Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C026706.30ON1221226367e-87
KAFR0A051106.30ON1221225961e-80
NCAS0D021206.30ON1221225847e-79
Kpol_1037.216.30ON1201205785e-78
TDEL0G043906.30ON1221225785e-78
ZYRO0C07502g6.30ON1221225786e-78
KNAG0F029106.30ON1221205682e-76
YOL005C (RPB11)6.30ON1201205663e-76
Smik_15.1656.30ON1201205663e-76
Suva_15.1696.30ON1221225639e-76
Skud_15.1576.30ON1221225639e-76
CAGL0E02453g6.30ON1201205631e-75
SAKL0E01562g6.30ON1221225422e-72
TBLA0E031506.30ON1181185378e-72
TPHA0J004106.30ON1201205317e-71
KLTH0C10934g6.30ON1221225265e-70
ACL005C6.30ON1221225241e-69
Kwal_56.224726.30ON1221225231e-69
KLLA0C06160g6.30ON1211224971e-65
TPHA0B029202.163ON1301061271e-09
Kpol_165.22.163ON128921159e-08
CAGL0L03872g2.163ON137921142e-07
Ecym_54232.163ON127901097e-07
TBLA0B012902.163ON102801061e-06
Suva_14.2252.163ON1421061071e-06
KAFR0B045702.163ON131901072e-06
KNAG0I020602.163ON134901035e-06
TDEL0F011802.163ON129761026e-06
YNL113W (RPC19)2.163ON1421041036e-06
NCAS0G025502.163ON1501041038e-06
Smik_14.2142.163ON1421041029e-06
SAKL0E10692g2.163ON1311041001e-05
ZYRO0B09878g2.163ON130621002e-05
Skud_14.2182.163ON156106984e-05
AFL220C2.163ON13590975e-05
NDAI0F027502.163ON14990967e-05
KLTH0D09350g2.163ON14681941e-04
Kwal_26.84732.163ON15053923e-04
KLLA0F23760g2.163ON12768903e-04
TPHA0B015207.441ON115074670.95
Kpol_311.54.1ON57976671.1
TDEL0C030507.441ON114575661.5
Smik_3.941.423ON60346661.5
TBLA0I009107.441ON113974651.8
SAKL0F13618g7.441ON117570652.1
ZYRO0E04246g1.423ON60646642.2
CAGL0L07810g1.423ON59646642.7
Ecym_46527.441ON114374642.7
Kpol_520.177.441ON116468643.0
ACR191C7.441ON114970633.2
KLTH0C05478g7.441ON116475633.3
Skud_3.731.423ON60446633.8
Kwal_27.105817.441ON115470633.8
YHL030W (ECM29)4.15ON186863634.1
KNAG0B026007.353ON27999624.5
YCR008W (SAT4)1.423ON60346624.5
Kwal_23.58927.257ON67859624.5
Suva_3.331.423ON61446625.2
KAFR0G010807.441ON115070615.8
Skud_2.47.441ON115175616.2
CAGL0M09361g7.441ON114475617.2
TBLA0J007305.604ON72692607.7
NCAS0C058604.15ON1868113608.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C02670
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   249   7e-87
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   234   1e-80
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   229   7e-79
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   227   5e-78
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   227   5e-78
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   227   6e-78
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   223   2e-76
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   222   3e-76
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   222   3e-76
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   221   9e-76
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   221   9e-76
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   221   1e-75
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   213   2e-72
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   211   8e-72
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   209   7e-71
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   207   5e-70
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   206   1e-69
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   206   1e-69
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   196   1e-65
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    54   1e-09
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    49   9e-08
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    49   2e-07
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    47   7e-07
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    45   1e-06
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    46   1e-06
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    46   2e-06
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    44   5e-06
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    44   6e-06
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    44   6e-06
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    44   8e-06
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    44   9e-06
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    43   1e-05
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    43   2e-05
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    42   4e-05
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    42   5e-05
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    42   7e-05
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    41   1e-04
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    40   3e-04
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    39   3e-04
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    30   0.95 
Kpol_311.5 s311 complement(13607..15346) [1740 bp, 579 aa] {ON} ...    30   1.1  
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    30   1.5  
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    30   1.5  
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    30   1.8  
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    30   2.1  
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    29   2.2  
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    29   2.7  
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    29   2.7  
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    29   3.0  
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    29   3.2  
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    29   3.3  
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    29   3.8  
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    29   3.8  
YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffo...    29   4.1  
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...    28   4.5  
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    28   4.5  
Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL06...    28   4.5  
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    28   5.2  
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    28   5.8  
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    28   6.2  
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    28   7.2  
TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5....    28   7.7  
NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]...    28   8.5  

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  249 bits (636), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  234 bits (596), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 112/122 (91%), Positives = 118/122 (96%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLLGEGESKL IDPDTK+PNAVVITF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFA FKLR+QT+EGYDPK ALKNACN+IINKLGILKTNFETEWNLQTLASDENF
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  229 bits (584), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 116/122 (95%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLLGEGESKL IDPDTKAPNAVVITF+KEDHTLGNLIRSELLND +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFA FKLRIQTVEGYDPK ALKNACN+II+KLG+LK NFETEWNLQTLA+DEN 
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  227 bits (578), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 111/120 (92%), Positives = 114/120 (95%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPD+FELFLLGEGESKL I+PDTKAPNAVVITF+KEDHTLGNLIRSELLND KVLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA FKLRIQTVE YDPK ALKNACNNIINKLGILKTNFETEWNLQTLASDENF
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  227 bits (578), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLLGEGESKL I+PDTKAPNAVVITF+KEDHTLGNLIRSELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA FK+RIQTVEGYDPK ALKNACN IINKL +LKTNFETEWNLQTLASD+N+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  227 bits (578), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 107/122 (87%), Positives = 116/122 (95%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLLGEGESKL +DPDTKAPNA+V+TF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA FK+RIQT+EGYDPK ALKNACN IINKLG+LKTNFETEWNLQTLASD+NF
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  223 bits (568), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLLG+GESKL IDPDTK+PNA+VITF KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFA FKLRIQTVEGYDPK ALKNACN IINKLGILKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  222 bits (566), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLLGEGESKL IDPDTKAPNAVVITF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFA FKLRIQT EGYDPK ALKNACN+IINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  222 bits (566), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLLGEGESKL IDPDTKAPNAVVITF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFA FKLRIQT EGYDPK ALKNACN+IINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDDAF 120

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  221 bits (563), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 107/122 (87%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLLGEGESKL I+PDTKAPNAVVITF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFA FKLRIQT EGYDPK ALKNACN+IINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 GI 122
            +
Sbjct: 121 NM 122

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  221 bits (563), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 107/122 (87%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLLGEGESKL I+PDTKAPNAVVITF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFA FKLRIQT EGYDPK ALKNACN+IINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 GI 122
            +
Sbjct: 121 NM 122

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  221 bits (563), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 114/120 (95%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLLGEGESKL IDPDTKAPNAVVITF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFA FKLRIQTVEGYDPK AL+NAC++IINKLG LK+NFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADDAF 120

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  213 bits (542), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 100/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLL EGESKL I+PDTKAPNAV+ITF+KEDHTLGNLIR+ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA FK+RIQTVEGYDPK ALKNACNNII KL  L++NFETEW+LQTLAS+EN+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

Query: 121 GI 122
           G+
Sbjct: 121 GL 122

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  211 bits (537), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 101/118 (85%), Positives = 109/118 (92%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFE FLLGEGESKL I+PDTKAPN VVITF+KEDHTLGNLI+SELL+D KVLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDE 118
           YKVEHP FA FK+RIQTVEGYDPK AL+ ACN+II KLGILKTNFETEWNLQTLASD+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  209 bits (531), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 103/120 (85%), Positives = 109/120 (90%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLL EG+SKL I+ DTKA NAVVITF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA FKLRIQT E YDPK ALK ACNNIINKLGILKTNF+TEWNLQTLASD+NF
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  207 bits (526), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 109/122 (89%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLL EGE+KL IDPDTKAPNAV++TF+KEDHTL NLIR ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA FKLRIQTVEGYDPK ALKNACN II+KLG L++NFETEWNLQTLAS++N+
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GI 122
            +
Sbjct: 121 AM 122

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  206 bits (524), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 96/122 (78%), Positives = 109/122 (89%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLL EGESKL I+PDTKA NAV+ITF+KEDHTLGN+IR+ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA F++RIQT EGYDPK ALKNACN+IINKL  LK+NFETEWNLQTLAS++ F
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

Query: 121 GI 122
            +
Sbjct: 121 RL 122

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  206 bits (523), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 96/122 (78%), Positives = 109/122 (89%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLL EGE+KL IDPDTKAPNAV++TF+KEDHTL NLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA FK+RIQT EGYDPK ALKNACN II+KLG L++NFETEWNLQTLAS++N+
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GI 122
            +
Sbjct: 121 AM 122

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  196 bits (497), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 1/122 (0%)

Query: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60
           MNAPDRFELFLL EGESKL ++ DTKA +A+++TF+KEDHTLGNLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA FK+RIQTVEGYDPK ALKNACN+IINKL  L++NFETEWNLQTLA+ E++
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLAT-EDY 119

Query: 121 GI 122
           G+
Sbjct: 120 GM 121

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 53.5 bits (127), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 2/106 (1%)

Query: 2   NAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFA 59
           + P+  E+ +    E K+ I P+  +P+    +FQ  +EDHTLGN +R  ++ + +V F 
Sbjct: 18  SVPEVDEVDVNAVDEDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFC 77

Query: 60  AYKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNF 105
            Y + HP      LRIQT        AL+    ++++   +++  F
Sbjct: 78  GYSIPHPSETLLNLRIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 48.9 bits (115), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 16  ESKLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKL 73
           E K+ I P   + +    +FQ   EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTVEGYDPKLALKNACNNIINKLGILKTNF 105
           RIQT        AL+    ++++   +++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 48.5 bits (114), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 16  ESKLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKL 73
           ++K+ + P   + +    +FQ  +EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 40  KTKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNL 99

Query: 74  RIQTVEGYDPKLALKNACNNIINKLGILKTNF 105
           RIQT        AL+   +++I+    +K  F
Sbjct: 100 RIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 46.6 bits (109), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRI 75
           K+ + P+  + +    +FQ   EDHTLGN +R  ++ + +V F  Y + HP      LRI
Sbjct: 31  KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76  QTVEGYDPKLALKNACNNIINKLGILKTNF 105
           QT        AL     ++++   +++  F
Sbjct: 91  QTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 45.4 bits (106), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 28  PNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRIQTVEGYDPKL 85
           P+    +FQ   EDHTLGN +R  L+ +  V F  Y + HP      LR+QT        
Sbjct: 16  PDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYGDITASD 75

Query: 86  ALKNACNNIINKLGILKTNF 105
           AL     ++++   +++  F
Sbjct: 76  ALAQGLQDLMDLCDVVEDTF 95

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 12/106 (11%)

Query: 2   NAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFA 59
           + PDR ++ LL +  S+          +    +FQ  +EDHTLGN +R  ++ + +V F 
Sbjct: 40  DEPDREKIKLLTQATSE----------DGTSASFQIVEEDHTLGNALRYIIMKNPEVEFC 89

Query: 60  AYKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNF 105
            Y + HP      +RIQT        AL+    ++++   ++++ F
Sbjct: 90  GYSIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRI 75
           K+ I P   + +    +FQ  +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 35  KIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIRI 94

Query: 76  QTVEGYDPKLALKNACNNIINKLGILKTNF 105
           QT        ALK    ++++   +++  F
Sbjct: 95  QTYGEITAVDALKKGLADLMDLCDVVEETF 124

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 44.3 bits (103), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRI 75
           K+ I P+    +    +FQ   EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTVEGYDPKLALKNACNNIINKLGILKTNF 105
           QT        A K    ++++   +++  F
Sbjct: 98  QTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
          YNL113W
          Length = 129

 Score = 43.9 bits (102), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 12/76 (15%)

Query: 4  PDRFELFLLGEGESKLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAY 61
          PDR ++ LL          P   + +    +FQ  +EDHTLGN +R  ++ +  V F  Y
Sbjct: 29 PDREKIKLL----------PQASSEDGTCASFQIAEEDHTLGNALRYVIMKNKDVEFCGY 78

Query: 62 KVEHPFFANFKLRIQT 77
           + HP      LRIQT
Sbjct: 79 SIPHPSENLLNLRIQT 94

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 44.3 bits (103), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 12/104 (11%)

Query: 4   PDRFELFLLGEGESKLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAY 61
           PDR ++ LL +  S+          +    +FQ  +EDHTLGN +R  ++ +  V F  Y
Sbjct: 42  PDREKIKLLTQATSE----------DGTSASFQIVEEDHTLGNALRYVIMKNPDVEFCGY 91

Query: 62  KVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNF 105
            + HP      +RIQT        AL+    ++++   ++++ F
Sbjct: 92  SIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 44.3 bits (103), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 4   PDRFELFLLGEGESKLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAY 61
           PDR ++ +L EG S+          +    +FQ   EDHTLGN +R  ++ +  V F  Y
Sbjct: 50  PDREKVKILPEGASE----------DGTCASFQIVDEDHTLGNALRYIIMKNPNVEFCGY 99

Query: 62  KVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNF 105
            + HP      +RIQT        A +    ++++   +++  F
Sbjct: 100 SIPHPSENFLNVRIQTYGDITAVEAFQKGLQDLMDLCDVVEDKF 143

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 43.9 bits (102), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 12/104 (11%)

Query: 4   PDRFELFLLGEGESKLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAY 61
           PDR ++ LL +  S+          +    +FQ  +EDHTLGN +R  ++ +  V F  Y
Sbjct: 42  PDREKIKLLTQATSE----------DGTSASFQIVEEDHTLGNALRYIIMKNPDVEFCGY 91

Query: 62  KVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNF 105
            + HP      +RIQT        AL+    ++++   ++++ F
Sbjct: 92  SIPHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 4   PDRFELFLLGEGESKLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAY 61
           PDR ++ LL          P   + +    +FQ  +EDHTLGN +R  ++ + +V F  Y
Sbjct: 31  PDREKIKLL----------PQATSDDGTSASFQISEEDHTLGNALRYIIMKNPEVEFCGY 80

Query: 62  KVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNF 105
            + HP      +RIQT        AL+    ++++    ++  F
Sbjct: 81  SIPHPSENLLNVRIQTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa]
          {ON} highly similar to uniprot|Q755Q7 Ashbya gossypii
          AFL220C AFL220Cp and similar to YNL113W uniprot|P28000
          Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
          subunit common to RNA polymerases I and III
          Length = 130

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 18 KLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRI 75
          K+ I P   + +    +FQ  +EDHTLGN +R  ++ +  V F  Y + HP      +R+
Sbjct: 34 KIKILPQATSEDGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRV 93

Query: 76 QT 77
          QT
Sbjct: 94 QT 95

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 12/106 (11%)

Query: 2   NAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFA 59
           + PDR ++ LL +  S+          +    +FQ  +EDHTLGN +R  ++ +  V F 
Sbjct: 54  DEPDREKIKLLTQATSE----------DGTNASFQIVEEDHTLGNALRYIIMKNPDVEFC 103

Query: 60  AYKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNF 105
            Y + HP      +RIQT        AL+    ++++   +++  F
Sbjct: 104 GYSIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 42.0 bits (97), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 2/90 (2%)

Query: 18  KLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRI 75
           K+ + P   + +     FQ   EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 39  KIRLLPQATSEDGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRI 98

Query: 76  QTVEGYDPKLALKNACNNIINKLGILKTNF 105
           QT        AL     ++++   +++  F
Sbjct: 99  QTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 41.6 bits (96), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLTIDPDTKAPNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRI 75
           K+ I     + +    +FQ  +EDHTLGN +R  ++ + +V F  Y + HP      +RI
Sbjct: 53  KIKILQQGASEDGCSASFQILQEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRI 112

Query: 76  QTVEGYDPKLALKNACNNIINKLGILKTNF 105
           QT        AL     ++++   +++  F
Sbjct: 113 QTYGEITAVEALHKGLQDLMDLCDVVEEKF 142

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 27  APNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRIQTVEGYDPK 84
           + +    +FQ  +EDHTLGN +R  ++ +  V F  Y + HP      LRIQT   +   
Sbjct: 59  SEDGTCASFQISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAV 118

Query: 85  LALKNACNNIINKLGILKTNF 105
             L+    ++++    ++  F
Sbjct: 119 EVLQKGLQDLMDLCDAVEDKF 139

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 27  APNAVVITFQ--KEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRIQT 77
           + +    +FQ  +EDHTLGN +R  ++ +  V F  Y + HP      LRIQT
Sbjct: 63  SEDGTCASFQISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQT 115

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%)

Query: 38  EDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINK 97
           EDHTLGN +R  ++ + +V F  Y + HP      +RIQT        AL     ++++ 
Sbjct: 53  EDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRIQTYGKITAVEALHKGLGDLMDM 112

Query: 98  LGILKTNF 105
              ++  F
Sbjct: 113 CDAVEDRF 120

>TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {ON}
           Anc_7.441 YBL105C
          Length = 1150

 Score = 30.4 bits (67), Expect = 0.95,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 30/74 (40%), Gaps = 1/74 (1%)

Query: 5   DRFELFLLGEGE-SKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAAYKV 63
           D   L +LG+G   K+ +           I   K+DH + N   +    + KV   A K 
Sbjct: 822 DFILLKVLGKGNFGKVLLSKSKNTGRVCAIKVLKKDHIIQNHDIASARAEKKVFLLATKT 881

Query: 64  EHPFFANFKLRIQT 77
           +HPF  N     QT
Sbjct: 882 KHPFLTNLYCSFQT 895

>Kpol_311.5 s311 complement(13607..15346) [1740 bp, 579 aa] {ON}
           complement(13607..15346) [1740 nt, 580 aa]
          Length = 579

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 25  TKAPNAVVITF---QKEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRIQTVEGY 81
           TK PN++ I F    K + + GN IR++ L    ++    +++ P+F + K+ I+ +EG 
Sbjct: 79  TKNPNSLTILFFSSLKFNGSFGNGIRNKFLPYLNII--PIELDQPYFWDPKI-IEVIEGT 135

Query: 82  DPKLALKNACNNIINK 97
           D  L +KN    I N+
Sbjct: 136 DLFLIMKNNLIEIFNE 151

>TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7.441
           YBL105C
          Length = 1145

 Score = 30.0 bits (66), Expect = 1.5,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 2/75 (2%)

Query: 5   DRFELF-LLGEGE-SKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAAYK 62
           D F L  +LG+G   K+ +           I   K+DH + N        + KV   A K
Sbjct: 816 DDFVLLKVLGKGNFGKVLLSKSKNTDRLCAIKVLKKDHIIQNHDIESARAEKKVFLLATK 875

Query: 63  VEHPFFANFKLRIQT 77
            +HPF  N     QT
Sbjct: 876 AKHPFLTNLYCSFQT 890

>Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W
           (REAL)
          Length = 603

 Score = 30.0 bits (66), Expect = 1.5,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 51  LNDGKVLFAAYKVEHPFFANFKLRIQTVEGYDPKLALKNA-CNNII 95
           +  G+ L+++ + E PF+ N+    +   GY+P  +LK A C N+I
Sbjct: 522 MRTGRQLWSSAEKEDPFYMNYLKGRKEKGGYEPIESLKRARCRNVI 567

>TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {ON}
           Anc_7.441 YBL105C
          Length = 1139

 Score = 29.6 bits (65), Expect = 1.8,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 29/74 (39%), Gaps = 1/74 (1%)

Query: 5   DRFELFLLGEGE-SKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAAYKV 63
           D   L +LG+G   K+ +           I   K+DH + N        + KV   A K 
Sbjct: 811 DFILLKVLGKGNFGKVLLSKSKNTGTICAIKVLKKDHIIQNHDIESARAEKKVFLLASKA 870

Query: 64  EHPFFANFKLRIQT 77
           +HPF  N     QT
Sbjct: 871 KHPFLTNLYCSFQT 884

>SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON}
           similar to uniprot|P24583 Saccharomyces cerevisiae
           YBL105C PKC1 Protein Kinase C
          Length = 1175

 Score = 29.6 bits (65), Expect = 2.1,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 9   LFLLGEGE-SKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAAYKVEHPF 67
           L +LG+G   K+ +       +   I   K+DH + N        + KV   A K +HPF
Sbjct: 851 LKVLGKGNFGKVLLAKSKNTDSLCAIKVLKKDHIIKNHDIESARAEKKVFLLATKAKHPF 910

Query: 68  FANFKLRIQT 77
             N     QT
Sbjct: 911 LTNLYCSFQT 920

>ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {ON}
           similar to uniprot|P25333 Saccharomyces cerevisiae
           YCR008W
          Length = 606

 Score = 29.3 bits (64), Expect = 2.2,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 51  LNDGKVLFAAYKVEHPFFANFKLRIQTVEGYDPKLALKNA-CNNII 95
           +  G+ L+   + E PFFA +  + +   G++P   LK A C N+I
Sbjct: 525 MRTGRQLWKVAQKEDPFFAKYLRKRKEKGGFEPIENLKRARCRNVI 570

>CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa]
           {ON} similar to uniprot|P25333 Saccharomyces cerevisiae
           YCR008w SAT4 serine/threonine-specific protein kinase
          Length = 596

 Score = 29.3 bits (64), Expect = 2.7,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 51  LNDGKVLFAAYKVEHPFFANFKLRIQTVEGYDPKLALKNA-CNNII 95
           +  G+ L+ A K + PF+  +    +   GY+P  +LK A C N+I
Sbjct: 497 MRTGRQLWTAAKKDDPFYNKYLQGRRQKSGYEPIESLKRARCRNVI 542

>Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} similar
           to Ashbya gossypii ACR191C
          Length = 1143

 Score = 29.3 bits (64), Expect = 2.7,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 29/74 (39%), Gaps = 1/74 (1%)

Query: 5   DRFELFLLGEGE-SKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAAYKV 63
           D   L +LG+G   K+ +           I   K+DH + N        + KV   A K 
Sbjct: 815 DFILLKVLGKGNFGKVLLAKSKNTDRLCAIKVLKKDHIIQNHDIESARAEKKVFLLATKA 874

Query: 64  EHPFFANFKLRIQT 77
           +HPF  N     QT
Sbjct: 875 KHPFLTNLYCSFQT 888

>Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON}
           complement(37953..41447) [3495 nt, 1165 aa]
          Length = 1164

 Score = 29.3 bits (64), Expect = 3.0,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 27/68 (39%), Gaps = 1/68 (1%)

Query: 11  LLGEGE-SKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFA 69
           +LG+G   K+ +           I   K+DH + N        + KV   A K +HPF  
Sbjct: 842 VLGKGNFGKVLLSKSKNTGRICAIKVLKKDHIIQNHDIESARAEKKVFLLATKAKHPFLT 901

Query: 70  NFKLRIQT 77
           N     QT
Sbjct: 902 NLYCSFQT 909

>ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL105C
           (PKC1)
          Length = 1149

 Score = 28.9 bits (63), Expect = 3.2,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 1/70 (1%)

Query: 9   LFLLGEGE-SKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAAYKVEHPF 67
           L +LG+G   K+ +           I   K+DH + N        + KV   A K +HPF
Sbjct: 825 LKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARAEKKVFLLATKAKHPF 884

Query: 68  FANFKLRIQT 77
             N     QT
Sbjct: 885 LTNLYCSFQT 894

>KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa]
           {ON} similar to uniprot|P24583 Saccharomyces cerevisiae
           YBL105C PKC1 Protein Kinase C
          Length = 1164

 Score = 28.9 bits (63), Expect = 3.3,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 30/75 (40%), Gaps = 2/75 (2%)

Query: 5   DRFELF-LLGEGE-SKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAAYK 62
           D F L  +LG+G   K+ +           I   K+DH + N        + KV   A K
Sbjct: 835 DDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKKVFLLATK 894

Query: 63  VEHPFFANFKLRIQT 77
            +HPF  N     QT
Sbjct: 895 AKHPFLTNLYCSFQT 909

>Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W
           (REAL)
          Length = 604

 Score = 28.9 bits (63), Expect = 3.8,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 51  LNDGKVLFAAYKVEHPFFANFKLRIQTVEGYDPKLALKNA-CNNII 95
           +  G+ L+++ + + PF+ N+    +   GY+P  +LK A C N+I
Sbjct: 523 MRTGRQLWSSAEKDDPFYMNYLKARKEKGGYEPIESLKRARCRNVI 568

>Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa]
           {ON} YBL105C (PKC1) - Protein Kinase C [contig 34] FULL
          Length = 1154

 Score = 28.9 bits (63), Expect = 3.8,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 1/70 (1%)

Query: 9   LFLLGEGE-SKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAAYKVEHPF 67
           L +LG+G   K+ +           I   K+DH + N        + KV   A K +HPF
Sbjct: 830 LKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKKVFLLATKAKHPF 889

Query: 68  FANFKLRIQT 77
             N     QT
Sbjct: 890 LTNLYCSFQT 899

>YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffold
           protein that assists in association of the proteasome
           core particle with the regulatory particle; degraded by
           the mature proteasome after assembly; contains HEAT-like
           repeats
          Length = 1868

 Score = 28.9 bits (63), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 11  LLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRS--ELLND---GKVLFAAYKVEH 65
           L  EG  KL + P T A N  ++  Q +  TLG++++   EL++D    + LF + K + 
Sbjct: 397 LHAEGWPKLQLGPQTPAFNTAILQRQLQYETLGDILKRDFELVSDLSYIEFLFESLKNDL 456

Query: 66  PFF 68
           P F
Sbjct: 457 PQF 459

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score = 28.5 bits (62), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 7/99 (7%)

Query: 22  DPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRIQTVEGY 81
           DPD K  N +  T      T G L+ S  LN+  V  AA ++      ++  R      +
Sbjct: 51  DPDHKIMNPLFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQ----HWDYRENFPNEF 106

Query: 82  DPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120
           DP    +    +I+ +L I++ N     N   ++ DENF
Sbjct: 107 DPASDTREDTKSIVLRLPIVELN---GMNTLLISVDENF 142

>YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Thr
           protein kinase involved in salt tolerance; funtions in
           regulation of Trk1p-Trk2p potassium transporter;
           partially redundant with Hal5p; has similarity to Npr1p
          Length = 603

 Score = 28.5 bits (62), Expect = 4.5,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 51  LNDGKVLFAAYKVEHPFFANFKLRIQTVEGYDPKLALKNA-CNNII 95
           +  G+ L+++ + + PF+ N+    +   GY+P  +LK A C N+I
Sbjct: 522 MRTGRQLWSSAEKDDPFYMNYLKGRKEKGGYEPIESLKRARCRNVI 567

>Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL067C
           - Hypothetical ORF [contig 11] FULL
          Length = 678

 Score = 28.5 bits (62), Expect = 4.5,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 28/59 (47%)

Query: 41  TLGNLIRSELLNDGKVLFAAYKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLG 99
           T G+L+R E  N  K    AY  EHP   N+++   T + ++   A     N+I   +G
Sbjct: 547 TRGSLLRGEAGNSWKPPVLAYNQEHPHLLNWQVTNSTEKSFEKLDAYSLLINDIERYVG 605

>Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)
          Length = 614

 Score = 28.5 bits (62), Expect = 5.2,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 51  LNDGKVLFAAYKVEHPFFANFKLRIQTVEGYDPKLALKNA-CNNII 95
           +  G+ L+++ + + PF+ N+    +   GY+P  +LK A C N+I
Sbjct: 533 MRTGRQLWSSAEKDDPFYLNYLKGRKEKGGYEPIESLKRARCRNVI 578

>KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {ON}
           Anc_7.441 YBL105C
          Length = 1150

 Score = 28.1 bits (61), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 9   LFLLGEGE-SKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAAYKVEHPF 67
           L +LG+G   K+ +           I   K+D+ + N        + KVL  A K +HPF
Sbjct: 826 LKVLGKGNFGKVILSKSKNTGRLCAIKVLKKDNIIQNHDIESARAEKKVLLLATKTKHPF 885

Query: 68  FANFKLRIQT 77
             N     QT
Sbjct: 886 LTNLYCSFQT 895

>Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON}
           YBL105C (REAL)
          Length = 1151

 Score = 28.1 bits (61), Expect = 6.2,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 2/75 (2%)

Query: 5   DRFELF-LLGEGESKLTIDPDTKAPNAV-VITFQKEDHTLGNLIRSELLNDGKVLFAAYK 62
           D F L  +LG+G     I   +K  N +  I   K+D+ + N        + KV   A K
Sbjct: 822 DNFVLLKVLGKGNFGKVILSKSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATK 881

Query: 63  VEHPFFANFKLRIQT 77
            +HPF  N     QT
Sbjct: 882 TKHPFLTNLYCSFQT 896

>CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]
           {ON} highly similar to uniprot|P24583 Saccharomyces
           cerevisiae YBL105c PKC1 ser/thr protein kinase
          Length = 1144

 Score = 28.1 bits (61), Expect = 7.2,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 2/75 (2%)

Query: 5   DRFELF-LLGEGESKLTIDPDTKAPNAV-VITFQKEDHTLGNLIRSELLNDGKVLFAAYK 62
           D F L  +LG+G     I   +K  N +  I   K+D+ + N        + KV   A K
Sbjct: 815 DNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATK 874

Query: 63  VEHPFFANFKLRIQT 77
            +HPF  N     QT
Sbjct: 875 TKHPFLTNLYCSFQT 889

>TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5.604
           YOR022C
          Length = 726

 Score = 27.7 bits (60), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 42/92 (45%), Gaps = 15/92 (16%)

Query: 40  HTLGNLIRSELLNDGKVLFAAYKVEHPFFAN-----FKLRIQT-VEGYDPKLALKNACNN 93
           H+LGNLI  +LLN+ K     +KV + F        FKL  +T ++G      + N    
Sbjct: 499 HSLGNLILFDLLNNTKKYSLNFKVGNYFCLGSPAGVFKLIQRTNIDG------INNKAGK 552

Query: 94  IINKLGILKTNFETE---WNLQTLASDENFGI 122
            + K   LK  ++ E   W  QTL   E + I
Sbjct: 553 ELGKRKKLKQKYQLEIDNWQTQTLPCKELYNI 584

>NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]
           {ON} Anc_4.15 YHL030W
          Length = 1868

 Score = 27.7 bits (60), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 6/113 (5%)

Query: 11  LLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSE--LLNDGKVLFAAYKVEHPFF 68
           L  EG  KL +   T A N  ++  + +  TLG+++  E  L+ D   +   +       
Sbjct: 391 LHAEGWPKLQLGESTPAFNTTILQRRLQYETLGDILMKEFSLVEDLSFIEFLFDSLQGDL 450

Query: 69  ANFKLRIQ-TVEGYDPKLALKNACNNIINKL-GILKTNFETEWNLQTLASDEN 119
           + F+  IQ  +    P L  +   ++  +KL GILK     ++NLQ  +SD+N
Sbjct: 451 SEFRASIQEALISLTPHL--RKLPSSSKDKLKGILKNLLSDDFNLQEASSDQN 501

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.138    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,948,634
Number of extensions: 554332
Number of successful extensions: 1391
Number of sequences better than 10.0: 80
Number of HSP's gapped: 1390
Number of HSP's successfully gapped: 80
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)