAGSSEAQHRGGFQELDQVSL----LKPYV 120

Query: 127 RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLETPID 186
           + S  ++ +     D+ T     D      Y T    YL +P NL+   V    L  P  
Sbjct: 121 KFSGQLNSSN---IDVLT----YDALRLVQYTTAGATYLDIPGNLIGSTVKKDSL--PPV 171

Query: 187 LSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTP 246
            ++       +   V  + +LI+     V++     + H    E ++ +D  Q P   TP
Sbjct: 172 KNIYVPKSSPDPSAVQEVTDLIRKNPENVLVVVGKGAVH-ASQEIRQFVDRFQLPFLPTP 230

Query: 247 MGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLS 290
           MGKG + + HP           S A   A++ A ++L +GA L+
Sbjct: 231 MGKGVVPDSHP--------LNVSSARSRALQEAKVVLVLGARLN 266

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 2/97 (2%)

Query: 377 FLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKK 436
            + +   +I   G +     +  FP + Y + ++  G+   T G  +G A AA+  +P K
Sbjct: 367 LINDESTIIVSEGANTMDKARVSFPTD-YPLQRLDAGT-NATMGVGMGYALAAKVSNPDK 424

Query: 437 RVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNG 473
            V++  GD +   +  +I T  R  L   + V+NN G
Sbjct: 425 TVLVIQGDSAFGFSAMDIETATRSGLALIVIVMNNGG 461

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 118/294 (40%), Gaps = 29/294 (9%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T   Y    L Q ++ T+FG+ G   + L DK+ E  G+R+    NE  A+YAA GY  
Sbjct: 10  LTATEYFVSLLKQYEIDTVFGIVGIPIVELADKMIEH-GIRFISCRNEQAASYAASGYGY 68

Query: 64  IKGMSCIITTF-GVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDF 122
           + G   ++    G G + AL GI  S +                           G  D 
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGIYNSMSNKWPLIVIAGSSNSETD-------QVGGFQDL 121

Query: 123 TVFHRMSANISETTAMVT-DIATAPAEIDRCIRTTYVTQRPV---YLGLPANLVD--LKV 176
                ++  +  T  + + +I TA           +  Q P+   Y+  P NL++   KV
Sbjct: 122 DQVSLLNKYVKYTVKLNSINIPTALFN-----AYNFAIQSPMGVTYIDFPGNLIEGNYKV 176

Query: 177 PASLLETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLID 236
            A     P+ +  +      +   VN + +LI +  +  +L        +   +  K I+
Sbjct: 177 QAQPATNPVSIPRRVR-CSPDPNTVNEVAKLIIENSSNNVLVILGKGAVEFHKDINKFIN 235

Query: 237 ITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLS 290
               P   TPM KG + + H     + V +  S A+K+    A+++L +GA L+
Sbjct: 236 TFNLPFLPTPMAKGILPDSH----NLNVSSARSKALKD----ANIVLVLGARLN 281

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 7/109 (6%)

Query: 370 MWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAA 429
           ++  + K + E   V+   G ++  I +  FP++     Q L      T G  LG   AA
Sbjct: 382 VYGALRKLMDESKTVLVTEGANSMDIARISFPSSVP--KQRLDAGTNATMGIGLGYGIAA 439

Query: 430 --EEVDPKKR---VILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNG 473
              E+   KR   VIL  GD +   +  EI T VR+ L   + V+NN+G
Sbjct: 440 CLNELRNGKRGKDVILIQGDSAFGFSGMEIETAVRFKLGLIIVVMNNSG 488

>YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON}
           Protein of unknown function with low sequence identity
           to Pdc1p; mRNA identified as translated by ribosome
           profiling data
          Length = 560

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 84/370 (22%), Positives = 145/370 (39%), Gaps = 39/370 (10%)

Query: 141 DIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA---SLLETPIDLSLKANDVEAE 197
           D+ T  A ++ CI+ T       Y+ +PA+ ++ + P          + + L  N    +
Sbjct: 136 DMITQKA-LNYCIQGTAGVS---YIDVPADFIEYEKPLEGNDRTGNELPMILTPNICGPD 191

Query: 198 TEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHP 257
              +  +++LI   KN  IL            E ++L++    P   TPM KG + +  P
Sbjct: 192 PSKIKKVVQLILQHKNKNILIVIGKGAVKNSHEIRRLVNTFNLPFLPTPMAKGIVPDSSP 251

Query: 258 RFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDYIKI 316
                      S A  +A++ AD++L +GA L+       S  + +++I ++F S+   +
Sbjct: 252 --------LNVSSARSQALKIADIVLVLGARLNWILHFGTSPKWNSESIFIQFDSNPETL 303

Query: 317 -KNATFPGVQMK------FALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQEW 369
             N   PG  +        ++  L+  +                           L++E 
Sbjct: 304 GDNNVSPGADLSIWGDIGLSVTALVEELTRQDSCWKYSGVKQEIREKIQLNQTRLLRKEK 363

Query: 370 M------WNQV----GKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTT 419
                  +NQV       + +   ++   G +   I +  FP  T    + L      T 
Sbjct: 364 TRGAQLNYNQVYGTLRPLIDDYRTILVTEGANTMDIARISFP--TDAPRRRLDAGTNATM 421

Query: 420 GACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNG-YTIEK 478
           G  LG A A +   P+  V+L  GD +   +  EI T VR  L   + V+NN+G Y  EK
Sbjct: 422 GIGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETAVRCQLALVIVVMNNSGIYHGEK 481

Query: 479 LIHG---PTA 485
            I G   PTA
Sbjct: 482 DIEGDLPPTA 491

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 106/499 (21%), Positives = 192/499 (38%), Gaps = 52/499 (10%)

Query: 8   RYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANE--LNAAYAADGYARIK 65
           +Y  E L +  + T+FG+ G   + L D +  + G+++    NE   + A +A GY   K
Sbjct: 7   QYFAELLQRYGIDTVFGIVGIPIVQLADTMV-SKGIKFIPCRNEQAASYAASAYGYVNDK 65

Query: 66  GMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAK---QLLLHHTLGNGDF 122
               ++   G G + +L GI  S +                  K   Q L   +L     
Sbjct: 66  -PGVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSHGDTHKGGFQELDQVSL----L 120

Query: 123 TVFHRMSANIS-ETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA--- 178
           + F + +  ++ +   M+T  A     ++ CI+ T       Y+ +PA+ ++ + P    
Sbjct: 121 SPFLKFTGKLAPDNIRMITQKA-----LNHCIQGTAGV---AYIDVPADFIEYEKPLEGN 172

Query: 179 SLLETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDIT 238
             +   + + L  N    +   +  +++LI   K   IL            E ++LI+  
Sbjct: 173 CHIGDELPVILTPNKCGPDPSRIKEVVQLILKNKENNILVVIGKGAVKNSHEVRRLINKF 232

Query: 239 QFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFS 298
             P   TPM KG + +  P           S A  +A+++AD++L +GA L+       S
Sbjct: 233 NIPFLPTPMAKGIVPDSSP--------LNVSSARSQALKTADIVLVLGARLNWILHFGAS 284

Query: 299 YSYKTKNI-VEFHSDYIKI-KNATFPGVQMK------FALQKLLGSVAEXXXXXXXXXXX 350
             + +++I ++F S+   +  N   PG  +        ++  L+  V             
Sbjct: 285 PKWNSESIFIQFDSNPETLGDNNISPGADLSVWGDIGLSVTALMEEVVRQDPCWKYSGIS 344

Query: 351 XXXXXXXXXXXXTPLKQE----------WMWNQVGKFLQEGDVVITETGTSAFGINQTHF 400
                         LK+E           ++  +   + +    +   G +   I +  F
Sbjct: 345 QAIQEKIQFNQTRLLKKERTGGTQLNYHQVYGTLRPLIDDYRTFLVTEGANTMDIARVSF 404

Query: 401 PNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRW 460
           P N     + L      T G  LG A A +   P+  V+L  GD +   +  EI T VR 
Sbjct: 405 PTNAP--KRRLDAGTNATMGVGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETAVRC 462

Query: 461 NLKPYLFVLNNNG-YTIEK 478
            L   + V+NN+G Y  EK
Sbjct: 463 QLALVIVVMNNSGIYHGEK 481

>AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL020C
          Length = 545

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 95/487 (19%), Positives = 183/487 (37%), Gaps = 64/487 (13%)

Query: 14  LSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARIKGM-SCIIT 72
           L Q  ++ +FG+ G   + L +K+ E  G+R+    NE + +YAA  Y  +      ++ 
Sbjct: 13  LKQHGIEVVFGIVGIPIVELAEKLAEH-GVRFIACRNEQSCSYAASVYGYLTNKPGALLV 71

Query: 73  TFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTVFH-RMSAN 131
             G G + AL GI  ++                 +     L        +T F  R+S  
Sbjct: 72  VGGSGVVHALAGIHNAWVNKWPLLVIAGSTEDEYKGGFQELDQLRIVAPWTSFKGRLS-- 129

Query: 132 ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLETPIDLSLKA 191
           +     MV             ++T  +     YL +P  L+++     L   P+D+    
Sbjct: 130 LDNVNYMVYT----------AVKTAVLQHGVSYLDVPGRLINMDAVGPLASKPVDIQHVR 179

Query: 192 NDVEAETEVVNTILELIKDAKNP-VILADACASRHDVKAETKKLIDITQFPSFVTPMGKG 250
           +    ++  V    +L++D +N  V++   CA    V    +  ++  + P    PM KG
Sbjct: 180 SG--PDSSRVQGAAKLLQDGRNILVVVGRGCAEYPGV---VRSFLERYRLPFLPVPMAKG 234

Query: 251 SIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLS-------------------- 290
            + + H     + V    S A+K A    +++L +GA L+                    
Sbjct: 235 IVPDSHE----LNVNGCRSLALKRA----EIVLVLGARLNWILHYGSAPKWNADATFIQV 286

Query: 291 DFNTGSFSYSYKTKNIVEFHSD---YIKIKNATFP-GVQMKFALQKLLGSVAEXXXXXXX 346
           D +  +  ++  +       SD   +I    A  P   Q +    ++L  + E       
Sbjct: 287 DRDPATLGHNNSSGVNYSVLSDVELFINAITAVLPQSWQYRGVDNEVLDKIRENGVKLQR 346

Query: 347 XXXXXXXXXXXXXXXXTPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYG 406
                           +PL    +++ + K + + + +++  G +    ++  F   T  
Sbjct: 347 KAQLTPG---------SPLNYHAVYSLLRKLIDDKNTILSAEGANTMDNSRLWF--GTDY 395

Query: 407 ISQVLWGSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYL 466
             + L    G T G  +G A +A+  +P K V+   GD +   +  E+ T VR  +   +
Sbjct: 396 PKRRLDAGTGATMGLGVGYALSAKLANPDKFVVALEGDSAFGFSCMELETAVRNKVGLVV 455

Query: 467 FVLNNNG 473
            V+NN G
Sbjct: 456 VVMNNGG 462

>Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C
           (REAL)
          Length = 561

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 75/355 (21%), Positives = 138/355 (38%), Gaps = 36/355 (10%)

Query: 141 DIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA----SLLETPIDLSLKANDVEA 196
           D+ T  A ++ CI+ T       Y+  PA+L++ +  +      L   + + L  N    
Sbjct: 136 DMVTRKA-LNHCIQGTMGVS---YIDFPADLIENEKKSLAGNDHLVNELPMILTPNKCGP 191

Query: 197 ETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQH 256
           +   +  I++LI   ++  IL            E ++L+     P   TPM KG + +  
Sbjct: 192 DPSKIEEIVQLILQNRDKNILIVIGKGAVKNSHEIRRLVSSFNLPFLPTPMAKGIVPDSS 251

Query: 257 PRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDYIK 315
           P           S A  +A+++AD++L +GA L+       S  +  +++ ++F S    
Sbjct: 252 P--------LNVSSARSQALKTADIVLVLGARLNWILQFGSSPRWNAESVFIQFDSHPET 303

Query: 316 I-KNATFPGVQMK------FALQKLLGSVAEXXXXXXXXXXXXXXXXXXXXXXXTPLKQE 368
           +  N T  G  +        ++  L+  +A                           ++E
Sbjct: 304 LGDNNTSAGAGLSVWGDIGLSVTALMEELARQRPRWKYSGVNNALREKIHVNETRLQEKE 363

Query: 369 WM------WNQV----GKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFT 418
            M      ++QV       +++   ++   G +   I +  FP  T      L      T
Sbjct: 364 KMGGAQLNYHQVYGVLRPLIEDYRTILVTEGANTMDIARVSFP--TDAPRHRLDAGTNAT 421

Query: 419 TGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNG 473
            G  LG A A++   P+  V+L  GD +   +  EI T VR  L   + V+NN+G
Sbjct: 422 MGIGLGYALASKASRPELDVVLIQGDSAFGFSAMEIETAVRCQLALVIVVMNNSG 476

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 60/282 (21%), Positives = 119/282 (42%), Gaps = 32/282 (11%)

Query: 14  LSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYARIKGM-SCIIT 72
           L Q  V+ +FG+ G   + + +   E  G+R+ G  NE + +YAA  Y  + G    ++ 
Sbjct: 11  LKQYGVEVVFGIVGIPIVEVAESFVEH-GIRFIGCRNEQSCSYAASAYGYLTGKPGVLLV 69

Query: 73  TFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFTVFHRMS--A 130
             G G + AL G+  S+                 +   L+L  +  N  +  F  +   +
Sbjct: 70  VGGPGVIHALAGVYNSFVN---------------KWPLLVLAGSSENEYYEGFQELDQLS 114

Query: 131 NISETTAMVTDIATAPAE--IDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLETPIDLS 188
            +S        I T      +   ++T+ +     Y+ +P  L++ K  +S  E P  + 
Sbjct: 115 VMSRWCKFYGRINTGNLSHLVYTAMKTSMLQNAVTYIDIPGGLIEEKAKSS-DELPKKME 173

Query: 189 LKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMG 248
           +       + + V  +  +++  K  +++    ++ +   AE +  ++  Q P   TPM 
Sbjct: 174 IAHIRCGPDIQRVKEVATIMQSGKKILVVVGRGSANY--PAEVRAFLEKYQLPFLPTPMA 231

Query: 249 KGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLS 290
           KG + + H     + V    S A+K    SA+++L +GA L+
Sbjct: 232 KGIVPDTHE----LNVNGARSLALK----SAEVVLILGARLN 265

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 54/111 (48%), Gaps = 2/111 (1%)

Query: 363 TPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGAC 422
           + L+   ++ ++ +F+ +   ++   G +   I +  FP  +Y   ++  G+   T G  
Sbjct: 353 SALRYHGVYAKLREFIDDKSTIMVLEGANTMDIARVSFPT-SYQKHRLDAGT-SATMGVG 410

Query: 423 LGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNG 473
           +G A AA+  +P K V+   GD +   +  E+ T+ R  L   + V+NN G
Sbjct: 411 IGYAMAAKVANPSKFVVALEGDSAFGFSAMELETIARNKLGIVVVVMNNGG 461

>KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/297 (20%), Positives = 118/297 (39%), Gaps = 35/297 (11%)

Query: 4   ITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADGYAR 63
           +T+   +   L   +V  +FG+ G   ++L ++ + T G+R+    NE +A+YAA  Y  
Sbjct: 3   VTITERITTVLRHYEVDLVFGIVGIPIVTLANE-FITHGIRFVSCRNEQSASYAASAYGY 61

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEXXXXXXXXXXXXXXXQAKQLLLHHTLGNGDFT 123
           + G   ++    VG    ++ +AG Y                         H    G F 
Sbjct: 62  LTGKPGVLLV--VGGPGLIHSLAGVYNSINNRWPLIVLAGSNDHG------HDQYRGAFQ 113

Query: 124 VFHRMS--ANISETTAMVTDIATAPAEIDRCIRTTY-----VTQRPVYLGLPANLVDLKV 176
              ++S      + +  +T+       +D  + + Y      T+   Y+ +P NL++ + 
Sbjct: 114 ELDQISLLKPYVKFSGKLTE-----GNVDHVLFSAYNIALQGTKGVTYVDIPGNLIETQA 168

Query: 177 PASL---LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKK 233
             +    L  P+   +K +    +   V  +  LI + ++  +L           A  ++
Sbjct: 169 VCAGTPGLLPPVPQPIKCS---PDPHTVKRVASLILENRDKKVLVVVGKGSQGAFAAVRR 225

Query: 234 LIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLS 290
            ID   FP   TPMGKG + ++H            S A   A+  A ++L +GA L+
Sbjct: 226 FIDEFNFPFLPTPMGKGVVPDEHE--------LNVSSARSYALAHAGIVLIMGARLN 274

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 3/110 (2%)

Query: 365 LKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLG 424
           L    ++  +   L++   V+   G +     +  FP +T   S++  G+   T G  LG
Sbjct: 373 LNYNRVYGIIRPLLEQDRTVLVTEGANTMDKARVSFPAST-PFSRLDAGT-NATMGVGLG 430

Query: 425 AAFAAEEVDPKKR-VILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNG 473
            A AA+      R V+L  GD +   +  E+ T+VR+ +   + ++NN+G
Sbjct: 431 YAMAAKLSSGAARDVVLIQGDSAFGFSGMELETLVRFQVGVVVMIMNNSG 480

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 56/111 (50%), Gaps = 8/111 (7%)

Query: 377 FLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKK 436
           F  E  +++TE G +   + +  FP + +   ++  G++  T G  LG A + +   P K
Sbjct: 393 FKDEETILVTE-GANTMDVARISFPTD-FPQHRIDCGTLA-TMGIGLGYAISTKLSKPNK 449

Query: 437 RVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQY 487
            V+L  GD +   +  E+ T VR+NL   + ++NN+G     + HG T  +
Sbjct: 450 SVVLIQGDSAFGFSGLELETSVRFNLGLIVVIMNNSG-----IYHGTTKDH 495

>Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON}
           (141784..143499) [1716 nt, 572 aa]
          Length = 571

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 2/104 (1%)

Query: 370 MWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAA 429
           ++  + K L + + +I   G +   I +  F  + Y   ++  G++  T G  LG A +A
Sbjct: 381 VYGSLRKILNDRETIIVMEGANTMDIARISFKTD-YPQHRLDCGNLA-TMGVGLGYAISA 438

Query: 430 EEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNG 473
           +   P K V+L  GD +   +  EI T VR  L   + V+NN+G
Sbjct: 439 KLSRPDKTVVLIQGDSAFGFSGMEIETAVRNKLGLIIIVMNNSG 482

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 2/104 (1%)

Query: 370 MWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAA 429
           ++  + K + + D +I   G +   + +  FP +   +   +      T G  LG A AA
Sbjct: 362 VYATIRKQIVDKDTIIVSEGANTMDVARISFPTDYPKLR--MDAGTNATMGVGLGYAIAA 419

Query: 430 EEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNG 473
           +   P+K VI   GD +   +  E+ T  R+ L   + V+NN+G
Sbjct: 420 KIAHPQKNVIAIQGDSAFGFSGMELETASRYKLGITVVVMNNSG 463

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 10/127 (7%)

Query: 164 YLGLPANLVDLKVPASLLETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACAS 223
           YL +PAN++D +V  +  E+     +     +     +  + +L+   ++  IL      
Sbjct: 153 YLDIPANVIDQEVEKN--ESFSRRHIAKISYQPTDAALQRVAKLLNANRDKNILCVIGKG 210

Query: 224 RHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLIL 283
             +   + +  +D  Q P   TPM KG + + H     + V +  S A+K    SAD++L
Sbjct: 211 ATENAQQIRPFVDEFQLPFLSTPMAKGVVPDSH----ALNVSSARSLALK----SADIVL 262

Query: 284 SVGALLS 290
            +GA L+
Sbjct: 263 VLGARLN 269

>Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {ON}
           YEL020C - Hypothetical ORF [contig 268] FULL
          Length = 553

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 60/142 (42%), Gaps = 18/142 (12%)

Query: 157 YVTQRPVYLGLPANLVDLKVPASLLETPIDLSLKANDVEAETEV--------VNTILELI 208
           Y   R   +G P  +  L +P  L+E  ++   K N V   T+V        +  + +LI
Sbjct: 140 YNALRQSMVGTPG-VSYLDIPGDLIEQSVEKE-KYNCVRNITKVEYQPSKDALQRVADLI 197

Query: 209 KDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLS 268
            +     +L        D   E +K I+  Q P   TPM KG + + HP           
Sbjct: 198 TENSTKSLLCVIGKGATDSSMEVRKFIERFQLPFLPTPMAKGVVPDSHP--------LNV 249

Query: 269 SPAVKEAVESADLILSVGALLS 290
           S A   A+ SAD++L +GA L+
Sbjct: 250 SSARSLALRSADIVLVLGARLN 271

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 371 WNQVGKFLQEGDV----VITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAA 426
           +NQV   ++E  V     I   G +   I +  FP +   +   L      T G  +G A
Sbjct: 361 YNQVYAAMREHMVDRNTFIVSEGANTMDIARVSFPTDYPKLR--LDAGTNATMGVGIGYA 418

Query: 427 FAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNG 473
            AA+   P+K V+   GD +   +  E+ T  R+ L     V+NN+G
Sbjct: 419 IAAKLAHPEKSVVCIQGDSAFGFSGLELETASRYQLGIVFVVMNNSG 465

>CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa]
           {ON} similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020c
          Length = 562

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 7/76 (9%)

Query: 418 TTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIE 477
           T G  LG A AA+   P+  ++   GD +   +  EI T VR+ L     ++NN+G    
Sbjct: 420 TMGVGLGYAIAAKVHSPELNIVTIQGDSAFGFSGMEIETAVRYRLGIIFIIMNNSG---- 475

Query: 478 KLIHG--PTAQYNEIQ 491
            + HG  P+   NE Q
Sbjct: 476 -IYHGSDPSTITNETQ 490

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 11/90 (12%)

Query: 201 VNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFG 260
           V ++++  +D    V+L   C +        +  I+   FP   TPM KG + + H R  
Sbjct: 196 VTSLIKEHQDKNILVVLGKGCINS---SLALRHFIEEFNFPFLPTPMAKGILPDSH-RLN 251

Query: 261 GVYVGTLSSPAVKEAVESADLILSVGALLS 290
                   S A  +A++SADL+L  GA L+
Sbjct: 252 -------VSAARSQALKSADLVLVFGARLN 274

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 79/364 (21%), Positives = 131/364 (35%), Gaps = 60/364 (16%)

Query: 164 YLGLPANLV--DLKVPASLLETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADAC 221
           Y+  P +L+  +++VP       I  ++K++   A+  V   + +L++   +  +L    
Sbjct: 163 YIDFPEHLISNNVRVPNMKQNISIPRAIKSS---ADPLVTKEVAQLLRRNSDQNVLVIIG 219

Query: 222 ASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADL 281
               +        I   QFP   TPMGKG I +  P           S A   A+  +D+
Sbjct: 220 KGAVNYSKGLSAFIHKYQFPFLPTPMGKGIISDMDP--------LNVSSARSSALSKSDI 271

Query: 282 ILSVGALLSDFNTGSFSYSYKTKNIVEF---HSDYIKIKNATFPGVQMKFALQKLLGSVA 338
           +L  GA L+      F    K K+ V+F    +D   I N     +        LLG + 
Sbjct: 272 VLVFGARLNWLL--HFGKPPKWKSTVKFILCDNDPHAIGNNNMQSINY-----SLLGDIG 324

Query: 339 EXXXXXXXXXXXXXXXXXXXXXXXTPLKQEWMWNQ---------------------VGKF 377
                                     L+ E + NQ                     V + 
Sbjct: 325 LIINELTEELDRVENEWGRKYGVTKELRSEILKNQFKLQEKESRSNTNGALLNYHVVYRT 384

Query: 378 LQE----GDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAA---- 429
           L+E     +  +   G +   I +  FP  +    Q L      T G  LG   AA    
Sbjct: 385 LREMLDLKNTFLVTEGANTMDIARISFP--SLKPKQRLDAGTNATMGVGLGYGIAARLSQ 442

Query: 430 EEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNE 489
           + +  K  +++  GD +   +  EI T VR+ L   + V+NN+G     + HG T Q  +
Sbjct: 443 DYMKSKPDILVIQGDSAFGFSAIEIETAVRFKLGLIIIVINNSG-----IYHG-TEQSKK 496

Query: 490 IQSW 493
           I  +
Sbjct: 497 ISPY 500

>TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.450
           YEL020C
          Length = 582

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 76/361 (21%), Positives = 136/361 (37%), Gaps = 64/361 (17%)

Query: 160 QRPVYLGLPANLVDLKVPASLLETPIDL--SLKANDVEAETEVVNTILELIKDAKN---- 213
           +R  YL +           S L  P DL    +  D+E  T   N IL++  D       
Sbjct: 145 ERITYLAIKNCCNGNNNGVSFLNFPADLIQDTRVKDLEL-THCHNHILQMGPDPNQIDRI 203

Query: 214 -----------PVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGV 262
                       +++    A   D+  +  + ++  Q P   TPM KG + + HP    +
Sbjct: 204 VKFLTKSSSLQTLLIIGKGAINTDI-TKINEFVNKFQLPFLPTPMAKGIVPDSHP----L 258

Query: 263 YVGTLSSPAVKEAVESADLILSVGALLS-DFNTGSFSYSYKTKNIVEFHSDYIKIKNATF 321
            V    S A+K    ++D+I+ +GA L+   + GSF    KTK   +    +I+I N + 
Sbjct: 259 NVSVARSFALK----NSDIIIVIGARLNWILHFGSFG---KTK--FKPGCQFIQIDNDSE 309

Query: 322 P-----------------GVQMKFALQKL-LGSVAEXXXXXXXXXXXXXXXXXXXXXXXT 363
                             G+ +    QKL LG                            
Sbjct: 310 VLGWNNNQGNENCLLSDIGLALDSISQKLPLGFKFSKEKQEDNKLSNEIQKIIENNTNKL 369

Query: 364 PLKQ-----------EWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLW 412
            LKQ           E ++ ++ + + +   ++   G +   I +  F  + Y + ++  
Sbjct: 370 RLKQRYDHNNGAPSYEQVYYKLNQVINDKQTILVTEGANTMDIARICFQTD-YPLHRLDC 428

Query: 413 GSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNN 472
           G+   T G  +G A A++   P K  +L  GD +   +  E+ T+ R+ L   + ++NN+
Sbjct: 429 GT-NATMGIGIGYAIASKLAVPDKLTVLIQGDSAFGFSGMELETISRFKLGIVVIIMNNS 487

Query: 473 G 473
           G
Sbjct: 488 G 488

>KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 418 TTGACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNG 473
           T G  LG   A+   +P    IL  GD +   +  EI T+ R+ L   + ++NN+G
Sbjct: 424 TMGVGLGYLMASRLANPNLDNILIQGDSAFGFSGMEIETLCRFKLGSVIIIMNNSG 479

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,615,150
Number of extensions: 2197037
Number of successful extensions: 6141
Number of sequences better than 10.0: 141
Number of HSP's gapped: 6038
Number of HSP's successfully gapped: 233
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)