Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C026606.29ON1657139360770.0
NCAS0D021306.29ON1434114432620.0
Kpol_1037.226.29ON1496113730690.0
ZYRO0C07524g6.29ON1670113330660.0
TDEL0G044006.29ON1490115430210.0
YOL004W (SIN3)6.29ON1536114530000.0
KNAG0F029206.29ON1492113829900.0
KAFR0A051206.29ON147988428390.0
Smik_15.1666.29ON1566101427410.0
TBLA0E031606.29ON173987327260.0
TPHA0J004006.29ON151286427200.0
Suva_15.1716.29ON156198027100.0
Skud_15.1586.29ON155596526950.0
SAKL0E01540g6.29ON141584026670.0
CAGL0E02475g6.29ON149382626540.0
KLLA0C06182g6.29ON151986426500.0
Ecym_30336.29ON147491226410.0
ACL004W6.29ON137788826190.0
KLTH0C10956g6.29ON143381026180.0
Kwal_56.224626.29ON154185125770.0
CAGL0J11594g6.29ON9373596221e-65
ZYRO0D04950g7.32ON77671746.8
NCAS0A120605.500ON154383739.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C02660
         (1657 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  2345   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1261   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1186   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1185   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1168   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1160   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1156   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1098   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1060   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1054   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1052   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1048   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1042   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1031   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1026   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1025   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1021   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1013   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1013   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...   997   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   244   1e-65
ZYRO0D04950g Chr4 complement(416099..418429) [2331 bp, 776 aa] {...    33   6.8  
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    33   9.7  

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 2345 bits (6077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1176/1393 (84%), Positives = 1176/1393 (84%)

Query: 265  EEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 324
            EEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF
Sbjct: 265  EEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 324

Query: 325  KGYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVDNTNVSXXXXXXX 384
            KGYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVDNTNVS       
Sbjct: 325  KGYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVDNTNVSPTLPTVQ 384

Query: 385  XXXXXXXXXGNNDTTNVINNAANQPQQVHAQTHLXXXXXXXXXXXXXXXXXXXXXXXXXX 444
                     GNNDTTNVINNAANQPQQVHAQTHL                          
Sbjct: 385  PLLQQPQPQGNNDTTNVINNAANQPQQVHAQTHLQEQTQAQTPADADAQAQAEVQAQVQA 444

Query: 445  XXXXXXXXXXXXXXXXXXXEVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKP 504
                               EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKP
Sbjct: 445  HAQAQAQAQAQMQAQNQNPEVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKP 504

Query: 505  ISEVYEQVTVLFNDAPDLLEDFKKFLPETPANNXXXXXXXXXXXXXXXXXXXXXXXXXXX 564
            ISEVYEQVTVLFNDAPDLLEDFKKFLPETPANN                           
Sbjct: 505  ISEVYEQVTVLFNDAPDLLEDFKKFLPETPANNQPVQQPHAHPQLQQLQPRIPSISQQQQ 564

Query: 565  XXXXYPFSNNGPVPSGFYQIPQQNLPPIGSFSXXXXXXXXXXXXXXXGTVVNNFRHGISM 624
                YPFSNNGPVPSGFYQIPQQNLPPIGSFS               GTVVNNFRHGISM
Sbjct: 565  PSQLYPFSNNGPVPSGFYQIPQQNLPPIGSFSPPTATNANATTTPAAGTVVNNFRHGISM 624

Query: 625  QTALPSMMTPDTEAIPISNLRSVDGFPPSSGGVIPMPNNQTADFXXXXXXXXXXLTNRLP 684
            QTALPSMMTPDTEAIPISNLRSVDGFPPSSGGVIPMPNNQTADF          LTNRLP
Sbjct: 625  QTALPSMMTPDTEAIPISNLRSVDGFPPSSGGVIPMPNNQTADFQYQQQQPQPPLTNRLP 684

Query: 685  DQFPLDXXXXXXXXXXXXXXXXXXXLISEAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLV 744
            DQFPLD                   LISEAPTRPEIDLDPSIV               LV
Sbjct: 685  DQFPLDQQQSQQQQAQQQAQQQQQQLISEAPTRPEIDLDPSIVPIIPEPTEPIENNITLV 744

Query: 745  EETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTF 804
            EETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTF
Sbjct: 745  EETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTF 804

Query: 805  VGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWV 864
            VGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWV
Sbjct: 805  VGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWV 864

Query: 865  GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTA 924
            GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTA
Sbjct: 865  GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTA 924

Query: 925  EEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDE 984
            EEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDE
Sbjct: 925  EEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDE 984

Query: 985  EWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKR 1044
            EWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKR
Sbjct: 985  EWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKR 1044

Query: 1045 IHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFS 1104
            IHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFS
Sbjct: 1045 IHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFS 1104

Query: 1105 IPSSEIDKKLSGKNDEKFEKGXXXXXXXXXXXXXAKKRSLELDIPLADVLRKYKYQKIKE 1164
            IPSSEIDKKLSGKNDEKFEKG             AKKRSLELDIPLADVLRKYKYQKIKE
Sbjct: 1105 IPSSEIDKKLSGKNDEKFEKGSSSSSSTSNSTPSAKKRSLELDIPLADVLRKYKYQKIKE 1164

Query: 1165 KVINELENNSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGL 1224
            KVINELENNSN                              MKKPWLLGSVIDKTSEHGL
Sbjct: 1165 KVINELENNSNEYDERDEEFDEELKRQQQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGL 1224

Query: 1225 IENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLIST 1284
            IENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLIST
Sbjct: 1225 IENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLIST 1284

Query: 1285 QLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQAL 1344
            QLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQAL
Sbjct: 1285 QLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQAL 1344

Query: 1345 VKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENT 1404
            VKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENT
Sbjct: 1345 VKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENT 1404

Query: 1405 NHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFXXXXXXXXXX 1464
            NHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPF          
Sbjct: 1405 NHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELE 1464

Query: 1465 XAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTD 1524
             AQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTD
Sbjct: 1465 NAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTD 1524

Query: 1525 AXXXXXXXXXXXXAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQETGEFIPIPKPITTE 1584
            A            AFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQETGEFIPIPKPITTE
Sbjct: 1525 AKKIESSIKEKSEAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQETGEFIPIPKPITTE 1584

Query: 1585 STTGVIAEPVIKPASNPIVVTPVTAAIEAVATAPIPTDSGALTDNSDHKGKDDQETEGKP 1644
            STTGVIAEPVIKPASNPIVVTPVTAAIEAVATAPIPTDSGALTDNSDHKGKDDQETEGKP
Sbjct: 1585 STTGVIAEPVIKPASNPIVVTPVTAAIEAVATAPIPTDSGALTDNSDHKGKDDQETEGKP 1644

Query: 1645 TPIETSAITELQN 1657
            TPIETSAITELQN
Sbjct: 1645 TPIETSAITELQN 1657

 Score =  190 bits (482), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 117/197 (59%)

Query: 1   MSGIWNNPSTQDNTGSANVDXXXXXXXXXTEKRGLPGSASSDKEIQDSASNRNEQITLPS 60
           MSGIWNNPSTQDNTGSANVD         TEKRGLPGSASSDKEIQDSASNRNEQITLPS
Sbjct: 1   MSGIWNNPSTQDNTGSANVDRNNNRSNNSTEKRGLPGSASSDKEIQDSASNRNEQITLPS 60

Query: 61  INSQSFAHVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXGXXXXXXXXXXXXXFPANSNNI 120
           INSQSFAHVV                            G             FPANSNNI
Sbjct: 61  INSQSFAHVVSNTNNSSNNISDNNSDNKHNKNSNNNNNGATPASITATTPSIFPANSNNI 120

Query: 121 NKNNMPVLHSVQTHQSPMNNPSVSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSQSH 180
           NKNNMPVLHSVQTHQSPMNNPSVSP                              VSQSH
Sbjct: 121 NKNNMPVLHSVQTHQSPMNNPSVSPARAARAANTSTTTATATTNNNIVESNRNNNVSQSH 180

Query: 181 PQRNNSASAGFSVASFD 197
           PQRNNSASAGFSVASFD
Sbjct: 181 PQRNNSASAGFSVASFD 197

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1261 bits (3262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1144 (58%), Positives = 779/1144 (68%), Gaps = 98/1144 (8%)

Query: 464  EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
            EVEFSQAINYVNKIK R+ADQP IYK FLEILQTYQRE+KPI+EVY QVTVLF  APDLL
Sbjct: 357  EVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLL 416

Query: 524  EDFKKFLPETPANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPFSNNGPVPSGFYQ 583
            +DFKKFLPE+                                   Y + NN   P+G   
Sbjct: 417  DDFKKFLPESSG-----TTSTSELPQNAGIQQRAAIPTPNPKHQQYGYPNNY-YPNGTGT 470

Query: 584  IPQQNLPPIGSFSXXXXXXXXXXXXXXXGTVVNNFRHGISM--QTALPSMMTPD------ 635
              QQNLPPIGSF+               GT    +  G        LPSM+  D      
Sbjct: 471  --QQNLPPIGSFAPPN------------GTASREYAPGNQFVGPGGLPSMIPNDQALQQQ 516

Query: 636  ----------TEAIPISNLRSVDGFPPSSGGVIPMPNNQTADFXXXXXXXXXXLTNRL-P 684
                       EAIP+SNLRS            P+ + Q  +           + N++ P
Sbjct: 517  QQPGLVHGYTNEAIPVSNLRS------------PLTDQQYPNLLN--------MQNQMTP 556

Query: 685  DQFPLDXXXXXXXXXXXXXXXXXXXLISEAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLV 744
             Q  ++                     +EAP RPEIDLDPSIV               LV
Sbjct: 557  GQMDINNATAPMAQQ----------YTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLV 606

Query: 745  EETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTF 804
            EET+FFEK KKFI +K +Y EFLK+LNLYSQDLL+T+EL  +V+YY+GSN+ELF WFK F
Sbjct: 607  EETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNF 666

Query: 805  VGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWV 864
            VG+ E P  IENI+HEKHKLDLDLCEA GPSYKKLPKTDTFMPCSGRD MCWEVLNDEWV
Sbjct: 667  VGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWV 726

Query: 865  GHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTA 924
            GHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IESNLRTIQTLETIANKI NMT 
Sbjct: 727  GHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTN 786

Query: 925  EEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDE 984
            EEKKNFKLP GLGHTSSTIYKKVIRKVYDK+RGFEIID LHE PA  VP++L+RLK+KDE
Sbjct: 787  EEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDE 846

Query: 985  EWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKR 1044
            EWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQL+SEISSI+VDQ NKR
Sbjct: 847  EWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKR 906

Query: 1045 IHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFS 1104
            IHWLTPKPKSQL+F F+D+DI VDIL L +VFI+H+STYSN EKER+KDFLRVF+ LFFS
Sbjct: 907  IHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFS 966

Query: 1105 IPSSEIDKKLSGKNDEKFEKGXXXXXXXX---------XXXXXAKKRSLELDIPLADVLR 1155
            IP  ++++ LS ++    EK                       +KKR L +DIPLAD+LR
Sbjct: 967  IPLDKVNEALSDRSHWLQEKEKKTKESSRNIDSTTSSSSSGSNSKKRPLNIDIPLADILR 1026

Query: 1156 KYKYQKIKEKVINELENNSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKPWLLGSV 1215
            K+KYQKI+++     E+N                                +K+PWLLG++
Sbjct: 1027 KHKYQKIRKQA---KESNEENAQEEDDENIVGDSNEELNEQDENEIILEEIKRPWLLGNI 1083

Query: 1216 IDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPF 1275
            I+  S HG I NR +FN+FANTNIYVFFR WT IYERL E+KQIN+KVT+E+NSR+++ F
Sbjct: 1084 IETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQF 1143

Query: 1276 AKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLY 1335
            AKDL LISTQL  MGLDF   +SY+ELL L+KRLI+NDIEHQWFEESLRQA+NNKAFKLY
Sbjct: 1144 AKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLY 1203

Query: 1336 TADKVIQALVKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENM 1395
            T DKVIQ+LVKHA++IL D K SEIM LFEKDRL SST+ ++QI+YRLQTR HMTNTENM
Sbjct: 1204 TVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENM 1263

Query: 1396 FRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFX 1455
            FRIEFNE  NHVCIQYIA+EDLT+K   + ++ WEYYVTSY+LPHPTEGVPQ+ LK+PF 
Sbjct: 1264 FRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFL 1323

Query: 1456 XXXXXXXXXXAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSR 1515
                        ++D E +      K SPEG+S+SKLKIKID ++Y L++EPGSFD+FSR
Sbjct: 1324 EKTLEL------EVDEEGDN-----KSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSR 1372

Query: 1516 KSLNKFPTDAXXXXXXXXXXXXAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQE----T 1571
            KS+N +PT                 KFL  K GW           IE+  KK +E    T
Sbjct: 1373 KSMNVYPT--YSDETKKRKSIDQMTKFLDGKNGWKKNLTTADSTNIEDLVKKSRELSKAT 1430

Query: 1572 GEFI 1575
            GE I
Sbjct: 1431 GEQI 1434

 Score =  178 bits (451), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 80/107 (74%), Positives = 93/107 (86%)

Query: 266 EDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325
           +D  YRPLNVKDALSYLEQVK QF+ +P IYNQFLDIMKDFKSQ+IDTPGVIERVS LF+
Sbjct: 203 QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

Query: 326 GYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVD 372
           GYP+L+QGFNTFLPQGY I C+ +PD P+RVTTPMGTST +  P ++
Sbjct: 263 GYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLSGGPAME 309

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 40/63 (63%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K +++ +P IY  FL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 215 ALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPMLVQGFNTF 274

Query: 530 LPE 532
           LP+
Sbjct: 275 LPQ 277

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 39/64 (60%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A++Y+ ++K +F  QP IY +FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422

Query: 338 LPQG 341
           LP+ 
Sbjct: 423 LPES 426

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1186 bits (3069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/1137 (53%), Positives = 759/1137 (66%), Gaps = 70/1137 (6%)

Query: 464  EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
            +VEFSQA++YVNKIK R+ADQP IYKHFLEILQTYQRE+KPISEVY QVTVLF +APDLL
Sbjct: 360  DVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLL 419

Query: 524  EDFKKFLPETPANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPFSNNGPVPSGFYQ 583
            +DFKKFLP++  +                                    NNG   +G   
Sbjct: 420  DDFKKFLPDSSPSVTTQQPVQPQQQALPQQQQPMYGV------------NNGYYQAGKIP 467

Query: 584  IPQQNLPPIGSFSXXXXXXXXXXXXXXXGTVVNNFRHGISMQTALPSMMTPDTEAIPISN 643
               QNLPP+G+FS                   ++         ALPSM+   TE    + 
Sbjct: 468  SANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHM-------MALPSMLQAPTEH---AQ 517

Query: 644  LRSVDGFPPSSGGVIPMPN--NQTADFXXXXXXXXXXLTNRLPDQFPLDXXXXXXXXXXX 701
            L +     P +   IP+ +  +Q  D             N + +  P++           
Sbjct: 518  LHAQQHIAPMTNEAIPISDLRSQIID------------NNHVHNYTPIELAQLQQQQQQQ 565

Query: 702  XXXXX---------XXXLISEAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEK 752
                               +E   RPEIDLDPSIV               LVEE +FF+K
Sbjct: 566  QQQQQQQQQQQMQLEAAYATEGIVRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDK 625

Query: 753  VKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPS 812
             KKFI +K +Y+EFLK+LNLYSQD+LS ++L+ +VDYY+GSNKELFDWFK FVG+ + P 
Sbjct: 626  AKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPK 685

Query: 813  TIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASE 872
             IEN++HEKHKLDLDLCEA GPSYKKLPKTDTFMPCSGRD MCWEVLNDEWVGHPVWASE
Sbjct: 686  HIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASE 745

Query: 873  DSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKL 932
            DSGFIAHRKNQYEETLFKIEEERHEYDF+IESNLRTIQTLETIA+KI NMT EEK+ FKL
Sbjct: 746  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKL 805

Query: 933  PVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQRE 992
            P+GLGHTS+TIY+KVIRKVYDKERGFEIIDALHE+P+ AVP++L+RLK+KD+EWRRAQRE
Sbjct: 806  PIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQRE 865

Query: 993  WNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKP 1052
            WNKVWRELEQKV++KSLDHLGLTFKQ+DKKLLTTKQL++EISSI+VDQ NKRIHWLTPKP
Sbjct: 866  WNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKP 925

Query: 1053 KSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDK 1112
            KSQLD+   D  +L DIL LA+VFI+HTS+YSN +KERL+DFL+ +IGLFFSIP  EI  
Sbjct: 926  KSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKD 985

Query: 1113 KLSGKNDEKFEKGXXXXXXXXXXXXXAKKRSLELDIPLADVLRKYKYQKIKEKVINELEN 1172
             +    D   +               + KR  +++I L+D+L + +YQ++K  +      
Sbjct: 986  AVEAAIDNGKQ---LDENEQNSSKKNSNKRPRDVEICLSDILNRSRYQRLKHSL------ 1036

Query: 1173 NSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIFN 1232
                                              KKPWLLGS++++ +  GLI+NR I+N
Sbjct: 1037 ------DSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYN 1090

Query: 1233 LFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLD 1292
            +FAN N+YVF R+  TIY+RL E+K IND VT+EIN RKV  FAKDL LIS QL  MGLD
Sbjct: 1091 MFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLD 1150

Query: 1293 FKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSIL 1352
            F   DSY +LL L+KRLI+ D+EHQWFEESLRQAY N+AFKLYT DKVIQ+LVKHA++I+
Sbjct: 1151 FSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIM 1210

Query: 1353 TDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYI 1412
            TDSK+S++MALFEKDR+ SSTT++DQI+YRLQTR+HM+ TE+MFRIE+N   + + IQYI
Sbjct: 1211 TDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYI 1270

Query: 1413 AVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDNE 1472
            A++DLTL+   T ++ W+YY+TSY+L HPTEG+PQE +K+PF            +D D+ 
Sbjct: 1271 ALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDN 1330

Query: 1473 TEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTD--AXXXXX 1530
                    K SPEG+S S L IKID ETY L+VEPGSFD+FSRKS+NKFP D  +     
Sbjct: 1331 P-------KYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFPVDVFSESYKV 1383

Query: 1531 XXXXXXXAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQETGEFIPIPKPITTESTT 1587
                       FL+ K GW  Q   D ++ IE+ +   +  G F    +  T+E+T+
Sbjct: 1384 KKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLK-NGTFQQRSRSATSETTS 1439

 Score =  181 bits (459), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 81/98 (82%), Positives = 90/98 (91%)

Query: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329
           YRPLNVKDAL+YLEQVK+QFNS+P IYN FLDIMKDFKSQ+IDTPGVIERVSTLF+GYP 
Sbjct: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180

Query: 330 LIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTN 367
           LIQGFNTFLPQGYTI CS NPDDP++VTTP+G+   TN
Sbjct: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVTN 218

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 40/63 (63%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A+ Y+ ++K ++  +P IY HFL+I++ ++ +      V E+V+ LF   P+L++ F  F
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188

Query: 530 LPE 532
           LP+
Sbjct: 189 LPQ 191

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 271 RPLNVK--DALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYP 328
           +P +V+   A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+  P
Sbjct: 357 KPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAP 416

Query: 329 VLIQGFNTFLP 339
            L+  F  FLP
Sbjct: 417 DLLDDFKKFLP 427

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1185 bits (3066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1133 (55%), Positives = 748/1133 (66%), Gaps = 87/1133 (7%)

Query: 464  EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
            +VEFSQAI+YVNKIK R++DQP IYKHFLEILQTYQRE+KPI+EVY QVTVLF +APDLL
Sbjct: 519  DVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLL 578

Query: 524  EDFKKFLPETPANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPFSNNGPVPSGFYQ 583
            +DFKKFLP++ A+                                  +  N PV      
Sbjct: 579  DDFKKFLPDSSASAAQQQRQQLQPVMQHQQAAAATGYGY--------YGENQPVA----- 625

Query: 584  IPQQNLPPIGSFSXXXXXXXXXXXXXXXGTVVNNFRHGISMQTALPSM---------MTP 634
              +QNLPP+GSFS               GT   ++    S   ALP M         +TP
Sbjct: 626  --RQNLPPLGSFSPPPN-----------GTAPRDYYQEPSQGMALPPMTHLETQAAKVTP 672

Query: 635  D---------TEAIPISNLRS-VDGFPPSSGGVIPMPNNQTADFXXXXXXXXXXLTNRL- 683
                       +AIP+SN+RS   G P +   V   P +                     
Sbjct: 673  SHYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAPQHPQQYSPQQAPQPQLPQQQLPP 732

Query: 684  --------PDQFPLDXXXXXXXXXXXXXXXXXXXLISEAPTRPEIDLDPSIVXXXXXXXX 735
                    P   PL                       +   RPEIDLDPSIV        
Sbjct: 733  QQQEQSLPPQTIPLTQPSQLGPQQEVQYV--------DIAVRPEIDLDPSIVPVVPEPTE 784

Query: 736  XXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNK 795
                   LVEETSFF+K KKFI +K +Y EFLK+LNLYSQDLL  + LV +V++Y+G +K
Sbjct: 785  PIEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSK 844

Query: 796  ELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMC 855
            ELF WFK FVGY + P  IEN+IHEKH+LDLD+CEA GPSYKKLPK+DTFMPCSGRD MC
Sbjct: 845  ELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMC 904

Query: 856  WEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETI 915
            WEVLNDEW+GHPVWASEDSGFIAHRKNQYEETLFK+EEERHEYDF+IESNLRTIQTLETI
Sbjct: 905  WEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETI 964

Query: 916  ANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPII 975
            A+KI NMT EEK NFKLP GLGHTS TIYKKVIRKVYDKERGFEIIDALHEHPA AVP++
Sbjct: 965  ASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVV 1024

Query: 976  LRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISS 1035
            L+RLK+KDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLTTKQLISEISS
Sbjct: 1025 LKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISS 1084

Query: 1036 IQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFL 1095
            I+VDQ NKRIHWLTPKPKSQLD+ F D +I  DIL L  VF++HT  YSNS+KERLKDFL
Sbjct: 1085 IKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFL 1144

Query: 1096 RVFIGLFFSIPSSEID---KKLSGKNDEKFEKGXXXXXXXXXXXXXAKKRSLELDIPLAD 1152
            + F+ LFFSIP SE++   ++ S  N E+ E                 KR  E+++PL D
Sbjct: 1145 KSFLSLFFSIPVSEVNDGLRRRSPSNKEEHEANKKENGTALAH----GKRPREIELPLRD 1200

Query: 1153 VLRKYKYQKIKEKVINELENNSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKPWLL 1212
            +L + KYQK+K +   E                                     KKPWLL
Sbjct: 1201 ILHRNKYQKLKLRSDGE---------EGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLL 1251

Query: 1213 GSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKV 1272
            G+++++ +  G+I NR  FNLFANT+IYVFFRH TT+YERL+E+K I+ +VT+EINSRKV
Sbjct: 1252 GNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKV 1311

Query: 1273 TPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAF 1332
            + FAKDL LIS QL  MGLDF   D+Y++LL+L+KRLI+ DIEHQWFEESLRQAYNN+AF
Sbjct: 1312 SQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAF 1371

Query: 1333 KLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNT 1392
            K YT DKV+QALVKHA++ILTD K SEIM LFEKDR  ++T+ +DQI+YR+Q R+HM+NT
Sbjct: 1372 KFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNT 1431

Query: 1393 ENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKV 1452
            ENMFRIEFN  + HVCIQYIA++DLTL  + + ++ W+YYVTSY+L HPTEG+  E L+V
Sbjct: 1432 ENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQV 1491

Query: 1453 PFXXXXXXXXXXXAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDV 1512
            PF            Q+ D   E N    K SPEG+S S L+IKID ETY L+VEPGS DV
Sbjct: 1492 PFLEKIIESE----QEYD---EDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDV 1544

Query: 1513 FSRKSLNKFPTD--AXXXXXXXXXXXXAFNKFLSSKRGWNNQFKPDQVAGIEE 1563
            FSRK++NKFP +  +                +L S++GW        +  +EE
Sbjct: 1545 FSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEE 1597

 Score =  177 bits (450), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 91/108 (84%)

Query: 267 DPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKG 326
           D  YRPLNVKDALSYLEQVK QFNS+P +YN FLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333

Query: 327 YPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVDNT 374
           YP LIQGFNTFLPQGY I CS NPD+P++VTTPMG+ST   +  ++  
Sbjct: 334 YPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQA 381

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 41/63 (65%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K ++  +P +Y HFL+I++ ++ +      V E+V+ LF   P+L++ F  F
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344

Query: 530 LPE 532
           LP+
Sbjct: 345 LPQ 347

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 38/62 (61%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A+SY+ ++K +F+ QP IY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 338 LP 339
           LP
Sbjct: 585 LP 586

 Score = 38.1 bits (87), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 714 APTRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKP-IYMEFLKVLNL 772
            PT+PE+   P+ V                 +  S+  K+K   S +P IY  FL++L  
Sbjct: 496 GPTQPEV---PAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQT 552

Query: 773 YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFV 805
           Y ++    NE+  +V     +  +L D FK F+
Sbjct: 553 YQREQKPINEVYAQVTVLFQNAPDLLDDFKKFL 585

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1168 bits (3021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1154 (53%), Positives = 758/1154 (65%), Gaps = 112/1154 (9%)

Query: 464  EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
            +VEFSQAINYVNKIK R+A+QP IYKHFLEILQTYQRE+KPI+EVY QVTVLF +APDLL
Sbjct: 379  DVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLL 438

Query: 524  EDFKKFLPET-PANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPFSNNGPVPSGFY 582
            +DFKKFLP++ P+ N                                 + N    P+   
Sbjct: 439  DDFKKFLPDSSPSANRQQQQPGVLQQQSPAFGLSA-------------YYNETSPPTS-- 483

Query: 583  QIPQQNLPPIGSFSXXXXXXXXXXXXXXXGTVVNNFRHGISMQT-ALPSMMTPDT----- 636
               +QNLPP+GSFS               G V +N+      QT  LP +   +      
Sbjct: 484  ---RQNLPPLGSFSPPPN-----------GAVPHNYYRDQQPQTLGLPPVAQVENHIDQR 529

Query: 637  ------------EAIPISNLRS-VDGFPPSSGGVI----PMPNNQTADFXXXXXXXXXXL 679
                        E +P+SNLRS +    PS    +     +P+  TA+            
Sbjct: 530  SPPHIATQGIAGEPMPVSNLRSQITAQSPSELAQLHQQQQIPSQPTAN------------ 577

Query: 680  TNRLPDQFPLDXXXXXXXXXXXXXXXXXXXLISEAPTRPEIDLDPSIVXXXXXXXXXXXX 739
               +PD   LD                          RPEIDLDPSIV            
Sbjct: 578  ---IPDGQYLDIA-----------------------VRPEIDLDPSIVPVVPEPTAPIED 611

Query: 740  XXXLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFD 799
               LVEETSFF++ KKFI +K IY EFLK+LNL+SQDLL  +ELV RV++Y+G NKELF 
Sbjct: 612  SLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFV 671

Query: 800  WFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVL 859
            WFK FVG+ + P  IENI+HEKH+LDLDLCEA GPSYKKLPK+DTFMPCSGRD MCW VL
Sbjct: 672  WFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVL 731

Query: 860  NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKI 919
            NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF+IESNLRTIQTLETIA+KI
Sbjct: 732  NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKI 791

Query: 920  NNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRL 979
             NM+ EEK  FKLP GLGHTS TIYKKVIRKVYDKERGFEIIDALHE+PA AVP++L+RL
Sbjct: 792  ANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRL 851

Query: 980  KEKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVD 1039
            K+KDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEI SI+ D
Sbjct: 852  KQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTD 911

Query: 1040 QNNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFI 1099
            Q NKR+HWLTPKPK QLD+   D  +  DIL L + FI+H S+YSN +K RLKD  ++F+
Sbjct: 912  QTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFV 971

Query: 1100 GLFFSIPSSEIDKKLSGKNDEKFEKGXXXXXXXXXXXXXAKKRSLELDIPLADVLRKYKY 1159
             LFFSIP  E+++ +S + +   +K              + KR  E +I L++VL + K 
Sbjct: 972  SLFFSIPMYEVNEAVSRRGNLDDDKEDSTQKMESDNLNNS-KRPREDEISLSEVLHRAKN 1030

Query: 1160 QKIKEKVINELENNSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKPWLLGSVIDKT 1219
            Q+ K +  +E    S                                KKPWLLG+++++ 
Sbjct: 1031 QRFKSRAADETSEESA-------------AEPEPELNEEEETIRQEAKKPWLLGNLVEEV 1077

Query: 1220 SEHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDL 1279
            +  GLI NR  FN+FANTNIYVFFRH TT+YERL E+K++ND VT+EINSRKV  FAKDL
Sbjct: 1078 NAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDL 1137

Query: 1280 GLISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADK 1339
             LIS QL  MGLDF+ +D+Y++L +L KRLI+ DIEHQWFEESLRQAYNNKAFKLYT DK
Sbjct: 1138 NLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDK 1197

Query: 1340 VIQALVKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIE 1399
            VIQ+LVKHA++ILTDSK SEIM  FEKDR + +T+ +DQI+YRLQ R++M++TENMFRIE
Sbjct: 1198 VIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIE 1257

Query: 1400 FNENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFXXXXX 1459
            +N+ + +V IQ+IAV+DLTL    + +E W YYVTSY+L HPTEG+ QE L++PF     
Sbjct: 1258 YNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVL 1317

Query: 1460 XXXXXXAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLN 1519
                    D+DN +     I+K SPEG+S S LKIKID ETY LD+E GS+DVFSRKS+N
Sbjct: 1318 ETEEDYGSDVDNFS-----IDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVN 1372

Query: 1520 KFP--TDAXXXXXXXXXXXXAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQETGEFIPI 1577
            +FP   D+               +FL SK+GW      DQV  I+E   + +E G     
Sbjct: 1373 RFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENGSLDDF 1432

Query: 1578 PKPITTESTTGVIA 1591
             +   T+  + +IA
Sbjct: 1433 NEASQTQQASEIIA 1446

 Score =  177 bits (450), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 81/98 (82%), Positives = 88/98 (89%)

Query: 267 DPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKG 326
           D  YRPLNVKDALSYLEQVK QFNS+P +YN FLDIMKDFKSQ IDTPGVI+RVSTLFKG
Sbjct: 188 DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247

Query: 327 YPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTST 364
           YP LIQGFNTFLPQGY I CS NPD+P+RVTTPMG+S+
Sbjct: 248 YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSS 285

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 40/63 (63%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K ++  +P +Y HFL+I++ ++ +      V ++V+ LF   P L++ F  F
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258

Query: 530 LPE 532
           LP+
Sbjct: 259 LPQ 261

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 37/62 (59%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A++Y+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 444

Query: 338 LP 339
           LP
Sbjct: 445 LP 446

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1160 bits (3000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1145 (53%), Positives = 740/1145 (64%), Gaps = 116/1145 (10%)

Query: 464  EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
            +VEFSQAI+YVNKIKTR+ADQP IYKHFLEILQTYQRE+KPI+EVY QVT LF +APDLL
Sbjct: 405  DVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLL 464

Query: 524  EDFKKFLPETPANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------------YPF 571
            EDFKKFLP++ A+                                            YP 
Sbjct: 465  EDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQAQAQAQAQAQVEQQKQQQQFLYPA 524

Query: 572  SNNGPVPSGFYQIPQQNLPPIGSFSXXXXXXXXXXXXXXXGTVVNNFRHGISMQ----TA 627
            S     PS    IPQQNLPPIGSFS                TV   ++    MQ      
Sbjct: 525  SGYYGHPSN-RGIPQQNLPPIGSFSPPTNG----------STVHEAYQDQQHMQPPHFMP 573

Query: 628  LPSMMTPDTEAI---------PISNLRS--VDGFPPSS--------GGVIPMPNNQTADF 668
            LPS++      +         P+S+LR+   + + PSS          + P+ N Q  D 
Sbjct: 574  LPSIVQHGPNMVHQGIANENPPLSDLRTSLTEQYAPSSIQHQQQHPQSISPIANTQYGDI 633

Query: 669  XXXXXXXXXXLTNRLPDQFPLDXXXXXXXXXXXXXXXXXXXLISEAPTRPEIDLDPSIVX 728
                                                          P RPEIDLDPSIV 
Sbjct: 634  ----------------------------------------------PVRPEIDLDPSIVP 647

Query: 729  XXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVD 788
                          L EE +FFEK K++I +K +Y EFLK+LNLYSQD+L  ++LV +VD
Sbjct: 648  VVPEPTEPIENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVD 707

Query: 789  YYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPC 848
            +Y+GSNKELF WFK FVGY E    IENI+HEKH+LDLDLCEA+GPSYK+LPK+DTFMPC
Sbjct: 708  FYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPC 767

Query: 849  SGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRT 908
            SGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF+IESNLRT
Sbjct: 768  SGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRT 827

Query: 909  IQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHP 968
            IQ LETI NKI NMT  EK NFKLP GLGHTS TIYKKVIRKVYDKERGFEIIDALHEHP
Sbjct: 828  IQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHP 887

Query: 969  AFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQ 1028
            A   P++L+RLK+KDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQ
Sbjct: 888  AVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQ 947

Query: 1029 LISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEK 1088
            LISEISSI+VDQ NK+IHWLTPKPKSQLDF F D +I  DIL LA+ FI HT+ YSN +K
Sbjct: 948  LISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDK 1007

Query: 1089 ERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGXXXXXXXXXXXXXAKKRSLELDI 1148
            ERLKD L+ FI LFFSI   +I++ L        +               ++KR  + ++
Sbjct: 1008 ERLKDLLKYFISLFFSISFEKIEESLYSHK----QNVSESSGSDDGSSIASRKRPYQQEM 1063

Query: 1149 PLADVLRKYKYQKIKEKVINELENNSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKK 1208
             L D+L + +YQK+K           +                               K 
Sbjct: 1064 SLLDILHRSRYQKLKR----------SNDEDGKVPQLSEPPEEEPNTIEEEELIDEEAKN 1113

Query: 1209 PWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREIN 1268
            PWL G+++++ +  G+I+NR IFNLFANTNIY+FFRHWTTIYERLLE+KQ+N++VT+EIN
Sbjct: 1114 PWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEIN 1173

Query: 1269 SRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYN 1328
            +R    FAKDL L+S+QL+ MGLDF   D+YK++L L++RLI  D+EHQWFEESLRQAYN
Sbjct: 1174 TRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYN 1233

Query: 1329 NKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTH 1388
            NKAFKLYT DKV Q+LVKHA++++TD+K +EIMALF KDR  S+T+ +DQIIYRLQ R+H
Sbjct: 1234 NKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSH 1293

Query: 1389 MTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQE 1448
            M+NTENMFRIEF++ T HV IQYIA++DLTLK     ++ W+YYVTSYALPHPTEG+P E
Sbjct: 1294 MSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHE 1353

Query: 1449 GLKVPFXXXXXXXXXXXAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPG 1508
             LK+PF            QD+D      E  E+ SPEGIS S LKIKI   TY L +E G
Sbjct: 1354 KLKIPF----LERLIEFGQDIDG----TEVDEEFSPEGISVSTLKIKIQPITYQLHIENG 1405

Query: 1509 SFDVFSRKSLNKFPTDA--XXXXXXXXXXXXAFNKFLSSKRGWNNQFKPDQVAGIEEGWK 1566
            S+DVF+RK+ NK+PT A                +KFL    G  N     Q   +++ W+
Sbjct: 1406 SYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWE 1465

Query: 1567 KFQET 1571
              +++
Sbjct: 1466 NLKDS 1470

 Score =  184 bits (467), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%)

Query: 267 DPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKG 326
           D +YRPLNVKDALSYLEQVK QF+S+P IYN FLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 213 DADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 272

Query: 327 YPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTN 367
           YP+LIQGFNTFLPQGY I CS NPDDP+RVTTPMGT+T  N
Sbjct: 273 YPILIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNN 313

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 38/62 (61%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 411 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 470

Query: 338 LP 339
           LP
Sbjct: 471 LP 472

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 40/63 (63%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K +++ +P IY  FL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 224 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 283

Query: 530 LPE 532
           LP+
Sbjct: 284 LPQ 286

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1156 bits (2990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1138 (53%), Positives = 750/1138 (65%), Gaps = 77/1138 (6%)

Query: 464  EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
            +VEFSQAI+YVNKIK R++DQP IYK+FLEILQTYQRE+KPI+EVY QVTVLF++APDLL
Sbjct: 378  DVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLL 437

Query: 524  EDFKKFLPETPANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPFSNNGPVPSGFYQ 583
            +DFKKFLP++ A+N                               YP   N P       
Sbjct: 438  DDFKKFLPDSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQP------- 490

Query: 584  IPQQNLPPIGSFSXXXXXXXXXXXXXXXGTVVNNFRHGISM-----QTALPSMMTPDTEA 638
              Q NLPPIGSFS                    +   G+       Q   PSM+  D   
Sbjct: 491  --QSNLPPIGSFSPPANGVAPTTGTAIPHADEQHVVAGVPAMAPHEQQHAPSMINND--G 546

Query: 639  IPISNLRSVDGFPPSSGGVIPMPNNQTADFXXXXXXXXXXLTNRLPDQFPLDXXXXXXXX 698
            I ISN+R     P  +   +  P++ T                +      +D        
Sbjct: 547  IQISNMRGGGTVPALNQYGMISPHDYTQQQAKQVQQFQEDQQQQQQQSMMMDEQYGS--- 603

Query: 699  XXXXXXXXXXXLISEAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFIS 758
                          +   RPEIDLDPSIV               L EETSFFEKVKK I 
Sbjct: 604  -------------GDMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIG 650

Query: 759  SKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENII 818
            ++ IY+EFLKVLNL+SQDL++ +ELVT+V+ Y+    ELF+WFK FVGY + P  IEN+I
Sbjct: 651  NRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVI 710

Query: 819  HEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIA 878
            HEKH+LDLDLCEAYGPSYKKLPK+DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIA
Sbjct: 711  HEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIA 770

Query: 879  HRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGH 938
            HRKNQYEETLFKIEEERHEYDF+IESNLRTIQTLETIA+KI NMT EEK  FKLP GLGH
Sbjct: 771  HRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGH 830

Query: 939  TSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWR 998
            TS TIYKK+IRKVYDKERGFEIID LHEHPA  VPI+L+RLK+KDEEWRRAQREWNKVWR
Sbjct: 831  TSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWR 890

Query: 999  ELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDF 1058
            ELEQKVY+KSLDHLGLTFKQADKKLLTTKQLISEISSI+VDQNNKR+HWLTPKPK QLD+
Sbjct: 891  ELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDY 950

Query: 1059 TFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKN 1118
             FND DI+ DI+ L +VF+DH STYSN +KERLKD  RVFI LFF IP   I   L  K+
Sbjct: 951  QFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKS 1010

Query: 1119 DE------KFEKGXXXXXXXXXXXXXAKKRSL-ELDIPLADVLRKYKYQKIKEKVINELE 1171
            DE      KFEK              +KKR   ++++ L+D+L + KYQK+K      + 
Sbjct: 1011 DEGKSTDTKFEKA-----------DDSKKRPRPDVELSLSDILHRAKYQKLKNGEGLGMS 1059

Query: 1172 NNSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIF 1231
             + +                                KPWL+G ++++ + HGL+ +R ++
Sbjct: 1060 EDDDEEKLAKEAEEMSEKNA---------------SKPWLVGDIVERANSHGLVTDRAVY 1104

Query: 1232 NLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGL 1291
            NLF NTN+Y+F RHW+T+Y RLLELKQ++++VT+EIN+RKV  FA+DL L+STQL  MGL
Sbjct: 1105 NLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGL 1164

Query: 1292 DFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSI 1351
            DF   ++Y+E L L+KRLI+N++EHQWFEESLRQAYNNKAFKLYT DKV+ +LVKHA+++
Sbjct: 1165 DFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTL 1224

Query: 1352 LTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQY 1411
            +TD+K+SE+M LFEKDRL+SST  +DQI+YRL TR+HM++TENMFR+++N++T HV IQY
Sbjct: 1225 MTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQY 1284

Query: 1412 IAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDN 1471
            I ++D+TL+ +    E W YY+TSYALPHPTEG+ Q+ L VPF              LD 
Sbjct: 1285 IGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDM---LDV 1341

Query: 1472 ETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPT--DAXXXX 1529
            E   + +    +P G S SKLKI ID +TY L ++ GS+D+FSR S+N++P   D+    
Sbjct: 1342 EAGSDRY----NPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYV 1397

Query: 1530 XXXXXXXXAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKF---QETGEFIPIPKPITTE 1584
                       KFL  + GW      D +  +E   K     +ET +   +  P+TTE
Sbjct: 1398 QMVEKRKETAQKFLDGRFGWKKDLSDDVINTVEPTKKIALLSEETKDVGTLSTPVTTE 1455

 Score =  177 bits (449), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 83/111 (74%), Positives = 94/111 (84%), Gaps = 5/111 (4%)

Query: 267 DPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKG 326
           D  YRPLNVKDALSYLEQVK+QFNS+P IYNQFLDIMKDFKSQ IDTPGVIERVSTLFKG
Sbjct: 215 DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

Query: 327 YPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVDNTNVS 377
           +P LIQGFNTFLPQGY I CS NP++P++VTTPMG      L NV  ++++
Sbjct: 275 FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGV-----LENVRGSDIT 320

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 40/63 (63%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K ++  +P+IY  FL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 226 ALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGFPALIQGFNTF 285

Query: 530 LPE 532
           LP+
Sbjct: 286 LPQ 288

 Score = 47.0 bits (110), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (59%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A+SY+ ++K +F+ QP IY  FL+I++ ++ +      V  +V+ LF   P L+  F  F
Sbjct: 384 AISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKF 443

Query: 338 LP 339
           LP
Sbjct: 444 LP 445

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/884 (61%), Positives = 648/884 (73%), Gaps = 16/884 (1%)

Query: 713  EAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772
            EAP RPEIDLDPSIV               L+EETSFF+K KKFI++K IY EFLKVLNL
Sbjct: 605  EAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNL 664

Query: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832
            +SQDL+S ++LV +V+YYIGS+KELF+WF+ FVGY   P  IENI+HEKH+LDLDLCEA 
Sbjct: 665  FSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEAC 724

Query: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892
            GPSYK+LPK+DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 725  GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 784

Query: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952
            EERHEYD++IESNLRTIQTLE I NKI+NM+ EEKKNFKL  GLGHTS TIYKKVIRKVY
Sbjct: 785  EERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVY 844

Query: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012
            DKERGFEIIDALHEHPA A PI+L+RLK+KDEEWRRAQREWNKVWRELEQKVY+KSLDHL
Sbjct: 845  DKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL 904

Query: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072
            GLTFKQADKKLLT KQLISEISSI+VDQNNKRIHWLTPKPKSQL+F   D +IL DIL L
Sbjct: 905  GLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSL 964

Query: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGXXXXXXX 1132
            +  FI+H+STYS S+KERL DFL+ FI LFFS+P +EI+  L  +N++K  +        
Sbjct: 965  SENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSALP 1024

Query: 1133 XXXXXXAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNXXXXXXXXXXXXXXXXX 1192
                   K+   ++++ ++D+L + KYQK+K      L N  +                 
Sbjct: 1025 DGTENQKKRSIHDIELSMSDILHRTKYQKMK------LSNRGSDSQEENNIDTIIDEESD 1078

Query: 1193 XXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYER 1252
                          K+PWLLG +IDKT+  G+I +R  FNLFANTNIYVF RHWTT+YER
Sbjct: 1079 ERLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYER 1138

Query: 1253 LLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKN 1312
            LLELK++N +VT+EIN+RK   FA+DLGL+STQL  MGLDF   DSY+ELL L+KRLI+N
Sbjct: 1139 LLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIEN 1198

Query: 1313 DIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSS 1372
            DIEHQWFEESLRQAYNN+AFKLYT DKV+QALVKH ++++TD K +E+M LFEKDRL S+
Sbjct: 1199 DIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSA 1258

Query: 1373 TTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYY 1432
            T+ +DQI+YRLQ R+HM+NTE MFRIE+N++  ++CIQYIA++DLTLK   T +E W+YY
Sbjct: 1259 TSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYY 1318

Query: 1433 VTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDNETEKNEFIEKISPEGISTSKL 1492
            VTSY+LPHPTEG+  E L++PF            ++ D E + N    K SPEG+S S  
Sbjct: 1319 VTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSN---GKYSPEGVSNSMY 1375

Query: 1493 KIKIDQETYNLDVEPGSFDVFSRKSLNKFP--TDAXXXXXXXXXXXXAFNKFLSSKRGWN 1550
            KIKI    Y LD++ GSFD+FSRKSLNK+P   +               N FL S  GW 
Sbjct: 1376 KIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNGWK 1435

Query: 1551 NQFKPDQVAGIEEGWKKFQETGEFIPIP-----KPITTESTTGV 1589
               K        E   +  ET     +P     KP + E +TG+
Sbjct: 1436 KHLKKQLSLKKNESEPESAETRTIPAVPASTTDKPPSMEQSTGI 1479

 Score =  179 bits (454), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%)

Query: 265 EEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 324
           E+D  YRPLNVKDALSYLEQVK QFNS+P IYNQFLDIMKDFKSQTIDTPGVIERVSTLF
Sbjct: 205 EDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 264

Query: 325 KGYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTST 364
           +GYP LIQGFNTFLP GY I C  NP+DP++VTTP+G+ST
Sbjct: 265 RGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSST 304

 Score =  124 bits (312), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/133 (51%), Positives = 82/133 (61%), Gaps = 13/133 (9%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFSQAINYVNKIK R+ADQP IYK+FLEILQTYQRE+KPI+EVY QVT+LF +APDLL
Sbjct: 367 DVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLL 426

Query: 524 EDFKKFLPETPANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPFSNNGPVPSGFYQ 583
           +DFKKFLP++                                   Y    N P+      
Sbjct: 427 DDFKKFLPDS---------SKEQQYTGQLPQQIPNQEQLEEFSGSYARPPNAPLD----M 473

Query: 584 IPQQNLPPIGSFS 596
           + QQ+LPPIGSFS
Sbjct: 474 VAQQSLPPIGSFS 486

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 38/62 (61%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K ++  +P IY  FL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277

Query: 530 LP 531
           LP
Sbjct: 278 LP 279

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 37/62 (59%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A++Y+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKF 432

Query: 338 LP 339
           LP
Sbjct: 433 LP 434

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1060 bits (2741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/1014 (54%), Positives = 669/1014 (65%), Gaps = 104/1014 (10%)

Query: 584  IPQQNLPPIGSFSXXXXXXXXXXXXXXXGTVVNNFRHGISMQ----TALPSMMTPDT--- 636
            IPQQNLPPIGSFS                TV  N++    MQ      LPSM+       
Sbjct: 567  IPQQNLPPIGSFSPPTNG----------STVHENYQDQQHMQPPHLMPLPSMVQHGANIV 616

Query: 637  ------EAIPISNLRS--VDGFPPSS---------GGVIPMPNNQTADFXXXXXXXXXXL 679
                  E +P+S+LR+   + + PS+           + P+ N+Q  D            
Sbjct: 617  HQGIANENLPLSDLRTSLTEQYAPSNIQQQQQQHPQSISPIANSQYGD------------ 664

Query: 680  TNRLPDQFPLDXXXXXXXXXXXXXXXXXXXLISEAPTRPEIDLDPSIVXXXXXXXXXXXX 739
                                               P RPEIDLDPSIV            
Sbjct: 665  ----------------------------------VPVRPEIDLDPSIVPVVPEPTEPIED 690

Query: 740  XXXLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFD 799
               L EE +FFEK K++I +K +Y EFLK+LNLYSQD+L  ++LV +VD+Y+GSNKELF 
Sbjct: 691  NISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFS 750

Query: 800  WFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVL 859
            WFK FVGY E    IENI+HEKH+LDLDLCEA+GPSYK+LPK+DTFMPCSGRD MCWEVL
Sbjct: 751  WFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVL 810

Query: 860  NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKI 919
            NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF+IESNLRTIQ LETI NKI
Sbjct: 811  NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKI 870

Query: 920  NNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRL 979
             NMT  EK NFKLP GLGHTS TIYKKVIRKVYDKERGFEIIDALHEHPA   P++L+RL
Sbjct: 871  ENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRL 930

Query: 980  KEKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVD 1039
            K+KDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQLISEISSI+VD
Sbjct: 931  KQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVD 990

Query: 1040 QNNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFI 1099
            Q NK+IHWLTPKPKSQLDF F D +I  DIL LA+ FI HT+ YSN +KERLKD L+ FI
Sbjct: 991  QTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKYFI 1050

Query: 1100 GLFFSIPSSEIDKKLSGKNDEKFEKGXXXXXXXXXXXXXAKKRSLELDIPLADVLRKYKY 1159
             LFFSI   EI++ L        +               ++KRS + ++ L D+L + +Y
Sbjct: 1051 SLFFSISLEEIEESLQAYK----QSVSESSGSDDGGSSVSRKRSYQQEMTLLDILHRSRY 1106

Query: 1160 QKIKEKVINELENNSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKPWLLGSVIDKT 1219
            QK+K           +                               K PWL G+++++ 
Sbjct: 1107 QKLKR----------SKDEDGKVPQLSEAPDEESNIIEEEELINEEAKNPWLTGNLVEEA 1156

Query: 1220 SEHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDL 1279
            +  G+I+NR IFNLFANTNIY+FFRHWTTIYERLLE+KQ+N+KVT+EIN+R    FAKDL
Sbjct: 1157 NSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDL 1216

Query: 1280 GLISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADK 1339
             L+S QL+ MGLDF   D+YK++L L++RLI  D+EHQWFEESLRQAYNN+AFKLYT DK
Sbjct: 1217 DLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDK 1276

Query: 1340 VIQALVKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIE 1399
            V Q+LVKHA++++TD+K +EIMALF KDR  ++T+ + QIIYRLQ R+HM+NTENMFRIE
Sbjct: 1277 VTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIE 1336

Query: 1400 FNENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFXXXXX 1459
            F++ T HV IQYIA++DLTLK     ++ W+YYVTSYALPHPTEGV  E LK+PF     
Sbjct: 1337 FDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPF----L 1392

Query: 1460 XXXXXXAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLN 1519
                   QD+D +    +  EK SPEGIS S LKIKI   TY LD+E GS+DVF+RKS N
Sbjct: 1393 ERLIEFGQDIDGK----DVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSAN 1448

Query: 1520 KFPTDAX--XXXXXXXXXXXAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQET 1571
            K+PT A                ++FL       N     Q   ++E ++  ++T
Sbjct: 1449 KYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKDT 1502

 Score =  185 bits (469), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%)

Query: 268 PEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGY 327
           P+YRPLNVKDALSYLEQVK QF+S+P IYN FLDIMKDFKSQ IDTPGVIERVSTLF+GY
Sbjct: 227 PDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGY 286

Query: 328 PVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTN 367
           P+LIQGFNTFLPQGY I CS NPDDP+RVTTPMGT+T  N
Sbjct: 287 PILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNN 326

 Score =  124 bits (312), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/73 (80%), Positives = 68/73 (93%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFSQAI+YVNKIKTR+ADQP IYKHFLEILQTYQRE+KPI+EVY QVT LF +APDLL
Sbjct: 418 DVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLL 477

Query: 524 EDFKKFLPETPAN 536
           EDFKKFLP++ A+
Sbjct: 478 EDFKKFLPDSSAS 490

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 12/84 (14%)

Query: 268 PEYRPLNVKD------------ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPG 315
           P+ +PL V++            A+SY+ ++K +F  QP IY  FL+I++ ++ +      
Sbjct: 402 PQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINE 461

Query: 316 VIERVSTLFKGYPVLIQGFNTFLP 339
           V  +V+ LF+  P L++ F  FLP
Sbjct: 462 VYAQVTHLFQNAPDLLEDFKKFLP 485

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 40/63 (63%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K +++ +P IY  FL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 296

Query: 530 LPE 532
           LP+
Sbjct: 297 LPQ 299

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/873 (59%), Positives = 632/873 (72%), Gaps = 26/873 (2%)

Query: 710  LISEAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKV 769
            +  E   RPEIDLDPS+V               LVEET+FF+KVKK+I +K IY EFLKV
Sbjct: 824  MYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKV 883

Query: 770  LNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLC 829
            LNLYS DLL  +ELV ++ YY+  N+ELF WFK FVGY E P  IENI+HEKHKLDLDLC
Sbjct: 884  LNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLC 943

Query: 830  EAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLF 889
            EA GPSYKKLPKTDT MPCSGRD MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   
Sbjct: 944  EACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYL 1003

Query: 890  KIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIR 949
            +++++ HEYDF+IESNLRTIQTLETIA+KI NMT  EK NFKLP GLGHT+STIYKKVIR
Sbjct: 1004 RLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIR 1063

Query: 950  KVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSL 1009
            KVYDKERGFEIIDALHE+PA AVP++L+RLK+KDEEWRRAQREWNKVWRELEQKV++KSL
Sbjct: 1064 KVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSL 1123

Query: 1010 DHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDI 1069
            DHLGLTFKQADKKLLTTKQLISEISSI+VDQ +KR+HWLTPKPKSQLDF   D DI+ DI
Sbjct: 1124 DHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDI 1183

Query: 1070 LDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSG-----KNDEKFEK 1124
            L    +F++HTSTYSN EKERL DF++ F  LFFSIP  EI + +S      KNDEK E 
Sbjct: 1184 LSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLED 1243

Query: 1125 GXXXXXXXXXXXXXAKKRSLELDIPLADVLRKYKYQKIK-EKVINELENNSNXXXXXXXX 1183
                           K+ S ++ + L D+L++ KYQ++K     +E++ + N        
Sbjct: 1244 -----KQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQKLL 1298

Query: 1184 XXXXXXXXXXXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFF 1243
                                   KKPWLLG+++++ +  G I +R+IFN+F+NTN+Y+F 
Sbjct: 1299 EEEELLRQEA-------------KKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFI 1345

Query: 1244 RHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELL 1303
            RH TT+YERL E+KQ+NDKV+REI+ RK++ FAKDL LISTQLT MGLDF   D Y++LL
Sbjct: 1346 RHLTTMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLL 1405

Query: 1304 NLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMAL 1363
             L KRLI  D+EHQWFEESLRQA+NNKAFKLYT DKV QALVKHA++I++D K +EIMAL
Sbjct: 1406 VLCKRLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMAL 1465

Query: 1364 FEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSP 1423
            FEKDR ++ST+++DQI+YRLQTR  MT+ ENMFRIE+N  T H+CIQYIA++DLT+K + 
Sbjct: 1466 FEKDRTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAK 1525

Query: 1424 TTKETWEYYVTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDNETEKNEFIEKIS 1483
            T +E W+YY+TSYAL HPTEG+ QE +++PF             +  ++ ++ + + K S
Sbjct: 1526 TLEEKWKYYITSYALSHPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYS 1585

Query: 1484 PEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAXXXXX--XXXXXXXAFNK 1541
            PEGIS S LKIKID + Y L++E GSFD+FSRKSLN+FP                    K
Sbjct: 1586 PEGISGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEK 1645

Query: 1542 FLSSKRGWNNQFKPDQVAGIEEGWKKFQETGEF 1574
            FL+SK GW      DQ+  IE  W      G  
Sbjct: 1646 FLNSKMGWKRAISKDQMESIESKWDHLSNNGNL 1678

 Score =  168 bits (425), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (83%)

Query: 265 EEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 324
           +ED +YRPLNVKDALSYLEQVK QFNS+P +YN FLDIMKDFKSQ IDTPGVI RVS+LF
Sbjct: 294 KEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLF 353

Query: 325 KGYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNL 368
             YP LIQGFNTFLPQGY I CS NP+ P+ V TPMGT+T + +
Sbjct: 354 HDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSGV 397

 Score =  137 bits (344), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 86/133 (64%), Gaps = 16/133 (12%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFSQAI+YVNKIK R+A+QP+IYKHFLEILQTYQRE+KPI+EVY QVTVLF +APDLL
Sbjct: 542 DVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLL 601

Query: 524 EDFKKFLPETPANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPFSNNGPVPSGFYQ 583
           EDFKKFLP++ ANN                                 F+   P  +   +
Sbjct: 602 EDFKKFLPDSSANNNGSIVTSQEENFMYANG----------------FNQQQPHLTPHSE 645

Query: 584 IPQQNLPPIGSFS 596
           I  QNLPP+GSFS
Sbjct: 646 IQAQNLPPLGSFS 658

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 41/63 (65%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K ++  +P +Y HFL+I++ ++ +      V  +V+ LF+D P L++ F  F
Sbjct: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHDYPSLIQGFNTF 366

Query: 530 LPE 532
           LP+
Sbjct: 367 LPQ 369

 Score = 49.7 bits (117), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 3/78 (3%)

Query: 265 EEDPEYR---PLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVS 321
           +E PE R    +    A+SY+ ++K +F +QP IY  FL+I++ ++ +      V  +V+
Sbjct: 532 QELPEQRRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVT 591

Query: 322 TLFKGYPVLIQGFNTFLP 339
            LF+  P L++ F  FLP
Sbjct: 592 VLFQEAPDLLEDFKKFLP 609

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 472 NYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKFL 530
           N+ +K+K +Y     IY  FL++L  Y  +   + E+ E++    ND  +L   FK F+
Sbjct: 862 NFFDKVK-KYIGNKTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFV 919

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1052 bits (2720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/864 (60%), Positives = 635/864 (73%), Gaps = 30/864 (3%)

Query: 717  RPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQD 776
            RPEIDLDPSIV               LVEET+FF+K KKFI++K IYMEFLK+LNLYSQ+
Sbjct: 623  RPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYSQN 682

Query: 777  LLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPSY 836
            +L+ NELV +V YY+GSNKELFDWFK FVGY + P  IENI+HEKHKLDLDLCEAYGPSY
Sbjct: 683  ILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGPSY 742

Query: 837  KKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH 896
            KKLPKTDTFMPCSGRD MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH
Sbjct: 743  KKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH 802

Query: 897  EYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKER 956
            EYDF+IESNLRTIQTLETIA+KI NMT EE+ NFKLP+GLGHTS TIY+KVIRKVY KER
Sbjct: 803  EYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGKER 862

Query: 957  GFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTF 1016
            GFE+IDALHE+PA AVPIIL+RLK+KDEEWRRAQREWNKVWREL+QKVYYKSLDHLGLTF
Sbjct: 863  GFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLTF 922

Query: 1017 KQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANVF 1076
            KQADKKLLTTKQLISEISSI+VDQ NK++HWLTPKPKSQLD+   D  IL DIL L +VF
Sbjct: 923  KQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTDVF 982

Query: 1077 IDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKL---SGKNDEKFEKGXXXXXXXX 1133
            I+HTS YSN +KERL+DFL+ FI LFF IP ++I   +   S  +D K +          
Sbjct: 983  INHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIKIRSPLDDTKTD----SEESSG 1038

Query: 1134 XXXXXAKKRSLE-LDIPLADVLRKYKYQKIKEKVINELENNSNXXXXXXXXXXXXXXXXX 1192
                  KKRS+E  DI   D+L K KYQK+K+  +++ E  SN                 
Sbjct: 1039 DSDKFPKKRSIEDDDISFHDILDKVKYQKVKQG-LDKNETFSNDISSATSVDDDELIRQE 1097

Query: 1193 XXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYER 1252
                          +KPWLLGS++D  +  G+I+NR  +N+F NTNIYVF RH  T+YER
Sbjct: 1098 A-------------QKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYER 1144

Query: 1253 LLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKN 1312
            L E KQ+N +VT EI +R + PFAKDL L+STQL  MGLDF+ +DSYK+LL+L+ RLI+ 
Sbjct: 1145 LNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEG 1204

Query: 1313 DIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSS 1372
            ++EH WFEESLRQA+ NKAFKLYT DKV Q++VKHA++I++D+K +EIM L EKDR  ++
Sbjct: 1205 NLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCAT 1264

Query: 1373 TTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYY 1432
            T+++DQI+YRLQ R+HM+ T+NMFRIEFN++++++ IQYI ++DLTL    T +E W+YY
Sbjct: 1265 TSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYY 1324

Query: 1433 VTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDNETEKNEFIEKISPEGISTSKL 1492
            +TSYAL HPTEGVPQE +++PF           A       E+    +K SP+G+S S L
Sbjct: 1325 ITSYALSHPTEGVPQEEIQIPFLEKILETEEAYA------EEEEVINDKYSPKGVSQSDL 1378

Query: 1493 KIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAXXXXXXXXXXXXA--FNKFLSSKRGWN 1550
            KIKI  E Y L++EPGSFD FSR S+NK+P D                 N FL+ K GW 
Sbjct: 1379 KIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWK 1438

Query: 1551 NQFKPDQVAGIEEGWKKFQETGEF 1574
                 D++  I   +   ++ G  
Sbjct: 1439 QSLSEDEINNINLKYSHIKKYGSL 1462

 Score =  175 bits (443), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 90/95 (94%)

Query: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329
           YRPLNVKDAL+YLEQVK+QF+S+P IYN FLDIMKDFKSQ+IDTPGVIERVSTLF+GYP 
Sbjct: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201

Query: 330 LIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTST 364
           LIQGFNTFLPQGYTI C++NP+DP++VTTP+G+ T
Sbjct: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSET 236

 Score =  112 bits (281), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 51/69 (73%), Positives = 62/69 (89%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFSQA++YVNKIK R+ D+P IYK FLEILQTYQ+E+KPI EVY QVT+LF +APDLL
Sbjct: 351 DVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLL 410

Query: 524 EDFKKFLPE 532
           +DFKKFLP+
Sbjct: 411 DDFKKFLPD 419

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 40/63 (63%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A+ Y+ ++K +++ +P IY HFL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209

Query: 530 LPE 532
           LP+
Sbjct: 210 LPQ 212

 Score = 44.7 bits (104), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 271 RPLNVK--DALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYP 328
           +P +V+   A+SY+ ++K +F  +P IY  FL+I++ ++ +      V  +V+ LF+  P
Sbjct: 348 KPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAP 407

Query: 329 VLIQGFNTFLP 339
            L+  F  FLP
Sbjct: 408 DLLDDFKKFLP 418

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1048 bits (2710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/980 (55%), Positives = 654/980 (66%), Gaps = 108/980 (11%)

Query: 569  YPFSNNGPVPSGFYQIPQQNLPPIGSFSXXXXXXXXXXXXXXXGTVVNNFRHGISMQ--- 625
            Y  S NG        IPQQNLPPIGSFS                T    F+    MQ   
Sbjct: 552  YSHSTNG-------GIPQQNLPPIGSFSPPTNG----------STTHEGFQDQQHMQPPH 594

Query: 626  -TALPSMMTPD---------TEAIPISNLRS--VDGFPPSS--------GGVIPMPNNQT 665
               LPSM+             E IP+S+LR+   D + PS+          + P+ ++Q 
Sbjct: 595  LMPLPSMVQQGPNMVHQGIVNENIPLSDLRTSLTDQYAPSNFQQQQQQQPSISPIIDSQY 654

Query: 666  ADFXXXXXXXXXXLTNRLPDQFPLDXXXXXXXXXXXXXXXXXXXLISEAPTRPEIDLDPS 725
             D                                               P RPEIDLDPS
Sbjct: 655  GD----------------------------------------------VPVRPEIDLDPS 668

Query: 726  IVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVT 785
            IV               L EE +FFEK K++I +K +Y EFLK+LNLYSQD+L  ++LV 
Sbjct: 669  IVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVE 728

Query: 786  RVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTF 845
            +VD+Y+GSNKELF WFK FVGY E   +IEN++HEKH+LDLDLCEA+GPSYK+LPK+DTF
Sbjct: 729  KVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLPKSDTF 788

Query: 846  MPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESN 905
            MPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF+IESN
Sbjct: 789  MPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESN 848

Query: 906  LRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALH 965
            LRTIQ LETI NKI NMT  EK NFKLP GLGHTS TIYKKVIRKVYDKERGFEIIDALH
Sbjct: 849  LRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALH 908

Query: 966  EHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLT 1025
            EHPA   P++L+RLK+KDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLT
Sbjct: 909  EHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLT 968

Query: 1026 TKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSN 1085
            TKQLISEISSI+VDQ NK+IHWLTPKPKSQLDF F D DI  DIL LA+ FI HT+ YSN
Sbjct: 969  TKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHTTAYSN 1028

Query: 1086 SEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGXXXXXXXXXXXXXAKKRSLE 1145
             +KERLKD L  FI LFFSIP  +I++ L        +                +KR  +
Sbjct: 1029 PDKERLKDLLNYFISLFFSIPLEKIEEALQSYK----QNLSDSSGSDDGDSSTPRKRPYQ 1084

Query: 1146 LDIPLADVLRKYKYQKIKEKVINELENNSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1205
             ++ L D+L + KYQK+K           +                              
Sbjct: 1085 QEMSLLDILHRSKYQKLKR----------SNDEDGKVPQLSEPLDEESNAIEEEELINEE 1134

Query: 1206 MKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTR 1265
             K PWL G+++++ +  G+I+NR+IFNLFAN+NIY+FFRHWTTIYERLLE+KQ+N+KVT+
Sbjct: 1135 AKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTK 1194

Query: 1266 EINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQ 1325
            EI+ R +  FAKDL L+S+QL+ MGLDF   D+YK++L L++RLI  ++EHQWFEE LRQ
Sbjct: 1195 EISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQ 1254

Query: 1326 AYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQT 1385
            AYNNKAFKLYT DKVIQ LVKHA++++TD+K +EIMALF KDR  S+T+ +DQIIYRLQ 
Sbjct: 1255 AYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQA 1314

Query: 1386 RTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGV 1445
            R++M+NTENMFR+EF+    HV +QYIA++DLTLK     ++ W+YYVTSYALPHPTEG+
Sbjct: 1315 RSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGI 1374

Query: 1446 PQEGLKVPFXXXXXXXXXXXAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDV 1505
              E LK+PF             +   +T+  E  EK SPEG+S S LKIKI   TY L +
Sbjct: 1375 SHEKLKIPFLERLI--------EYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHI 1426

Query: 1506 EPGSFDVFSRKSLNKFPTDA 1525
            E GS+DVF+RK+ NK+PT A
Sbjct: 1427 ESGSYDVFTRKAANKYPTVA 1446

 Score =  191 bits (485), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 94/103 (91%)

Query: 265 EEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 324
           +EDP+YRPLNVKDALSYLEQVK QFNS+P IYN FLDIMKDFKSQ IDTPGVIERVSTLF
Sbjct: 62  DEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLF 121

Query: 325 KGYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTN 367
           +GYP+LIQGFNTFLPQGY I CS NPDDP+RVTTPMGT+T  N
Sbjct: 122 RGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNN 164

 Score =  124 bits (310), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/73 (80%), Positives = 68/73 (93%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFSQAI+YVNKIKTR+ADQP IYKHFLEILQTYQRE+KPI+EVY QVT LF +APDLL
Sbjct: 253 DVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLL 312

Query: 524 EDFKKFLPETPAN 536
           EDFKKFLP++ A+
Sbjct: 313 EDFKKFLPDSSAS 325

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 38/62 (61%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318

Query: 338 LP 339
           LP
Sbjct: 319 LP 320

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 39/63 (61%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K ++  +P IY  FL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 75  ALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 134

Query: 530 LPE 532
           LP+
Sbjct: 135 LPQ 137

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1042 bits (2695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/965 (55%), Positives = 651/965 (67%), Gaps = 101/965 (10%)

Query: 584  IPQQNLPPIGSFSXXXXXXXXXXXXXXXGTVVNNFRHGISMQ----TALPSMMT--PDT- 636
            +PQQNLPPIGSFS                TV +N++    MQ      LPSM+   P+  
Sbjct: 554  VPQQNLPPIGSFSPPTNG----------STVHDNYQDQQHMQPPHLVPLPSMVQHGPNMV 603

Query: 637  ------EAIPISNLRS--VDGFPPSS--------GGVIPMPNNQTADFXXXXXXXXXXLT 680
                  E +PIS+LR+   D + PS+          + P+ + Q  D             
Sbjct: 604  HQGIANENLPISDLRTSLTDQYAPSTFQQQQQNPPSISPITDLQYGD------------- 650

Query: 681  NRLPDQFPLDXXXXXXXXXXXXXXXXXXXLISEAPTRPEIDLDPSIVXXXXXXXXXXXXX 740
                                              P RPEIDLDPSIV             
Sbjct: 651  ---------------------------------VPVRPEIDLDPSIVPVVPEPTEPIEDN 677

Query: 741  XXLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDW 800
              L EE +FFEK K++I +K +Y EFLK+LNLYSQD+L  ++LV +VD+Y+GSNKELF W
Sbjct: 678  ISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSW 737

Query: 801  FKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLN 860
            FK FVGY E    IENI+HEKH+LDLDLCEA+GPSYK+LPK+DTFMPCSGRD MCWE+LN
Sbjct: 738  FKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILN 797

Query: 861  DEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKIN 920
            DEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDF+IESNLRTIQ LETI NKI 
Sbjct: 798  DEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIE 857

Query: 921  NMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLK 980
            NMT  EK +FKLP GLGHTS TIYKKVIRKVYDKERGFEIIDALHEHPA   P++L+RLK
Sbjct: 858  NMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLK 917

Query: 981  EKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQ 1040
            +KDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLTTKQLISEI+SI+VDQ
Sbjct: 918  QKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQ 977

Query: 1041 NNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIG 1100
             NK+IHWLTPKPKSQLDF F D DI  DIL LA+ FI HT+ YSN +KERLKD L+ FI 
Sbjct: 978  TNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFIS 1037

Query: 1101 LFFSIPSSEIDKKLSGKNDEKFEKGXXXXXXXXXXXXXAKKRSLELDIPLADVLRKYKYQ 1160
            LFFSIP  +I+K L        E               ++KR  + ++ L D+L + +YQ
Sbjct: 1038 LFFSIPLEKIEKALQFHK----ENVSESSGSDDGGSSTSRKRPYQQEMSLLDILHRNRYQ 1093

Query: 1161 KIKEKVINELENNSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKKPWLLGSVIDKTS 1220
            K+K    N+ E                                   + PWL G+++++ +
Sbjct: 1094 KLKRS--NDEEGK--------IPQLSEPLDEESNTIEEEELISEEARNPWLTGNLVEEAN 1143

Query: 1221 EHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLG 1280
              G+I+NR IFNLFANTNIY+FFRHWTTIYERLLE+KQ+N K+T+E+N+R    FAKDL 
Sbjct: 1144 SQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLD 1203

Query: 1281 LISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKV 1340
            L+S QL  MGLDF   D+YK++L L++RLI  D+EHQWFEESLRQAYNNKAFKLYT DKV
Sbjct: 1204 LLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKV 1263

Query: 1341 IQALVKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEF 1400
             Q+LVKHA++++ D K +EIMALF KDR   +T+ +DQIIYRLQ R++M+N ENMFRIE 
Sbjct: 1264 TQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIEL 1323

Query: 1401 NENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFXXXXXX 1460
            N+ + HV +QYIA++DLTLK     ++ W+YYVTSY LPHPTEG+  E LK+PF      
Sbjct: 1324 NKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLI- 1382

Query: 1461 XXXXXAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNK 1520
                   +   +T+  E  E+ SPEGIS S L+IKI   TY L +E GS+DVF+RK++NK
Sbjct: 1383 -------EFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNK 1435

Query: 1521 FPTDA 1525
            +PT A
Sbjct: 1436 YPTIA 1440

 Score =  189 bits (480), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%)

Query: 265 EEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 324
           +EDP+YRPLNVKDALSYLEQVK QF+S+P IYN FLDIMKDFKSQ IDTPGVIERVSTLF
Sbjct: 219 DEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLF 278

Query: 325 KGYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTN 367
           +GYP+LIQGFNTFLPQGY I CS NPDDP+RVTTPMGT+T  N
Sbjct: 279 RGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNN 321

 Score =  124 bits (311), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/73 (80%), Positives = 68/73 (93%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFSQAI+YVNKIKTR+ADQP IYKHFLEILQTYQRE+KPI+EVY QVT LF +APDLL
Sbjct: 413 DVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLL 472

Query: 524 EDFKKFLPETPAN 536
           EDFKKFLP++ A+
Sbjct: 473 EDFKKFLPDSSAS 485

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 38/62 (61%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478

Query: 338 LP 339
           LP
Sbjct: 479 LP 480

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 40/63 (63%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K +++ +P IY  FL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 232 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTF 291

Query: 530 LPE 532
           LP+
Sbjct: 292 LPQ 294

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/840 (61%), Positives = 612/840 (72%), Gaps = 26/840 (3%)

Query: 713  EAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772
            E   RPEIDLDPS+V               LVEETSFF+K KKFI +K IY EFLK+LNL
Sbjct: 511  EPVARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNL 570

Query: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832
            YSQDLL  +ELV +V+YY+G NKELFDWFK FVGY + P  IENI+HEKH+LDLDLCEA 
Sbjct: 571  YSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEAC 630

Query: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892
            GPSYKKLPK DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 631  GPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 690

Query: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952
            EERHEYDF+IE+NLRTIQTLETIANKI NMT EEK  FKL  GLGHTS TIYKKVIRKVY
Sbjct: 691  EERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVY 750

Query: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012
            DK+RGFEIIDALHE P+ AVPI+L+RLK+KDEEWRRAQREWNKVWRELEQKVYYKSLDHL
Sbjct: 751  DKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 810

Query: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072
            GLTFKQADKKLLTTKQL+SEIS+I+VDQ NKRIH LTPKPKSQLD+ F D ++L DIL+L
Sbjct: 811  GLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNL 870

Query: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLS-GKNDEKFEKGXXXXXX 1131
            A VFID  +TYSN +KE++ DFL+ F+ LFFS P  E++   +  + D   + G      
Sbjct: 871  AKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDG--EENS 928

Query: 1132 XXXXXXXAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNXXXXXXXXXXXXXXXX 1191
                   ++KR+ E +  L DVLR+ KYQK             N                
Sbjct: 929  GQENSDLSRKRTREEENLLKDVLRRNKYQK-----------GRNFAEEEPIPEESEFAEK 977

Query: 1192 XXXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYE 1251
                           KKPWLLGS++D+ +EHG +ENR  FN+FANTNIYVFFRH  T+Y 
Sbjct: 978  TVEEKEEEEIIRQEAKKPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYT 1037

Query: 1252 RLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIK 1311
            RL E+K IN+ VT EI +RKV  FAKDL LISTQL+ MGLDF+ +D+Y ++L L+KRLI+
Sbjct: 1038 RLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIE 1097

Query: 1312 NDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRS 1371
             DIEHQWFEESLRQAY NKAFK+YT DKV+Q+LVKHA++I+TD K  EIM LFEKDR   
Sbjct: 1098 GDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCL 1157

Query: 1372 STTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEY 1431
            +T+ ++QI+YRLQ R+HMT  ENMFRIE+N  + H  IQ++AV+DLTL+   + ++ W+Y
Sbjct: 1158 NTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKY 1217

Query: 1432 YVTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDNETEKNEFIEKISPEGISTSK 1491
            YVTSY+L HPTEG+  E L+ PF                 + E  E+    SPEG+S+S 
Sbjct: 1218 YVTSYSLSHPTEGISHEELQPPFLEKILEKEEEF------QCENGEY----SPEGVSSSN 1267

Query: 1492 LKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAXXXXXXXXXXXXA--FNKFLSSKRGW 1549
            LK+KI+ ETY+LDV+PGS+D FSRKS+NKFP +             A     +L+  +GW
Sbjct: 1268 LKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGW 1327

 Score =  169 bits (429), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 88/105 (83%), Gaps = 2/105 (1%)

Query: 266 EDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325
           +DP YRPLNVKDALSYLEQVK QFN++P +YN FLDIMKDFKSQ IDTPGVIERVS LF+
Sbjct: 154 QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

Query: 326 GYPVLIQGFNTFLPQGYTIHCSDNPDD--PVRVTTPMGTSTYTNL 368
           GYP LIQGFNTFLPQGY I CS NP+D  P++VTTP GT+    L
Sbjct: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTL 258

 Score =  122 bits (305), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 80/134 (59%), Gaps = 39/134 (29%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFS AI+YVNKIKTR+A+QP IYKHFLEILQTYQRE+KPI+EVY QVTVLF +APDLL
Sbjct: 338 DVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLL 397

Query: 524 EDFKKFLPETPANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPFSNNGPVP---SG 580
           +DFKKFLP+  A                                  P S   P P     
Sbjct: 398 DDFKKFLPDASA----------------------------------PQSTTTPAPVNGGT 423

Query: 581 FY--QIPQQNLPPI 592
           FY    PQQNLPP+
Sbjct: 424 FYPQAAPQQNLPPL 437

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 42/63 (66%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K ++ ++P +Y HFL+I++ ++ +      V E+V+ LF   P+L++ F  F
Sbjct: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTF 225

Query: 530 LPE 532
           LP+
Sbjct: 226 LPQ 228

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 338 LPQGYTIHCSDNP 350
           LP       +  P
Sbjct: 404 LPDASAPQSTTTP 416

 Score = 33.1 bits (74), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 748 SFFEKVKKFISSKP-IYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVG 806
           S+  K+K   + +P IY  FL++L  Y ++    NE+  +V     +  +L D FK F+ 
Sbjct: 346 SYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLP 405

Query: 807 YSEIPST 813
            +  P +
Sbjct: 406 DASAPQS 412

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1026 bits (2654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/826 (61%), Positives = 607/826 (73%), Gaps = 29/826 (3%)

Query: 712  SEAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLN 771
            SE   RPEIDLDPS+V               L+EET+FFE+VKK I +K IY EFLK+LN
Sbjct: 589  SELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKILN 648

Query: 772  LYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEA 831
            L+S DLL+ +ELV +V+YYIG+NKELFDWFK FVGY + P  IENI+HEKHKLDLDLCEA
Sbjct: 649  LFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEA 708

Query: 832  YGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 891
            YGPSYKKLPKTDTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI
Sbjct: 709  YGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 768

Query: 892  EEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKV 951
            EEERHEYD++IESNLRTIQTLETIANKI NMT  EK  F+LP GLGHTS TIYKKVIRKV
Sbjct: 769  EEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKV 828

Query: 952  YDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDH 1011
            YDKERGFEIIDALH +PA +VPIILRRLK+KDEEWRRAQREWNK+WR+LEQKVY+KSLDH
Sbjct: 829  YDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDH 888

Query: 1012 LGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILD 1071
            LGLTFKQADKKLLTTKQLISEI+ I+VDQN+KRIHWLTPKPK+QLD+ F D+DIL DI+ 
Sbjct: 889  LGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIA 948

Query: 1072 LANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKL------------SGKND 1119
            L  VF  +T+ YSN +KER+KD LRVF+  FFSIP  E+   L            S K  
Sbjct: 949  LGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKGS 1008

Query: 1120 EKFEKGXXXXXXXXXXXXXAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNXXXX 1179
             K ++              +KKR  + D+ ++D+L K K QK K           N    
Sbjct: 1009 GKMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTK----------MNKEMD 1058

Query: 1180 XXXXXXXXXXXXXXXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNI 1239
                                       +K WL+G V+D  ++   ++NR+I+NLFANTNI
Sbjct: 1059 GSKSPSEDLGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNI 1118

Query: 1240 YVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSY 1299
            Y+FFRH  T+YERL E+KQIND++ +EI SR+VT FAKDLGLISTQL+ +GLDF +SD+Y
Sbjct: 1119 YIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAY 1178

Query: 1300 KELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASE 1359
            ++LL L+KRLI+ DIEHQWFEES+RQAYNN+AFKLYT DKV+Q+ VKHA+++++DSK SE
Sbjct: 1179 QQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSE 1238

Query: 1360 IMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTL 1419
            IM LFE  R  + TTT+DQI+YR+Q R+HM++TENMFRIE+     H  IQYIA++DLTL
Sbjct: 1239 IMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTL 1298

Query: 1420 KPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDNETEKNEFI 1479
            K + + +E W YYVTSY+L +PTEGVP E L+VPF           ++D  N +      
Sbjct: 1299 KTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNS------ 1352

Query: 1480 EKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDA 1525
               S  GIS S L I ID+E YNL ++ GS DV+SR ++ K+P  A
Sbjct: 1353 -TYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPIVA 1397

 Score =  176 bits (447), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/99 (82%), Positives = 91/99 (91%), Gaps = 1/99 (1%)

Query: 267 DP-EYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325
           DP  YRPLNVKDALSYLEQVK QF+++P IYN FLDIMKDFKSQTIDTPGVIERVS+LFK
Sbjct: 181 DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240

Query: 326 GYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTST 364
           GYP LIQGFNTFLPQGY I CS+NP+DP++VTTPMG+ST
Sbjct: 241 GYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSST 279

 Score =  123 bits (308), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 66/73 (90%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFSQAI YVNKIKTR+ADQP IYK FLEILQTYQRE+KPI EVY QVT+LF +APDLL
Sbjct: 336 DVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLL 395

Query: 524 EDFKKFLPETPAN 536
           +DFKKFLP++ A+
Sbjct: 396 DDFKKFLPDSSAS 408

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 271 RPLNVK--DALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYP 328
           +P +V+   A++Y+ ++K +F  QP IY QFL+I++ ++ +      V  +V+ LF+  P
Sbjct: 333 KPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAP 392

Query: 329 VLIQGFNTFLP 339
            L+  F  FLP
Sbjct: 393 DLLDDFKKFLP 403

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 40/63 (63%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K ++  +P IY  FL+I++ ++ +      V E+V+ LF   P+L++ F  F
Sbjct: 193 ALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQGFNTF 252

Query: 530 LPE 532
           LP+
Sbjct: 253 LPQ 255

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/864 (59%), Positives = 620/864 (71%), Gaps = 32/864 (3%)

Query: 713  EAP-TRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLN 771
            EAP  RPEIDLDPS+V               L +E +FFE+VK+FI +K +Y EFLK+LN
Sbjct: 657  EAPMARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILN 716

Query: 772  LYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEA 831
            LYSQDLL+T+ELV++V++Y+ S+KELFDWFK+FVGY E P  IENI+HEKH+LDLDLCEA
Sbjct: 717  LYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEA 776

Query: 832  YGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKI 891
             GPSYKKLPK DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+
Sbjct: 777  CGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKV 836

Query: 892  EEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKV 951
            EEERHEYDF+IESNLRTIQTLETIANKI NMT EEK NFKLP GLGHTS TIYKKV+RKV
Sbjct: 837  EEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKV 896

Query: 952  YDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDH 1011
            YDK+RGFEIIDALHEHPA  VPI+L+RLK+KDEEWRRAQREWNKVWRELEQKVYYKSLDH
Sbjct: 897  YDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDH 956

Query: 1012 LGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILD 1071
            LGLTFKQADKKLLTTKQL+SEISSI+VDQ NKRIH LTPKPKSQLDF  ND ++L DILD
Sbjct: 957  LGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILD 1016

Query: 1072 LANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKND-EKFEKGXXXXX 1130
            L   F+   ++YSNS+K +L  F + FI LFFS P  ++++ +S ++     E G     
Sbjct: 1017 LVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQENGEEDSN 1076

Query: 1131 XXXXXXXXAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNXXXXXXXXXXXXXXX 1190
                     +  S E    + D+LR+ K      K  N  EN ++               
Sbjct: 1077 KSDSEKSNKRTLSDEDSYLMKDILRRTK----NAKTSNSEENQNSSSVKSNEEDETELLA 1132

Query: 1191 XXXXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIY 1250
                             KPWLLGS+ID+ +  G++ +RHIFNLF NT IYVFFRH  T+Y
Sbjct: 1133 KEAA-------------KPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLY 1179

Query: 1251 ERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLI 1310
            ERLLE+K+I+ +VT EI +RK+  FA DL LISTQL  MGL FK + +Y ELL L+KRLI
Sbjct: 1180 ERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLI 1239

Query: 1311 KNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLR 1370
              D++HQWFEESLRQAY NKAFK+YT DKV+Q+LVKHA+SI+TD K + +M LFE+DRL+
Sbjct: 1240 TGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLK 1299

Query: 1371 SSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWE 1430
              TT +DQI+YRL+ R  M  +ENMFRIE+N +++HV IQY+AV+DLTLK     KE W+
Sbjct: 1300 RDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWD 1359

Query: 1431 YYVTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDNETEKNEFIEKISPEGISTS 1490
            YYVTSY+L HPTEG+ QE +  PF           A+ LD+E + ++F    SPEG+S S
Sbjct: 1360 YYVTSYSLSHPTEGITQEDISQPF---LGKIIEKEAEYLDDEEQNDKF----SPEGVSQS 1412

Query: 1491 KLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAXXXXXXXXXXXXAFNKFLSSKRGWN 1550
            KLK+ I  ETY L  E GS DVF+RKS+NKFP+                +KFL+S +GW 
Sbjct: 1413 KLKVNIHPETYELTFECGSTDVFTRKSVNKFPS------SQSTQPASKMDKFLNSSKGWK 1466

Query: 1551 NQFKPDQVAGIEEGWKKFQETGEF 1574
                 + +   E   K  +E G+ 
Sbjct: 1467 KNLSTEIIGRAESKMKILKEQGKL 1490

 Score =  165 bits (417), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 73/94 (77%), Positives = 84/94 (89%)

Query: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329
           YRPLNVKDALSYLEQVK QF+S+P +YN FLDIMKDFKSQ IDTPGVI+RV+TLF+G+P 
Sbjct: 201 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPN 260

Query: 330 LIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTS 363
           LIQGFNTFLP GY I CS NP+DP++VTTP GT+
Sbjct: 261 LIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTT 294

 Score =  118 bits (295), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 55/70 (78%), Positives = 63/70 (90%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           EVEFS AI+YVNKIKTR+ADQP IYK FLEILQTYQRE+KPI EVY QVT+LF + PDLL
Sbjct: 424 EVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLL 483

Query: 524 EDFKKFLPET 533
           +DFKKFLP++
Sbjct: 484 DDFKKFLPDS 493

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 41/62 (66%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K +++ +P +Y HFL+I++ ++ +      V ++VT LF   P+L++ F  F
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGFPNLIQGFNTF 268

Query: 530 LP 531
           LP
Sbjct: 269 LP 270

 Score = 49.7 bits (117), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 38/62 (61%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A+SY+ ++K +F  QP IY QFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 338 LP 339
           LP
Sbjct: 490 LP 491

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1021 bits (2641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/912 (56%), Positives = 630/912 (69%), Gaps = 18/912 (1%)

Query: 713  EAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772
            E   RPEIDLDPS+V               LVEE SFF+K KK+I +K IY EFLK+LNL
Sbjct: 562  ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNL 621

Query: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832
            YSQDLL    LV +V +Y+    ELFDWFK+FVGY E P  IENI+HEKH+LDLDLCEA 
Sbjct: 622  YSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEAC 681

Query: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892
            GPSYK+LPK DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIE
Sbjct: 682  GPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIE 741

Query: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952
            EERHEYDF+IE+NLRTIQTLETIANKI NMT EEK  FKLP GLGHTS TIYKKVIRKVY
Sbjct: 742  EERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVY 801

Query: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012
            DK+RG+EIIDALHE+PA  VPI+L+RLK+KDEEWRRAQREWNKVWRELEQKV++KSLDHL
Sbjct: 802  DKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 861

Query: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072
            GLTFKQADKKLLT KQLISEISSI+VDQNNKRIH LTPK KSQLD  F D ++  DIL+L
Sbjct: 862  GLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNL 921

Query: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGXXXXXXX 1132
            A VF+++ +TYS  +KERLKDF + FI LF S P  +I+K L+     K +         
Sbjct: 922  AIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALA-----KRDAASSSQSSN 976

Query: 1133 XXXXXXAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNXXXXXXXXXXXXXXXXX 1192
                  ++K+  + D+ L     +    ++   V+    N                    
Sbjct: 977  SNTETYSEKQQEDGDMKLPKKRNREDSDRLLRDVL--FRNKQQKGGRNSPRGDSSISAEK 1034

Query: 1193 XXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYER 1252
                          K PWLLGS++D+   HG +ENR  FNLFANTNIYVFFRH  TIYER
Sbjct: 1035 ESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYER 1094

Query: 1253 LLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKN 1312
            L+E+K++ND+VT+EI +RKV  FAKDL LISTQLT MGLDFK  D+Y++LL L++ LI  
Sbjct: 1095 LVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAG 1154

Query: 1313 DIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSS 1372
            D+EHQWFEESLRQAY NKAFK+YT DKVIQALVKHA++I+TD+K  EIM LFEKDR   S
Sbjct: 1155 DLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLS 1214

Query: 1373 TTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYY 1432
            T+T+DQI+YRLQ R++M+N ENMFRIE+N  T HVCIQ++AV+DLTL+   + K+ W+YY
Sbjct: 1215 TSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYY 1274

Query: 1433 VTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDNETEKNEFIEKISPEGISTSKL 1492
            +TSY+L HPTEG+  + L+ PF            +D D         EK SPEG++TS L
Sbjct: 1275 LTSYSLSHPTEGISHDNLRSPFLEKIIESEEDIIEDKD---------EKYSPEGVATSNL 1325

Query: 1493 KIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAXXXXXXXXXXXXAFNKFLSSKRGWNNQ 1552
            K+KID  TY+++VE GS D+FSRK++NKFP                  +FL+S  GW   
Sbjct: 1326 KVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVDIRKKKSSELKLELERFLNSNSGWKKD 1385

Query: 1553 FKPDQVAGIEEGWKKFQETGEFIPIPKPITTESTTGVIAEPVIKP--ASNPIVVTPVTAA 1610
                Q+A +E+  +  +  G            ST+ V    + K   A +    T V+A+
Sbjct: 1386 LSAKQIAEVEKRLEFVKLNGNLEEYSDDSAVASTSAVSGSDLAKEDIARSQSESTVVSAS 1445

Query: 1611 IEAVATAPIPTD 1622
            +   A + + T+
Sbjct: 1446 MATCAQSTLKTE 1457

 Score =  172 bits (437), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 77/94 (81%), Positives = 85/94 (90%)

Query: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329
           YRPLNVKDALSYLEQVK QFNS+P +YN FLDIMKDFKSQ IDTPGVIERVSTLF+GYP 
Sbjct: 160 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPT 219

Query: 330 LIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTS 363
           LIQGFNTFLPQGY I CS +P+DP++VTTP GT+
Sbjct: 220 LIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTT 253

 Score =  124 bits (310), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 58/72 (80%), Positives = 66/72 (91%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFS AI+YVNKIKTR+ADQP IYKHFLEILQTYQRE+KPI+EVY QVTVLF +APDLL
Sbjct: 351 DVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLL 410

Query: 524 EDFKKFLPETPA 535
           +DFKKFLP+  A
Sbjct: 411 DDFKKFLPDASA 422

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 40/63 (63%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K ++  +P +Y HFL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227

Query: 530 LPE 532
           LP+
Sbjct: 228 LPQ 230

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (59%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 338 LP 339
           LP
Sbjct: 417 LP 418

 Score = 35.0 bits (79), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 748 SFFEKVKKFISSKP-IYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVG 806
           S+  K+K   + +P IY  FL++L  Y ++    NE+  +V     +  +L D FK F+ 
Sbjct: 359 SYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLP 418

Query: 807 YSEIPSTIENIIHEKH 822
            +  P   +  + + H
Sbjct: 419 DASAPQAQQQHLAQSH 434

 Score = 34.3 bits (77), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 273 LNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQ 332
           LN+ +  S+ ++ K ++     IY +FL I+  +    +D   ++E+V     G P L  
Sbjct: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648

Query: 333 GFNTFLPQGY 342
            F +F+  GY
Sbjct: 649 WFKSFV--GY 656

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/888 (57%), Positives = 617/888 (69%), Gaps = 40/888 (4%)

Query: 713  EAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772
            E   RPEIDLDPS+V               LVEE +FF+K KKFI +K IY EFLK+LNL
Sbjct: 468  EPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNL 527

Query: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832
            YSQDLL   +LV  V +Y+  + ELFDWFK+FVGY E P  IEN+IHEKH+LDLDLCEA 
Sbjct: 528  YSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEAC 587

Query: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892
            GPSYK+LPK DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIE
Sbjct: 588  GPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIE 647

Query: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952
            EERHEYDF+IE+NLRTIQTLETIANKI NMT EEK  FKLP GLGHTS TIYKKVIRKVY
Sbjct: 648  EERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVY 707

Query: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012
            DK+RGFEIIDALHEHPA  VP++L+RLK+KDEEWRRAQREWNKVWRELEQKV+YKSLDHL
Sbjct: 708  DKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHL 767

Query: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072
            GLTFKQADKKLLT KQLISEISSI+VDQ+NKRIH LTPK KSQL + F + ++  DIL L
Sbjct: 768  GLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSL 827

Query: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGXXXXXXX 1132
              VF+ + +TYS S+ ERLKDF + FI LFFS P  EI++ L  ++ +            
Sbjct: 828  VMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRK 887

Query: 1133 XXXXXXAKKRSLELDIP------LADVLRKYKYQKIKEKVIN-----ELENNSNXXXXXX 1181
                   +K S    +       L D+L + K QK+ +   N     E E  S+      
Sbjct: 888  SKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVNKGPQNDQSSEEFEKESD------ 941

Query: 1182 XXXXXXXXXXXXXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYV 1241
                                     KKPWLLGS++D+   HG + +R  FN+FANTNIYV
Sbjct: 942  --------------IEEKEIVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYV 987

Query: 1242 FFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKE 1301
            FFRH TT+YERL+E+K+IN +VT+EI++RKV  FAKDL LISTQLT MGLDFK +D+Y+E
Sbjct: 988  FFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYEE 1047

Query: 1302 LLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIM 1361
            LL L++ LI  ++EHQWFEESLRQAY NKAFKLYT DKVIQALVKHA++IL D K  EIM
Sbjct: 1048 LLRLSRSLISGELEHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIM 1107

Query: 1362 ALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKP 1421
             LF+ DR  +ST+T+DQI+YRLQ R++M+N ENMFRIE+N  T+H  IQ++AVEDLTL  
Sbjct: 1108 LLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDE 1167

Query: 1422 SPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDNETEKNEFIEK 1481
              + ++ W+YY+TSY+L HPTEG+  + L+ PF             D D         E+
Sbjct: 1168 PKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDGD---------ER 1218

Query: 1482 ISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAXXXXXXXXXXXXAFNK 1541
             SPEG+++S +K+KID  TY+++VEPG  D+FSRKS+NKFPT                  
Sbjct: 1219 YSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRVDVKKKKSAELKLVLEG 1278

Query: 1542 FLSSKRGWNNQFKPDQVAGIEEGWKKFQETGEFIPIPKPITTESTTGV 1589
            FL+ +RGW       + A  E   +  +  G      + I+T++   +
Sbjct: 1279 FLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEEISTDTKAAL 1326

 Score =  166 bits (419), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 74/93 (79%), Positives = 81/93 (87%)

Query: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329
           YRPLNVKDALSYLEQVK QF+S+P +YN FLDIMKDFKSQ IDTPGVIERVSTLF GYP 
Sbjct: 129 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188

Query: 330 LIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGT 362
           LIQGFNTFLP GY I C  +P+DP++VTTP GT
Sbjct: 189 LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGT 221

 Score =  123 bits (309), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/141 (49%), Positives = 83/141 (58%), Gaps = 29/141 (20%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFS AI+YVNKIKTR+A+QP IYKHFLEILQTYQRE+KPI+EVY QVTVLF +APDLL
Sbjct: 283 DVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLL 342

Query: 524 EDFKKFLPETPANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPFSNNGPVPSGFYQ 583
           +DFKKFLP++ A                                       G   SG  Q
Sbjct: 343 DDFKKFLPDSSAPQLQSHQQINGAMVA---------------------PGFGHAQSGLQQ 381

Query: 584 --------IPQQNLPPIGSFS 596
                   + QQNLPP+G+FS
Sbjct: 382 ALPGTQPLMHQQNLPPLGNFS 402

 Score = 50.8 bits (120), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 41/62 (66%)

Query: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529
           A++Y+ ++K +++ +P +Y HFL+I++ ++ +      V E+V+ LF+  P L++ F  F
Sbjct: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196

Query: 530 LP 531
           LP
Sbjct: 197 LP 198

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (59%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 348

Query: 338 LP 339
           LP
Sbjct: 349 LP 350

 Score = 34.3 bits (77), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 748 SFFEKVKKFISSKP-IYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVG 806
           S+  K+K   + +P IY  FL++L  Y ++    NE+  +V     +  +L D FK F+ 
Sbjct: 291 SYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLP 350

Query: 807 YSEIP 811
            S  P
Sbjct: 351 DSSAP 355

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1013 bits (2618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/810 (60%), Positives = 611/810 (75%), Gaps = 34/810 (4%)

Query: 713  EAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772
            E  +RPEIDLDPS+V               L+EETSFF++ KK++ +K +Y EFLK+LNL
Sbjct: 550  EPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNL 609

Query: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832
            +SQDL+ T ELV +V++Y+G + ELFDWFK+FV Y E P  IEN+IHEKH+LDLDLCEA 
Sbjct: 610  FSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEAC 669

Query: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892
             PSYKKLPK DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 670  FPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 729

Query: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952
            EERHEYD++IE+NLRTIQ LETIANKI+NMT EEK+ FKLP GLGHTS TIYKKVIRKVY
Sbjct: 730  EERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVY 789

Query: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012
            DK+RGFEIIDALHE+PA +VPIIL+RLK+KDEEWRRAQREWNKVWRELEQKV+YKSLDHL
Sbjct: 790  DKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHL 849

Query: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072
            GLTFKQADKKLLT KQLISEISSI+VDQ NKRI+  TPKPKSQLD+   D  +L DIL L
Sbjct: 850  GLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCL 909

Query: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGXXXXXXX 1132
             N FIDH+STYSN +KE+L  F + F+ +FFSI   EI+      +D             
Sbjct: 910  VNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTPADSD------------- 956

Query: 1133 XXXXXXAKKRSLELDIPLADVLR-KYKYQKIKEKVINELENNSNXXXXXXXXXXXXXXXX 1191
                   +KR  E + PL ++LR K+K+ K ++      E++S                 
Sbjct: 957  AVSNSNPRKRLWESEQPLKELLRSKHKHHKKRD---TSAEDDS-------ISDDQNSPEK 1006

Query: 1192 XXXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYE 1251
                           KKPWLLG+++D+ ++HG + NR IFNLFANTN+YVFFRH TT+Y+
Sbjct: 1007 SPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQ 1066

Query: 1252 RLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIK 1311
            RL E+K +N++VTREINSR V  FAKDL L+STQL+ MGLDFK  D+Y +LL L KRLI+
Sbjct: 1067 RLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIR 1126

Query: 1312 NDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRS 1371
            ND++HQWFEESLRQAY NKAFK+YT DKVIQ+LVKHA+SI+TD+K++EIM LFEKDR  +
Sbjct: 1127 NDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCT 1186

Query: 1372 STTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEY 1431
            +T+T++QI+YRLQ R++M  TENMFR+E N+++ HVCIQY+A++DLTLK   + K+ W Y
Sbjct: 1187 ATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHY 1246

Query: 1432 YVTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDNETEKNEFIEKISPEGISTSK 1491
            Y+TSYAL HPTEG+P E +KVPF            + L ++ E +E  E+ SP G S S 
Sbjct: 1247 YLTSYALSHPTEGIPHEEIKVPFLE----------KTLQDDEEADEGSEERSPSGHSLSN 1296

Query: 1492 LKIKIDQETYNLDVEPGSFDVFSRKSLNKF 1521
            L+I+++ E+Y L +EPGS D+F+R ++N+F
Sbjct: 1297 LRIQVNPESYELQIEPGSKDIFTRFAVNRF 1326

 Score =  160 bits (406), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 75/112 (66%), Positives = 88/112 (78%), Gaps = 2/112 (1%)

Query: 266 EDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325
           +DP YRPLN KDALSYLEQVK QFN++P +YN FLDIMKD+KSQ IDT GVIER+STLFK
Sbjct: 138 QDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197

Query: 326 GYPVLIQGFNTFLPQGYTIHCSDNPDDP--VRVTTPMGTSTYTNLPNVDNTN 375
           GYP+LIQG NTFLPQGY I C+ NP+DP  ++VTTP   +   NL  +   N
Sbjct: 198 GYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGN 249

 Score =  125 bits (313), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 74/149 (49%), Positives = 83/149 (55%), Gaps = 20/149 (13%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFS AI+YVNKIKTR+ADQP IYKHFLEILQTYQRE+KPI EVY QVT LF +APDLL
Sbjct: 333 DVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLL 392

Query: 524 EDFKKFLPETPANNX-------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYP 570
           +DFKKFLP+  A +                                             P
Sbjct: 393 DDFKKFLPDATAAHEQQQLLLQQQQQQQQQLQQQQIQQHQSHYQNASQDLDQRQQHTHQP 452

Query: 571 FSNNGPVPSGFYQIPQ---QNLPPIGSFS 596
           F N  P    FYQ  Q   QNLPP+GSFS
Sbjct: 453 FGNTVP----FYQTQQGRPQNLPPLGSFS 477

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 39/68 (57%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V++LF+  P L+  F  F
Sbjct: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKF 398

Query: 338 LPQGYTIH 345
           LP     H
Sbjct: 399 LPDATAAH 406

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 42/68 (61%)

Query: 465 VEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLE 524
           + F  A++Y+ ++K ++ ++P +Y HFL+I++ Y+ +      V E+++ LF   P L++
Sbjct: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204

Query: 525 DFKKFLPE 532
               FLP+
Sbjct: 205 GLNTFLPQ 212

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/851 (58%), Positives = 617/851 (72%), Gaps = 34/851 (3%)

Query: 713  EAPTRPEIDLDPSIVXXXXXXXXXXXXXXXLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772
            E  +RPEIDLDPS+V               L+EETSFF+K KK++ +K +Y EFLK+LNL
Sbjct: 660  EPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNL 719

Query: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832
            +SQDL+ T+ELV +V++Y+G N ELFDWFK+FV Y E P  IEN++HEKH+LDLDLCEA 
Sbjct: 720  FSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRLDLDLCEAC 779

Query: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892
             PSYKKLPK DTFMPC GRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 780  CPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 839

Query: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952
            EERHEYD++IE+NLRTIQ LETIANKI+NMT EEKK FKLP GLGHTS+TIYKKVIRKVY
Sbjct: 840  EERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVY 899

Query: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012
            DK+RGFEIIDALHE+PA +VPI+LRRLK+KDEEWRRAQREWNKVWRELEQKV+YKSLDHL
Sbjct: 900  DKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHL 959

Query: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072
            GLTFKQADKKLLT KQLISEISSI++DQ NKRI+  T KPKSQLDF  +D  +L DIL+L
Sbjct: 960  GLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNL 1019

Query: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGXXXXXXX 1132
             + FIDH++TYSN +KE+L  F R F+ +FFSIP +++D   +   + K E G       
Sbjct: 1020 VDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLD---NPSEEHKVENG------- 1069

Query: 1133 XXXXXXAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNXXXXXXXXXXXXXXXXX 1192
                   +KRS + D    D+L+    Q  K+    E E+ S+                 
Sbjct: 1070 ----DSTRKRSRDDDQFFRDLLKSKHKQAKKKTSQQEDESTSDDQDTAAKTSPDLEYEEA 1125

Query: 1193 XXXXXXXXXXXXXMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYER 1252
                          KKPWLLG+++D+ + HG + NR  +N+FANTNIYVFFRH TT+Y+R
Sbjct: 1126 VRLDA---------KKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQR 1176

Query: 1253 LLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKN 1312
            L E K IN++VT+EINSRKV  FAKDL L STQL+ MGLDFK +D+Y++LL L KRLI++
Sbjct: 1177 LSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQS 1236

Query: 1313 DIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSS 1372
            DIEHQWFEESLRQAY NKAFK+YT DKVIQ+LVKHA+SI+TD+K +EIM LFEKDR   +
Sbjct: 1237 DIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPT 1296

Query: 1373 TTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYY 1432
            T+TR+QI+YRLQ R+ M  TENMFRIE N  + HV IQ++AV+DLTL    + K+ W+YY
Sbjct: 1297 TSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYY 1356

Query: 1433 VTSYALPHPTEGVPQEGLKVPFXXXXXXXXXXXAQDLDNETEKNEFIEKISPEGISTSKL 1492
            +TSY+L HPTEGVP E +K PF            + L ++ + +E  E  SP G S S+L
Sbjct: 1357 LTSYSLSHPTEGVPHEEIKAPFLE----------KTLRDDGDSDEDSEWYSPGGQSVSQL 1406

Query: 1493 KIKIDQETYNLDVEPGSFDVFSRKSLNKFPTD-AXXXXXXXXXXXXAFNKFLSSKRGWNN 1551
            +I+I+ E+Y L +EP S D+F+R ++NK PT               +    ++S+ GW  
Sbjct: 1407 RIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQKSLADMVNSEHGWKK 1466

Query: 1552 QFKPDQVAGIE 1562
              + + +   E
Sbjct: 1467 GLQNESIGKAE 1477

 Score =  158 bits (399), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 85/105 (80%), Gaps = 2/105 (1%)

Query: 266 EDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325
           +D  YRPLN KDALSYLEQVK QFN++P +YN FLDIMKD+KSQ IDT GVIER+STLFK
Sbjct: 245 QDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 304

Query: 326 GYPVLIQGFNTFLPQGYTIHCSDNPDDP--VRVTTPMGTSTYTNL 368
           GYPVLIQG NTFLPQGY I C+ NP DP  ++VTTP  T+   +L
Sbjct: 305 GYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSL 349

 Score =  121 bits (303), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 84/149 (56%), Gaps = 16/149 (10%)

Query: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523
           +VEFS AI+YVNKIKTR+ADQP IYKHFLEILQTYQRE+KPI EVY QVT LF +APDLL
Sbjct: 439 DVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLL 498

Query: 524 EDFKKFLPETPANNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPF-----------S 572
           +DFKKFLP+  A +                                              
Sbjct: 499 DDFKKFLPDATAAHEQHQQLLQQQQQQQQLQHQIQLQQQQSQQYQSFQSSPQELDQRQQQ 558

Query: 573 NNGPV--PSGFYQIPQ---QNLPPIGSFS 596
           +N P   P+ FYQ  Q   QNLPP+G+FS
Sbjct: 559 SNSPFNHPASFYQHQQARAQNLPPLGNFS 587

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 39/68 (57%)

Query: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGFNTF 337
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V++LF+  P L+  F  F
Sbjct: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKF 504

Query: 338 LPQGYTIH 345
           LP     H
Sbjct: 505 LPDATAAH 512

 Score = 49.7 bits (117), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 42/68 (61%)

Query: 465 VEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLE 524
           + F  A++Y+ ++K ++ ++P +Y HFL+I++ Y+ +      V E+++ LF   P L++
Sbjct: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQ 311

Query: 525 DFKKFLPE 532
               FLP+
Sbjct: 312 GLNTFLPQ 319

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  244 bits (622), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 143/359 (39%), Positives = 200/359 (55%), Gaps = 9/359 (2%)

Query: 749  FFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVG-Y 807
            F    +  +  + IY EFLK++NL++Q L+  N    R   + GS+  L   F   +  Y
Sbjct: 206  FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265

Query: 808  SEIPSTIENIIHEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGH 866
             +I   ++  +      D+ D     GPSYK+L   +T   C GRD +C EVLNDEWVGH
Sbjct: 266  KDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGH 325

Query: 867  PVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEE 926
            PVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF + S    I         +     + 
Sbjct: 326  PVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSLQLSKDDG 385

Query: 927  KKNFKL--PVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDE 984
            ++  ++  P     + ++I +KVIR++Y  E G  +IDA+  +P   VP IL+  KEK +
Sbjct: 386  RRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEKYQ 445

Query: 985  EWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKR 1044
            +W  A+ EWNK WRE+EQK YYKSLDHLGL FK A+K+ L  KQL+ E  S + D+  K 
Sbjct: 446  QWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLLKE 505

Query: 1045 IHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFF 1103
             H+   + K    + F D  +L D+ D+    +   S+ S S+K         F  L F
Sbjct: 506  -HYDNYEYK----YEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAFFDLLF 559

 Score =  122 bits (305), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 138/299 (46%), Gaps = 15/299 (5%)

Query: 1227 NRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLIS--T 1284
            NR   N+F + NI   F +  T+YER  ++K     + +++ ++K  P      L     
Sbjct: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPM 678

Query: 1285 QLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQAL 1344
            QL+  GL+    D Y+ +   +K+ +  +++HQWFEESLR  + NKA+KLYT D+VI+ +
Sbjct: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738

Query: 1345 VKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENT 1404
            +    +I       +I+ L   +  + +TT   Q+ YR + R  M    +MFR+E   ++
Sbjct: 739  LGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDS 798

Query: 1405 NHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFXXXXXXXXXX 1464
            N +  QYI V+DL        K     Y   Y     T+ +  +GL  P+          
Sbjct: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNL----- 853

Query: 1465 XAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPT 1523
                L  E +   F+       I    L + I+   Y +D+ PGS D+ S   + K  +
Sbjct: 854  ----LKREEQNIPFMNG----NIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKLKS 904

>ZYRO0D04950g Chr4 complement(416099..418429) [2331 bp, 776 aa] {ON}
           similar to gnl|GLV|KLLA0C12969g Kluyveromyces lactis
           KLLA0C12969g and some similarites with YAL041W
           uniprot|P11433 Saccharomyces cerevisiae YAL041W CDC24
           Guanine nucleotide exchange factor (GEF or GDP-release
           factor) for Cdc42p required for polarity establishment
           and maintenance and mutants have morphological defects
           in bud formation and shmooing
          Length = 776

 Score = 33.1 bits (74), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 747 TSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSN-KELFDWFKTFV 805
           T  ++ +K+F++++  Y+  L++L+LY Q LL++N + +   Y +  N  +  D+ + F+
Sbjct: 280 TEHYKVIKEFVTTERKYVHDLEILDLYRQQLLNSNLITSEELYMLFPNLSDAIDFQRRFL 339

Query: 806 GYSEIPSTIEN 816
              EI S +++
Sbjct: 340 VALEINSLVDS 350

>NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON}
           Anc_5.500
          Length = 1543

 Score = 32.7 bits (73), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 6/83 (7%)

Query: 880 RKNQYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPV----- 934
           RK+   E ++  E + H     +   L T+  L+T +N+I ++T E+  N    V     
Sbjct: 238 RKHYRGEVVYNAESDIHLPHLTVYQTLLTVARLKTPSNRIKDVTREDYANHVTEVTMATY 297

Query: 935 GLGHTSST-IYKKVIRKVYDKER 956
           GL HT +T +   ++R V   ER
Sbjct: 298 GLSHTRNTKVGNDLVRGVSGGER 320

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 152,823,293
Number of extensions: 6488032
Number of successful extensions: 17132
Number of sequences better than 10.0: 42
Number of HSP's gapped: 17477
Number of HSP's successfully gapped: 172
Length of query: 1657
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1534
Effective length of database: 39,377,481
Effective search space: 60405055854
Effective search space used: 60405055854
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 73 (32.7 bits)