Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C026506.28ON38938920700.0
NCAS0D021406.28ON37638713610.0
Kpol_1037.236.28ON37839111911e-163
TDEL0G044106.28ON38138911861e-162
Suva_15.1726.28ON39838911761e-160
ZYRO0C07546g6.28ON37738911661e-159
TPHA0J003906.28ON38039011591e-158
Skud_15.1596.28ON37938911311e-153
Ecym_30326.28ON37738811251e-153
Smik_15.1676.28ON37838911231e-152
SAKL0E01518g6.28ON37939311221e-152
YOL003C (PFA4)6.28ON37838911081e-150
CAGL0E02497g6.28ON37638911031e-149
KLTH0C10978g6.28ON37739110651e-144
KLLA0C06204g6.28ON37738910461e-141
ACL003C6.28ON37538810291e-138
Kwal_56.224596.28ON38339110191e-137
KAFR0A051306.28ON39640010101e-135
KNAG0F029306.28ON38639310071e-135
TBLA0B004806.28ON3774095321e-63
CAGL0D02508g3.12ON3321492213e-19
NDAI0G013403.12ON3351342195e-19
NCAS0E013003.12ON3271292186e-19
TPHA0P015603.12ON3311352115e-18
Kpol_1014.293.12ON3261852098e-18
YNL326C (PFA3)3.12ON3361292091e-17
KAFR0A085903.12ON3311292072e-17
Kwal_55.221263.12ON3601282082e-17
Smik_14.63.12ON3342362062e-17
TBLA0H001503.12ON3452202054e-17
TDEL0A003103.12ON329531992e-16
KNAG0K025703.12ON3281321992e-16
KLTH0F19580g3.12ON3421341992e-16
SAKL0C13596g3.12ON333661974e-16
Skud_14.153.12ON3361291974e-16
Suva_14.153.12ON3302371964e-16
NCAS0C029208.389ON3741231904e-15
NDAI0J010008.286ON3391261894e-15
TDEL0F041308.286ON3281521885e-15
ZYRO0C03410g3.12ON3272401877e-15
KLLA0E02069g3.12ON3251061878e-15
SAKL0H13860g8.389ON3521931842e-14
Ecym_20143.12ON339511833e-14
KLTH0G13112g8.286ON3491541823e-14
NCAS0B035908.286ON329701815e-14
Skud_12.3218.389ON3561241807e-14
TPHA0C023608.389ON404741808e-14
TDEL0F051308.389ON359891781e-13
ZYRO0C04092g8.389ON366801782e-13
KAFR0B053708.286ON3291251743e-13
ZYRO0D06600g8.286ON3301271726e-13
Smik_12.3068.389ON359611719e-13
SAKL0H16434g8.286ON555811739e-13
TPHA0C010708.286ON333681719e-13
TBLA0D040408.286ON329701701e-12
Suva_10.3428.389ON3561241701e-12
Ecym_41788.389ON3681281702e-12
KAFR0H019808.389ON361771682e-12
YLR246W (ERF2)8.389ON359611683e-12
KLLA0D18370g8.389ON3551231673e-12
ADL197C3.12ON390751683e-12
Skud_4.3878.286ON336651655e-12
KLTH0F08668g8.389ON3581241647e-12
NDAI0G022508.389ON3891241631e-11
CAGL0B01991g8.286ON330631621e-11
KLLA0F19690g8.286ON3241021602e-11
Ecym_42828.286ON3401451602e-11
KNAG0A027108.389ON354611575e-11
TBLA0H009208.389ON360611577e-11
YDR126W (SWF1)8.286ON336621568e-11
AGL125C8.389ON3671331551e-10
Kpol_1033.168.286ON321661541e-10
Suva_2.2898.286ON335621532e-10
CAGL0G08217g8.389ON326611532e-10
Smik_4.3728.286ON335491532e-10
KNAG0H031108.286ON3311081504e-10
Kwal_23.33028.389ON353501504e-10
Kwal_56.236978.286ON338661408e-09
AGR065W8.286ON326471399e-09
KAFR0I011105.579ON3701401329e-08
Ecym_41145.579ON3721161311e-07
TDEL0A044405.579ON3651231311e-07
NCAS0F013905.579ON374931301e-07
ZYRO0D13860g5.579ON3652081292e-07
Kpol_1004.575.579ON3622191274e-07
TBLA0E028305.579ON3861401265e-07
KNAG0C028305.579ON354781231e-06
SAKL0G06160g5.579ON364721231e-06
Kwal_47.183665.579ON356861193e-06
KLTH0G04972g5.579ON367791168e-06
Skud_4.7345.579ON380721168e-06
TPHA0C003705.626ON7591341151e-05
Smik_4.7375.579ON3781411142e-05
KLLA0D06149g5.579ON349771113e-05
YDR459C (PFA5)5.579ON374691114e-05
Suva_2.6345.579ON388681071e-04
NDAI0H018905.579ON406721061e-04
Skud_4.5275.626ON7641501052e-04
Kpol_526.325.626ON7771151053e-04
Suva_2.4325.626ON7631331043e-04
ZYRO0C11132g5.626ON7591151043e-04
CAGL0K06347g5.579ON3521461024e-04
ABR203W5.579ON359721007e-04
YDR264C (AKR1)5.626ON7641331017e-04
Suva_8.875.626ON7301581009e-04
KAFR0H005705.626ON757134980.002
Smik_4.5155.626ON764132980.002
TDEL0A049205.626ON750136970.002
NCAS0C052805.626ON757123960.003
NDAI0H008505.626ON78644960.003
KNAG0B031405.626ON682224930.008
Ecym_13305.626ON739132930.008
CAGL0M08712g5.626ON76344910.011
KLTH0E02420g5.626ON73452900.015
KNAG0C062305.626ON752123900.017
YOR034C (AKR2)5.626ON74951850.061
TBLA0J008305.626ON739107850.072
AER388C5.626ON72439840.079
Smik_15.2135.626ON744209840.082
CAGL0K07590g2.440ON125286800.30
SAKL0G07326g5.626ON737135790.37
NDAI0B007905.36ON22338740.90
Ecym_51881.204ON42398741.1
Skud_15.1995.626ON74151722.4
SAKL0G17908g4.344ON80962695.2
KLLA0E16721g5.626ON75246686.6
TPHA0N018602.664ON373122669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C02650
         (389 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     801   0.0  
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   528   0.0  
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   463   e-163
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   461   e-162
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   457   e-160
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   453   e-159
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   451   e-158
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   440   e-153
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   437   e-153
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   437   e-152
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   436   e-152
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   431   e-150
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   429   e-149
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   414   e-144
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   407   e-141
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   400   e-138
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   397   e-137
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   393   e-135
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   392   e-135
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   209   1e-63
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    90   3e-19
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      89   5e-19
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    89   6e-19
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    86   5e-18
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    85   8e-18
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    85   1e-17
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    84   2e-17
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    85   2e-17
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    84   2e-17
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    84   4e-17
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    81   2e-16
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    81   2e-16
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    81   2e-16
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    80   4e-16
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    80   4e-16
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    80   4e-16
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     78   4e-15
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    77   4e-15
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    77   5e-15
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    77   7e-15
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    77   8e-15
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    75   2e-14
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    75   3e-14
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    75   3e-14
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      74   5e-14
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    74   7e-14
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    74   8e-14
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    73   1e-13
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    73   2e-13
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    72   3e-13
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    71   6e-13
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    70   9e-13
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    71   9e-13
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    70   9e-13
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    70   1e-12
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    70   1e-12
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    70   2e-12
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    69   2e-12
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    69   3e-12
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    69   3e-12
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    69   3e-12
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    68   5e-12
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    68   7e-12
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     67   1e-11
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    67   1e-11
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    66   2e-11
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    66   2e-11
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    65   5e-11
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    65   7e-11
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    65   8e-11
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    64   1e-10
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    64   1e-10
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    64   2e-10
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    64   2e-10
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    64   2e-10
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    62   4e-10
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    62   4e-10
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    59   8e-09
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    58   9e-09
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    55   9e-08
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    55   1e-07
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    55   1e-07
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    55   1e-07
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    54   2e-07
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    54   4e-07
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    53   5e-07
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    52   1e-06
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    52   1e-06
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    50   3e-06
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    49   8e-06
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    49   8e-06
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    49   1e-05
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    49   2e-05
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    47   3e-05
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    47   4e-05
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    46   1e-04
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    45   1e-04
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    45   2e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    45   3e-04
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    45   3e-04
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    45   3e-04
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    44   4e-04
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    43   7e-04
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    44   7e-04
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    43   9e-04
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    42   0.002
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    42   0.002
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    42   0.002
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    42   0.003
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    42   0.003
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    40   0.008
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    40   0.008
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    40   0.011
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    39   0.015
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    39   0.017
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    37   0.061
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    37   0.072
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    37   0.079
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    37   0.082
CAGL0K07590g Chr11 (749181..752939) [3759 bp, 1252 aa] {ON} high...    35   0.30 
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    35   0.37 
NDAI0B00790 Chr2 (184290..184961) [672 bp, 223 aa] {ON} Anc_5.36       33   0.90 
Ecym_5188 Chr5 (394647..395918) [1272 bp, 423 aa] {ON} similar t...    33   1.1  
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    32   2.4  
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    31   5.2  
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    31   6.6  
TPHA0N01860 Chr14 complement(395074..396195) [1122 bp, 373 aa] {...    30   9.6  

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/389 (100%), Positives = 389/389 (100%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
           ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFISNKDTSVESLVYDGEQVVRNRASNDTNISTI 360
           EISLYEPGSSVEDLLLSLPWPPDKGRNFISNKDTSVESLVYDGEQVVRNRASNDTNISTI
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFISNKDTSVESLVYDGEQVVRNRASNDTNISTI 360

Query: 361 NKDISREEWNNDWGESLVDFGVDIEAEVE 389
           NKDISREEWNNDWGESLVDFGVDIEAEVE
Sbjct: 361 NKDISREEWNNDWGESLVDFGVDIEAEVE 389

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/387 (61%), Positives = 304/387 (78%), Gaps = 11/387 (2%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M +KLKYPW+GV IP  + SFIGY++H F+L+NF+S K Q+WFQ SL+M+W+SY LAIFT
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPG+P K+ KP+    +++W   CKKC  +KPER+HHCKTCNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGRPAKSFKPL----KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           +KNFPHF+RFL W+++TTGFLL  LLKRT+ +W ++ LPSY+F++ EI FL ILIPMD F
Sbjct: 117 FKNFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           +L+T++LLFIRC +NQI+ G TQIE WELERLENL+Y KKLLP ++  LWE+YPNE+T  
Sbjct: 177 VLITVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPE 236

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
               A  L  R +KVRFENIV FPYD+DIW+N  TV+GS   W+W+FG PD +G+ F+KN
Sbjct: 237 NKVLAKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKN 296

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFISNKDTSVESLVYDGEQVVRNRASNDTNISTI 360
           E++LYE G+++EDLLLSLPWPPD GRNFI  K T+VES+  +GEQV+R R          
Sbjct: 297 ELALYEEGAAIEDLLLSLPWPPDGGRNFIQQKGTNVESITENGEQVIRQRNFE------- 349

Query: 361 NKDISREEWNNDWGESLVDFGVDIEAE 387
           N +  R+ WNNDWGE+L DFGVD++ E
Sbjct: 350 NDNSYRKTWNNDWGENLEDFGVDVDVE 376

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  463 bits (1191), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 221/391 (56%), Positives = 289/391 (73%), Gaps = 17/391 (4%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M +KLKYPW+G+AIP F+ISFI Y +HYFIL NFLSI KQIWF+ S++MIW+SY LAI+T
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPGKP  N  P       +W  +CKKCN YKPER+HHCKTC QCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGKPGSNYIP----PSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           YKNFPHF+RFL W+I+TT +LL  L+ R + +W  R+LPSY+F+++EIIFLTI  PMD F
Sbjct: 117 YKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           +LLTISLLFIRC  NQ++ G TQIE WE ERLE+LFY ++L P +I+ LWE +P  +T  
Sbjct: 177 VLLTISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPD 236

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
            +  A+ ++S+R  +RF+ +V+FPYD+ +  N+ TV+GS   W+W +G P  +G+ F+KN
Sbjct: 237 NEAKAEKIVSKR--IRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKN 294

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGR---NFISNKDTSVESLVYDGEQVVRNRASNDTNI 357
           E SL+E  S +ED +LSLPWPPD G+   N  ++   S+E+   DGE V+R R       
Sbjct: 295 EYSLFEEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKR------- 347

Query: 358 STINKDI-SREEWNNDWGESLVDFGVDIEAE 387
           S ++K + SR +W NDWGE+L DFGVDI+ E
Sbjct: 348 SPVSKLLESRTQWYNDWGENLEDFGVDIDVE 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  461 bits (1186), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 209/389 (53%), Positives = 287/389 (73%), Gaps = 13/389 (3%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M +KLK+PWLG+AIP  ++SFIGY  H+FILSNFLS  KQ+WFQ +L++IW+SY  AI+T
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPG+P  N +   +    +W  +CKKC NYKPER+HHCKTCNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGRPRPNFEVPKY----EWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           + NFPHF+RFL+W+I+ T FLL  L+ R + +W  R+LP Y+F R+E++FLTIL P+DAF
Sbjct: 117 HNNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           +LLTI++L  RC  NQI  GM+QIE WELERL+ LF +K+L+P++I   W+++P  R ++
Sbjct: 177 VLLTITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQI 236

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
            ++ A + LS  K++R E++VNFPYD+D W+N   ++G+   W+W FG P  +G+ F KN
Sbjct: 237 NESTAAE-LSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKN 295

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFI--SNKDTSVESLVYDGEQVVRNRASNDTNIS 358
           EIS Y   +S EDLLLSLPWPPD GR      +  +S+ES+   GEQ++R R ++ +++ 
Sbjct: 296 EISEYSSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDL- 354

Query: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387
                I R +W NDWGE+L DFGVD++ E
Sbjct: 355 -----IGRRQWQNDWGENLEDFGVDVDTE 378

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  457 bits (1176), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 214/389 (55%), Positives = 286/389 (73%), Gaps = 13/389 (3%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           MA+KLK+PWLG+AIP+F+ISFIGY +HYFILSNFLS+ KQI F+ SLSMIWVSY LAI+T
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPGKP    +P    +   W  +CKKC NYKPERSHHCK CNQCVLMMDHHCPWTMNCVG
Sbjct: 81  NPGKPSPTYQP----NPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVG 136

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           +KN+PHF+RF+ W+I TTGFL    LKR   +W  RHLP Y+F ++E++FLTIL P++ F
Sbjct: 137 FKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFF 196

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           +LLTI +LF+RC  NQI+ G +QIE W+++RLE+LF +++L+  +I   W +YP  R+  
Sbjct: 197 VLLTIVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQ 256

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
            +  A+ LL++  K+RFE +VNFPY+ID++TN    +G    W+W  G P  +G  F+KN
Sbjct: 257 LERDAEKLLTQH-KIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKN 315

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKG--RNFISNKDTSVESLVYDGEQVVRNRASNDTNIS 358
           +IS YE  SS+ED++LSLPWPPD G  +   ++ + ++E+    GEQVVR+R      I+
Sbjct: 316 DISKYEVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSR------IA 369

Query: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387
              +  +RE+W NDWGESL DFGVD++ E
Sbjct: 370 QHGRSATREKWYNDWGESLDDFGVDVDME 398

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  453 bits (1166), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 290/389 (74%), Gaps = 14/389 (3%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M ++LK+P+LG+AIP F+ISFIGYN+HYFILSNFLS +KQIWF+FSL+MIW SY LAI+T
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
            PG+P  N +P     +  W ++CKKC NYKPER+HHCKTCNQCVL MDHHCPWT NCVG
Sbjct: 61  LPGQPLPNFQP----SKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           Y NFPHF+RFL W+I TTG+LL  L  R   + +  + P+Y+++++E+IFLTILIPMD F
Sbjct: 117 YYNFPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           ILLTIS+LFIRC +NQI  G TQIE WE ERLE L+Y+K+LLP ++A  WE+YP  RT+ 
Sbjct: 177 ILLTISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRE 236

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
            ++ A   LS R+++  +++VNFPYDID W+N    +GS   W+W FG P  +G+ F KN
Sbjct: 237 LEDEASR-LSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKN 295

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFISNKD--TSVESLVYDGEQVVRNRASNDTNIS 358
           +IS +E  +++ D+LL+LPWPPD G++ + + D   +VE+ V DGEQV+R R  +  + S
Sbjct: 296 DISEFE-ETNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPS 354

Query: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387
                 SR +W N WGE+L DFGVD++AE
Sbjct: 355 ------SRTQWQNTWGENLEDFGVDVDAE 377

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  451 bits (1159), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 226/390 (57%), Positives = 290/390 (74%), Gaps = 14/390 (3%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M +K K+PW+G+AIP  +ISFIGY SHY+IL   LS+ KQ +F+FSL+MIWVSY +AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPGKP KN KP+      +W   CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNC+G
Sbjct: 61  NPGKPGKNFKPLP----HEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           + NFPHF+RFL+WI+ TTGFLL + +KR + MWN R+LPSY+F+R+E+I L +  P++ F
Sbjct: 117 FNNFPHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           ILLTI+LLF RC  NQI+ G TQIE WE++RLEN FY KKLLP +I  LWE+YP  ++  
Sbjct: 177 ILLTITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAK 236

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
            D  A+ L+  +K +R+++IVNFPYD+ I+ N+  ++G    W+W FG P  NG+ FEKN
Sbjct: 237 HDEEAERLIE-KKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKN 295

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFIS---NKDTSVESLVYDGEQVVRNRASNDTNI 357
           EI+L++P SS+    L+LPWPPDKGR+  S   N D++VE +  DGEQVVRNR      I
Sbjct: 296 EIALFDPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPI 355

Query: 358 STINKDISREEWNNDWGESLVDFGVDIEAE 387
                 +SREEW N+WGE+L DFGVD+E E
Sbjct: 356 ------LSREEWFNEWGENLEDFGVDVEME 379

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  440 bits (1131), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/389 (52%), Positives = 279/389 (71%), Gaps = 12/389 (3%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           MA+KLK+PWLG+AIP+F+ISFIGY +HYFILSNFLSI KQ+ F+ SLSMIWVSY LAI+T
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           N G+P  N +P        W   CKKC +YKPERSHHCK CNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NAGRPLPNYRPSPL----IWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           ++N+PHF+RFL W+I+TT  L    +KR   +W  R LP Y+F+++E+IFLTIL P+D F
Sbjct: 117 FRNYPHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           +LLTI++LF+RC +NQI+ G +QIE W+++RLE+L  + KL+P +I   W +YP  R+  
Sbjct: 177 VLLTIAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQ 236

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
            +  AD LL++R + RF+ +V+FPY+ +  TN    +G    W+W +G P  +G  F KN
Sbjct: 237 HERDADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKN 296

Query: 301 EISLYEPGSSVEDLLLSLPWPPD--KGRNFISNKDTSVESLVYDGEQVVRNRASNDTNIS 358
           +IS YE  S +ED++LSLPWPPD  K +   ++ ++++E+    GEQ+VR+R +      
Sbjct: 297 DISQYEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQH---- 352

Query: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387
               D  RE+W NDWGESL DFGVD++ E
Sbjct: 353 --GSDAIREKWYNDWGESLDDFGVDVDME 379

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  437 bits (1125), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 208/388 (53%), Positives = 277/388 (71%), Gaps = 13/388 (3%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M +KLK+PWLG+AIP F+I+FIGY++  F+L  FLS+K+QIWFQFSL+MIW+SY  AI+T
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPG P    +P+    + +W  +CKKC N+KPER+HHCKTC QCVL+MDHHCP+TMNCVG
Sbjct: 61  NPGSPVPGFQPL----KHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           Y NFPHF+RFL WII TT +L +   KRT  +WN+RH  + +  + EIIFLTIL P +AF
Sbjct: 117 YNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           +LLTIS+LF RC  NQ++ GMTQIE WE++R+E++FYN++L+P +++ L E+YPN     
Sbjct: 177 VLLTISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDG- 235

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
                D +L+ R K+ FE++VNFPYD D W N+   MG    W+  FG P+ NG+ FEKN
Sbjct: 236 HKGEIDRILNNR-KISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKN 294

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNF-ISNKDTSVESLVYDGEQVVRNRASNDTNIST 359
           E+S YE GS++ D LLSLPWPPD  R    SN    VES   +GE ++R R+        
Sbjct: 295 ELSAYEHGSTLTDKLLSLPWPPDGERAPNSSNSRLKVESSTRNGEHIIRKRSPEP----- 349

Query: 360 INKDISREEWNNDWGESLVDFGVDIEAE 387
              ++SR EW NDWGE+L  FGVD++A+
Sbjct: 350 -RLNLSRTEWYNDWGENLAHFGVDVDAD 376

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  437 bits (1123), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 278/389 (71%), Gaps = 13/389 (3%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           MA+KL++PWLG+AIP+ +ISFIGY +HYFILSNFL I KQI F+FSLSMIW SY LAI+T
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPG+P  N +P        W   CKKC NYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGRPLPNYQPTP----GIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           + N+PHF+RFL WIIITT  L    +KR   +W  R+ P Y+F ++E+ FLTIL P++ F
Sbjct: 117 FGNYPHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           +LLTI++LF+RC  NQIV G +QIE W+++RLE+LF +++L+  +I   W +YP  +T  
Sbjct: 177 VLLTITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQ 236

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
            +  A+ LL ++++  FE +VNFPY+ D+ TN    +G    W+W +G+P  NG  F KN
Sbjct: 237 HERDAEGLL-KQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKN 295

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGR-NFISNKDTS-VESLVYDGEQVVRNRASNDTNIS 358
           +IS YE  S +ED++LSLPWPPD G    +SN  TS +E+    GEQVVR+R + +    
Sbjct: 296 DISNYEVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQN---- 351

Query: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387
              +  SRE+W NDWGESL DFGVD++ E
Sbjct: 352 --GRSASREKWFNDWGESLDDFGVDVDME 378

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  436 bits (1122), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 218/393 (55%), Positives = 283/393 (72%), Gaps = 20/393 (5%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           MA+KLK+PWLG+AIP F+ISFIGY +HYFILSNFL  KKQ+WF+FSL MIW+SY LAI+T
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPGKP    +P  F    +W   C KCNNYKPER+HHCK CNQCVL MDHHCPWTMNCVG
Sbjct: 61  NPGKPTPGFRPSKF----EWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           ++NF HFIRFL W+I TT FLL +L+KR + +WN RH+P+Y   R+E+IFLTIL PMDAF
Sbjct: 117 HRNFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           +LLTISLL +RC  NQI++GMTQIE WE++R+EN+F++ +L+P ++  L E+ P   +  
Sbjct: 177 VLLTISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLS-- 234

Query: 241 ADNYADDL--LSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFE 298
             N  DD+  L  + ++  + IVNFPYD++ W N    +G  ++WI  +G    NG+ FE
Sbjct: 235 --NQDDDIRKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFE 292

Query: 299 KNEISLYEPGSSVEDLLLSLPWPPDKGRNFI----SNKDTSVESLVYDGEQVVRNRASND 354
           KNE+S+YEP   +ED LLSLPWPPD GR+ +    +N    VES   DGE+VVR R  + 
Sbjct: 293 KNELSVYEPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDP 352

Query: 355 TNISTINKDISREEWNNDWGESLVDFGVDIEAE 387
                    + R++W NDWGE+L DFGVD++ E
Sbjct: 353 RTT------MPRKKWYNDWGENLADFGVDLDEE 379

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  431 bits (1108), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 207/389 (53%), Positives = 273/389 (70%), Gaps = 13/389 (3%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M +KL++PWLG+AIP+F+ISFIGY +HYFILSNFLS+ KQI F+F LSMIW+SY LAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPG+P  N KP        W   CKKC +YKPERSHHCKTCNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGRPLPNYKP----PPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           + N+PHF+RFL WII+TT  L     KR   +W  RHLP Y F ++E+IFLTI  P+++F
Sbjct: 117 FANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           +LLTI++LF+RC  NQI+ G +QIE W+++RLE+LF + +L   +I   W +YP  R+  
Sbjct: 177 VLLTITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQ 236

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
               A++ L+ +K+ RF+ +VNFPYD D++TN    +G    W+W +GVP  +G  F KN
Sbjct: 237 NKKDAEEHLT-KKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKN 295

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGR--NFISNKDTSVESLVYDGEQVVRNRASNDTNIS 358
            IS YE  SS+ED +LSLPWPPD G+     ++  +++E     GEQ++R R   +    
Sbjct: 296 GISKYEANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQN---- 351

Query: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387
              +  SRE+W NDWGESL DFGVD++ E
Sbjct: 352 --GRHASREKWYNDWGESLDDFGVDVDME 378

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  429 bits (1103), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 208/389 (53%), Positives = 278/389 (71%), Gaps = 15/389 (3%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M +KLK+PWLG+AIPSF+I+ IGY +HYFIL NFLS++KQ+W+QF  +MIW+SY LAI+T
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
            PGKPP N KP     + +W  +CKKC  YKPERSHHCKTCNQCVLMMDHHCPWTMNCVG
Sbjct: 61  PPGKPPTNFKP----SKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           Y NFPHFIRFL W+I+ T  L + L  R  ++W  R  PSY++ ++E+IFLTIL P++AF
Sbjct: 117 YNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           ILLTIS+L IRC  NQI  G +QIE WE++RLE L    KLLP++I  +W ++PN R + 
Sbjct: 177 ILLTISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEH 236

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
            ++ A+ LL+ +K++  + +VNFPYD+  + N   ++G+   W++ F  P  +GL F+KN
Sbjct: 237 VESQAEALLN-KKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKN 295

Query: 301 EISLYEPGSSVEDLLLSLPWPPD--KGRNFISNKDTSVESLVYDGEQVVRNRASNDTNIS 358
           E S+ E  +S+ D++L LPWPPD  K  N  S   ++V+ +  +GEQV+R        I 
Sbjct: 296 EESMIEDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIR--------IR 347

Query: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387
           T  K +SR EW NDWGESL DFGVD++ E
Sbjct: 348 TPEKKLSRSEWLNDWGESLEDFGVDVDVE 376

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  414 bits (1065), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 197/391 (50%), Positives = 272/391 (69%), Gaps = 17/391 (4%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M ++LK+PWLG+A+PSF+I++IGY+SHYFIL NF S  +Q+WF+FSL++IWVSY  AIF 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPG+PP N +P       +W  +CKKC+NYKPER+HHCKTC QCVL MDHHCPWTMNCVG
Sbjct: 61  NPGRPPPNFEP----PIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           + NFPHF+RFL W+++TT +L + L +R    W  R+   ++   +E+ FL +  P++AF
Sbjct: 117 HNNFPHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAF 175

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           ILLT+SLL  RC  NQ + GMTQIE WE +R+ENLF+N++L+P +I  L E++P +    
Sbjct: 176 ILLTVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPED---T 232

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
            D  A   L   K++  E+I+NFPYD+DI  NM + MG  ++W    G P   G +F  N
Sbjct: 233 FDEGAAQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTN 292

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGR---NFISNKDTSVESLVYDGEQVVRNRASNDTNI 357
           ++S Y+  +S+ED LLSLPWPPD GR      ++  +++E+    GE  +RNR S D+ I
Sbjct: 293 DLSDYDIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNR-SFDSRI 351

Query: 358 STINKDISREEWNNDWGESLVDFGVDIEAEV 388
           S     + R EW+NDWGE+L DFGVD++AE 
Sbjct: 352 S-----VPRTEWHNDWGENLSDFGVDVDAET 377

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  407 bits (1046), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 199/389 (51%), Positives = 264/389 (67%), Gaps = 14/389 (3%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           MAIKLK  WLGVAIP+F+++ IGY SHYFILSNFLS  +QI++Q   +MIWVSY LAI+T
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPG PPK+ KP       +W+ +CKKC  YKPER+HHCKTCNQCVL MDHHCPWT+NCVG
Sbjct: 61  NPGIPPKDFKP----SAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           + NFPHF+RFL W+I +T +LL  L+ R   +W++RH   +    +EIIF+ I+ PMDAF
Sbjct: 117 HSNFPHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           +LLT+S L  RC  NQ + GMTQIE WE++R+++L Y  +LL  +I  L E  P E    
Sbjct: 177 VLLTVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRP-EILPA 235

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
             +  + LLS+R  V  E+  NFPYD++ WTN+N  MG  + W+W +  P   G  F KN
Sbjct: 236 KQHEINKLLSKR-YVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKN 294

Query: 301 EISLYEPGSSVEDLLLSLPWPPD--KGRNFISNKDTSVESLVYDGEQVVRNRASNDTNIS 358
           E+  Y+P SS+ED+L+SLPWPPD     +      +S+E++V  GEQV+R+++ +     
Sbjct: 295 ELFFYDPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVD----- 349

Query: 359 TINKDISREEWNNDWGESLVDFGVDIEAE 387
            +   + R  W NDWGE L DFGVD E E
Sbjct: 350 -LRDRLGRNSWYNDWGEDLSDFGVDTELE 377

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  400 bits (1029), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 199/388 (51%), Positives = 261/388 (67%), Gaps = 14/388 (3%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           MA+ +K+PWLGVAIP F+ISF GY +H+F+L+NFLS K+ +WFQ SLSMIW+SY  AI+ 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPG+P K  +P+ +    +W  +C KC  YKPER+HHCK CNQCVL+MDHHCPWTMNC+G
Sbjct: 61  NPGRPTKGFRPLRY----EWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
            +          WII TTG LL + +KR    W  R+  + +  + E+IFLTIL P+DAF
Sbjct: 117 LQYLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAF 176

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           ILLTISLLF+RC  NQIV G TQIE WE++R+ENLFY+++LLP ++  L E+YP    + 
Sbjct: 177 ILLTISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGS-LEG 235

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
            +   ++ LS      F+ ++NFPYDI+ W N+   MGS  NW+  FG P  +G+ F+KN
Sbjct: 236 QEKEVEEFLS-SSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKN 294

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFISNKDTS-VESLVYDGEQVVRNRASNDTNIST 359
           EIS Y+  +S++D LL+LPWPPD  R+ I+    S VE     GEQVVR R      I+ 
Sbjct: 295 EISDYDEATSIQDKLLALPWPPDDTRHGIAFPSVSHVEKDTQGGEQVVRRR---HVPIAV 351

Query: 360 INKDISREEWNNDWGESLVDFGVDIEAE 387
                 R EW NDWGESL  FGVD+E E
Sbjct: 352 ----PPRNEWYNDWGESLEHFGVDVEVE 375

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  397 bits (1019), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 201/391 (51%), Positives = 263/391 (67%), Gaps = 17/391 (4%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M +KLK+PWLG+AIPS +I+FIGY SHYFIL NFLS+ +Q+WFQ  LSMIW+SY LAIFT
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPGKPP   +P+      +W   C+KC  YKPER+HHCKTC+QCVL+MDHHCPWTMNCVG
Sbjct: 61  NPGKPPTGFQPLP----HQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVG 116

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           + NFPHF+RFL+W+IITT +L   L KR    W LRH   Y+  + E++F+ I  P++AF
Sbjct: 117 HNNFPHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAF 175

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240
           + LTI LL +RC  NQ + GMTQIE WE ER+EN F N +L+P ++  L E+Y ++    
Sbjct: 176 VWLTIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNS 235

Query: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300
            +  A  L++ R  ++ E IVNFPYD++I  N    +G+    I  +  P  NGLKF KN
Sbjct: 236 PN--AKKLINAR-DLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKN 292

Query: 301 EISLYEPGSSVEDLLLSLPWPPDKGRN---FISNKDTSVESLVYDGEQVVRNRASNDTNI 357
           ++S Y+   ++ED LLSLPWPPD GR      S   + +E     GE V+R R   D  I
Sbjct: 293 DLSSYDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRL-RDPRI 351

Query: 358 STINKDISREEWNNDWGESLVDFGVDIEAEV 388
                ++ R EW NDWGE+L DFGVD+E+E 
Sbjct: 352 -----NMQRTEWYNDWGENLSDFGVDVESET 377

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  393 bits (1010), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 212/400 (53%), Positives = 275/400 (68%), Gaps = 17/400 (4%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           MAI+LK+PWLG+AIP+F+ISFIGY++HYFIL + LS K Q+WFQFSLSMIW+SY LAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           +PG P    K  D    R   T+CKKC+ YKP R+HHCKTCN+C+LMMDHHCPWTMNCVG
Sbjct: 61  DPGSPSIADKNEDIKTIR---TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVG 117

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180
           +KN+PHF+RFL W+I+TT FLL  L +R   +W   +  S +  R EI+ LTIL PMDAF
Sbjct: 118 FKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAF 177

Query: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKK-----LLPMIIATLWEVYPN 235
           ILLTI+LL IRC  NQI  GM+QIE WE+ERLE+ FY++K      L ++I  ++ ++  
Sbjct: 178 ILLTITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSI 237

Query: 236 ERTKVADNYADDLLSRRKKVR--FENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRN 293
           E  +      + LL +  K R  F +I+NFPYDIDI TN   V+G  F+W+  FG P+ +
Sbjct: 238 ESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGD 297

Query: 294 GLKFEKNEISLYEPGSSVEDLLLSLPWPPD----KGRNFISNKDTSVESLVYDGEQVVRN 349
           G+ FE NEI+  E  S++ DLLLSLPWPPD    K    I      VE+ +  GE V+RN
Sbjct: 298 GMHFELNEIA-SEKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRN 356

Query: 350 RA-SNDTNISTINKD-ISREEWNNDWGESLVDFGVDIEAE 387
           R  S   ++ T N++ +SR+ W N+WGE+L  FGVDIE E
Sbjct: 357 RTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  392 bits (1007), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 259/393 (65%), Gaps = 21/393 (5%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M ++LK PW G+AIP  +I FIGY +H+FIL N LS K+QI FQF L+MIW+SY +AI+T
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120
           NPGKPP        +     N +C KCN +KPERSHHCKTC QCVLMMDHHCPWTMNC+G
Sbjct: 61  NPGKPPHGSA--QQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLG 118

Query: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLP----SYIFDRNEIIFLTILIP 176
           + NFP F+RFL+W+IITT  L  +LL R   +W  R++P           E++ L +L P
Sbjct: 119 FGNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTP 178

Query: 177 MDAFILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNE 236
           MD F+L TI+ LF+RC  NQ++ GMTQIE WE+ERL+N+FY+KKLLP++I  +WE +P+E
Sbjct: 179 MDLFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHE 238

Query: 237 RTKVADNYADDLLSRRKK--VRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNG 294
           +T   +  A+ LL   ++  ++F ++VNFPYD+D+ TN++  +GS    +W F     NG
Sbjct: 239 QTPEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNG 298

Query: 295 LKFEKNEISLYEPGSSVEDLLLSLPWPPDKGRNF--ISNKDTS--VESLVYDGEQVVRNR 350
           + F+KN+IS YE   S+ DLLL L WPPD GR       +D +  ++  V DGE ++R R
Sbjct: 299 VTFQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR 358

Query: 351 ASNDTNISTINKDISREEWNNDWGESLVDFGVD 383
            S            SR  W N WGE+L  FGVD
Sbjct: 359 NSPIE---------SRTTWENQWGETLEGFGVD 382

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  209 bits (532), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 146/409 (35%), Positives = 209/409 (51%), Gaps = 57/409 (13%)

Query: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60
           M I+   PW GVAIPS II  +   S++ IL + L+  + IW+  +  MI  SY LAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGKPPKNCKPI-------DFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCP 113
            P   P             + ND     T  K      P R+HHCKTCN CV+MMDHHCP
Sbjct: 61  PPTPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLP-RAHHCKTCNTCVVMMDHHCP 119

Query: 114 WTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFD--RNEIIFL 171
           WTMNCVGY N+PHFIRFL W+II+T  LL  L+K+   ++  R+ P +++   + +II L
Sbjct: 120 WTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKIIIL 179

Query: 172 TILIPMDAFILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLW- 230
           T+LIP   F+ LT+ LL ++   NQI  GMTQIE+W+ E +EN ++  K   + +     
Sbjct: 180 TLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVALQLQLL 239

Query: 231 ---------EVYPNERTKVADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGS-- 279
                    ++  +  TK+    +      R    F +I+NFPYD+ +  N+ T MGS  
Sbjct: 240 ENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLN 299

Query: 280 AFNWIWIFGVPDRNGLKFEKNEISLY---EPGSSVEDLLLSLPWPPDKGRNFISNKDTSV 336
             +W   +  P       + NE +++   E   +++D+LL LPWP +   N         
Sbjct: 300 PLSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKDMLLCLPWPLNYSNN--------- 349

Query: 337 ESLVYDGEQVVRNRASNDTNISTINKDISREEWNNDWGESLVDFGVDIE 385
            S   DGE VV+                     +ND+GE+L DFGVD +
Sbjct: 350 -STFQDGELVVK---------------------SNDYGETLQDFGVDYD 376

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 79/149 (53%), Gaps = 8/149 (5%)

Query: 65  PPKNCKPIDFNDQRKWNTH-CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKN 123
           PP+      +  +R      CK C+++KP+R HHC TCN CVL MDHHCPW   CVGY+N
Sbjct: 86  PPEMLVKRSYTQKRNGRFRVCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRN 145

Query: 124 FPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILL 183
              FI+FL++  + +  +L+ L    +  W         F   E+I  T+L      +++
Sbjct: 146 QKFFIQFLIYCTVYSILVLI-LSSMEIYTWFKGE-----FFEVELINFTLLSLWLLALVV 199

Query: 184 TISLLFIRCFN-NQIVRGMTQIEFWELER 211
           +IS+     F+ +Q+ +  T IE + L R
Sbjct: 200 SISITIFTVFSISQVCQNQTTIELYSLRR 228

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 75/134 (55%), Gaps = 7/134 (5%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C  +KP+R HHC TCN+C+L MDHHCPW   C+G+KN   FI+FL++  I   F+ +
Sbjct: 109 CQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTI-YAFVAL 167

Query: 144 HLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFN-NQIVRGMT 202
            L+      W      +Y+   NE I  T+LI      +++IS+L    F+  Q+++  T
Sbjct: 168 GLISYQFVNWYKNQ--NYM---NEYIDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNRT 222

Query: 203 QIEFWELERLENLF 216
            IE + + R    F
Sbjct: 223 TIEMYGIRRYNRDF 236

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 88.6 bits (218), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 77/129 (59%), Gaps = 7/129 (5%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C  +KP+R HHC TC++C+L MDHHCPW   C+G++N  +F++FL++    T + +V
Sbjct: 101 CQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIY---CTAYSIV 157

Query: 144 HLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFN-NQIVRGMT 202
            L     T   L +  S     +E+I L +L      I++T+SL+F   F+  Q+++  T
Sbjct: 158 VLF---FTSCELHYWFSGKQYEDELIDLMLLTVWILAIVITVSLIFFSSFSIYQLLKNQT 214

Query: 203 QIEFWELER 211
            IE + ++R
Sbjct: 215 TIEMYGMKR 223

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 85.9 bits (211), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 73/135 (54%), Gaps = 13/135 (9%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ CN +KP+RSHHC TCN+CVL MDHHCPW   C+G+KN   FI+FL++    T +  V
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIY---NTTYAYV 166

Query: 144 HLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNN----QIVR 199
             +  +  M+N     SY    NE + + +L     +IL  +  L + CF       ++ 
Sbjct: 167 IAILTSKQMYNWFDDGSY---ENEFVNMYLLF---LWILALVVSLALSCFAGFSVYMVMN 220

Query: 200 GMTQIEFWELERLEN 214
             T IE + + +  +
Sbjct: 221 NKTTIEMYAMRKYRD 235

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 85.1 bits (209), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 83/185 (44%), Gaps = 35/185 (18%)

Query: 53  SYLLAIFTNPGKP-------PKNCK--------PIDFNDQRKWNTH-------CKKCNNY 90
           +Y   I   PG P        +N K        P DF  QR +          C+ CN +
Sbjct: 53  TYYKVIIVGPGSPLDFGQLTVRNIKDAEDGIELPPDFLAQRSFTLKHDGRFRVCRTCNVW 112

Query: 91  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTM 150
           KP+R HHC  C++C+L MDHHCPW   CVG+KN  +F++FL++  +        +L  T 
Sbjct: 113 KPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTVYA------ILVMTY 166

Query: 151 TMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNN----QIVRGMTQIEF 206
           T + +           EII + +L+    +IL     L + CF      Q +   T IE 
Sbjct: 167 TSFQIYDWFKNELYETEIIKIRLLM---VWILSVAVFLTVTCFTGFSIYQTINNRTTIEM 223

Query: 207 WELER 211
           + L +
Sbjct: 224 YTLRK 228

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 72/129 (55%), Gaps = 7/129 (5%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C+ +KP+R HHC +C+ C+L MDHHCPW   C G++N   FI+FLM+  +    +L+
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTLYAFLVLI 165

Query: 144 HLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFN-NQIVRGMT 202
           +      T +N     S  F+R  I F  + + + A + + IS+L   CF+  Q+ +  T
Sbjct: 166 YTCYELGTWFN-----SGSFNRELIDFHLLGVALLA-VAVFISVLAFTCFSIYQVCKNQT 219

Query: 203 QIEFWELER 211
            IE   + R
Sbjct: 220 TIEVHGMRR 228

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 74/129 (57%), Gaps = 7/129 (5%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C  +KP+R HHC +CN+C+L MDHHCPW   C+G+KN  +FI+FL +    T + ++
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFY---CTSYSII 162

Query: 144 HLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNN-QIVRGMT 202
            L   ++ +++     SY ++  +   LT+ +     I++ ISL+    F+  Q++   T
Sbjct: 163 VLFVTSIQIYHWFRSTSYEYEFIDFKLLTVWLLA---IVIFISLVLFTGFSVFQLLGNQT 219

Query: 203 QIEFWELER 211
            IE +   R
Sbjct: 220 TIELYAYRR 228

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 74/128 (57%), Gaps = 11/128 (8%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF--L 141
           C+ C  +KP+R HHC  CN+C L MDHHCPW  +CVGY+N  +FI FL++   TT +  L
Sbjct: 133 CRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLY---TTAYSIL 189

Query: 142 LVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNNQIV-RG 200
           +  L    + MW      S  +++ E+I L +LI     +++TIS+L    +   +V + 
Sbjct: 190 VFFLTGADLLMW----FRSQGYNQ-ELINLPLLIVWILSLVITISMLAFTSYTIYLVAKN 244

Query: 201 MTQIEFWE 208
            T IE +E
Sbjct: 245 QTTIEMYE 252

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 100/236 (42%), Gaps = 38/236 (16%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C+ +KP+R HHC +C+ CVL MDHHCPW   C G+KN   FI+FLM+       +L+
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYTTCYAFLVLI 165

Query: 144 HLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNNQIVRGMTQ 203
           +      T +N     S  F+R  I F  + + + A  +    L F      Q+ +  T 
Sbjct: 166 YTCYELGTWFN-----SGSFNRELIDFQLLGVALLAVAVFITVLAFTVFSIYQVCKNQTT 220

Query: 204 IEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKVADNYADDLLSRRKKVRFENIVNF 263
           IE   + R                     Y  +   + D+Y  ++ S       EN+ + 
Sbjct: 221 IEVHGMRR---------------------YRRDLEIINDSYGTNVYS-------ENVFDL 252

Query: 264 PYDIDIWTNMNTVMGSA-FNWIWIFGVPDRNGLKFEKNEISLY-EPGSSVEDLLLS 317
              +  W +   +MGS+   W+           K  K+E  LY      V+D LLS
Sbjct: 253 GSSMANWQD---IMGSSWLEWLLPIETYKYKKSKHTKDEKGLYFNVRPEVQDRLLS 305

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 101/220 (45%), Gaps = 38/220 (17%)

Query: 24  YNSHYFILSNFLSIKKQIW--FQFSLSMIWVSYLL-------AIFTNPGKPPKNCK---- 70
           + +  ++ S F +I +  W  + F ++M+W  YL+       A    PG P    +    
Sbjct: 15  FTTFLYLWSFFTAIYQIKWINYTFMITMLWSLYLIGYYAYVQAFMVGPGSPSDFPELRVN 74

Query: 71  -----------PIDFNDQRKWNTH-------CKKCNNYKPERSHHCKTCNQCVLMMDHHC 112
                      P ++  Q+            C+ C  +KP+R HHC +C++C+L MDHHC
Sbjct: 75  SIEAAEAGTEFPPEYLSQKSITLKHDGRARVCRTCLVWKPDRCHHCSSCDRCILKMDHHC 134

Query: 113 PWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLT 172
           PW   C+G+KN  +FI FL++  +   F+    L  +  +WN      Y+    E+I + 
Sbjct: 135 PWFAECIGFKNHKYFINFLIYNSLYATFV---CLISSKELWNWFSQEKYV---TELINIH 188

Query: 173 ILIPMDAFILLTISLLFIRCFN-NQIVRGMTQIEFWELER 211
           +L+     ++ ++S+     ++  Q++   T IE +   R
Sbjct: 189 LLLLFIVSLITSVSMTLFTAYSIYQVLINRTTIELYAYRR 228

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 41/53 (77%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIII 136
           C+ C+ +KP+R HHC  CN+C+L MDHHCPW  +CVG++N  +FI+FLM+  +
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATL 160

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 76/132 (57%), Gaps = 7/132 (5%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C  +KP+R HHC +C++C+L MDHHCPW   CVG++N   FI+FL++   TT + + 
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLY---TTAYAIF 159

Query: 144 HLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFN-NQIVRGMT 202
            L   ++ ++   +   +   + E+I   +L      +++ I++     F+ +Q+++  T
Sbjct: 160 VLSMTSVQLYRWFYNDKF---QEELISGYLLFLWIFSLVVFIAMTLFSAFSVSQVLKNQT 216

Query: 203 QIEFWELERLEN 214
            IE + ++R  N
Sbjct: 217 TIEMYGVQRWRN 228

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 75/134 (55%), Gaps = 13/134 (9%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C  +KP+R HHC  C +C L MDHHCPW  +CVGY N  +F++FL++  + +  +L+
Sbjct: 106 CRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFS--ILI 163

Query: 144 HLLKRT-MTMW--NLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNNQIV-R 199
            LL  T + +W  N R+         E+I L +L+     + ++IS+L    +   ++ +
Sbjct: 164 FLLSGTELLLWFKNQRY-------NQEMIQLPLLVVWILSVAISISMLAFTSYTVYLITK 216

Query: 200 GMTQIEFWELERLE 213
             T IE +E   L+
Sbjct: 217 NQTTIEMYEWSNLK 230

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 7/66 (10%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMW-------III 136
           C+ C  +KP+RSHHC +CN+C L MDHHCPW  +C+G+KN   FI+FL++       + +
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTTWYAVFVFM 164

Query: 137 TTGFLL 142
           TTG  L
Sbjct: 165 TTGLQL 170

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 67/129 (51%), Gaps = 7/129 (5%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C+ +KP+R HHC +C+ C+L MDHHCPW   C G+KN   FI+FLM+       +L+
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYTTFYAFLVLI 165

Query: 144 HLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFN-NQIVRGMT 202
                  T +N     S  F R E+I L +L      I + IS+L    F+  Q+    T
Sbjct: 166 DTCYELGTWFN-----SGSFSR-ELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQT 219

Query: 203 QIEFWELER 211
            IE   + R
Sbjct: 220 TIELHSMRR 228

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 102/237 (43%), Gaps = 40/237 (16%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C+ +KP+R HHC +C+ C+L MDHHCPW   C G+KN   FI+FLM+       +L+
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTFYAFLVLI 165

Query: 144 HLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFN-NQIVRGMT 202
           +      T ++     S  F++  I F  + + + A I + IS+L    F+  Q+    T
Sbjct: 166 YSCYELGTWFH-----SGSFNQELIDFHLLGVALLA-IAIFISVLAFTAFSIYQVCNNQT 219

Query: 203 QIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKVADNYADDLLSRRKKVRFENIVN 262
            IE + + R                     Y  +   + D Y  D        + ENI +
Sbjct: 220 TIELYGMRR---------------------YRRDLEIINDTYGAD-------TQLENIFD 251

Query: 263 FPYDIDIWTNMNTVMG-SAFNWIWIFGVPDRNGLKFEKNEISLY-EPGSSVEDLLLS 317
               I  W ++   MG S   W+           K  K+E  LY +     +D LLS
Sbjct: 252 LGSSIANWQDL---MGMSWLEWLLPIETYKYKRSKHTKDEKGLYFDIRPEAQDRLLS 305

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 20/123 (16%)

Query: 41  IWFQFSLSMIWVSYLLAIFTNPGKPPKNCK----------PIDFNDQRKWNT-------- 82
           IWF +  ++   S++    ++PG  P+N            P ++ +Q    T        
Sbjct: 121 IWFYYIWAICLGSFIKTATSDPGVLPRNVHLGSVQRNFQIPQEYYNQITLPTFHTDCNIV 180

Query: 83  --HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
             +CK C  ++P RS HC  C  CVLM DHHC W  NCVG +N+ +F+ FL    +T+ F
Sbjct: 181 LKYCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIF 240

Query: 141 LLV 143
           L+V
Sbjct: 241 LIV 243

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 65/126 (51%), Gaps = 14/126 (11%)

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
           N  C+ C   KP RS HC+ CN C+L+ DHHC W  NC+G  N+ +F  FL+   IT  +
Sbjct: 136 NIECRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTY 195

Query: 141 LLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNNQIVR- 199
             +    R   M+   H PS    RN    LT+LI   +F ++     F++    Q+V+ 
Sbjct: 196 SFI----RLFLMYCQGHAPS---SRN---ILTLLILCGSFAVICAGFTFLQL---QLVKD 242

Query: 200 GMTQIE 205
           GMT  E
Sbjct: 243 GMTTNE 248

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 74/152 (48%), Gaps = 8/152 (5%)

Query: 51  WVSYLLAIFTNPGKPPKNCKPIDFNDQRKW-NTHCKKCNNYKPERSHHCKTCNQCVLMMD 109
           W+S  +   T+ G  P + +  D++    + N  C+ C+  KP RS HC  C +CVL+ D
Sbjct: 104 WLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVAD 163

Query: 110 HHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMW-NLRHLPSYIFDRNEI 168
           HHC W  NC+G  N+  F  FL+  +I+  +  + +L      W ++   PS +     I
Sbjct: 164 HHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVL------WISVMKDPSMVVYPRSI 217

Query: 169 IFLTILIPMDAFILLTISLLFIRCFNNQIVRG 200
           +  TIL    A I    + L ++  N+ +  G
Sbjct: 218 LIFTILCGTFAIICGVFTYLQLQLVNDGMTTG 249

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 109/240 (45%), Gaps = 44/240 (18%)

Query: 29  FILSNFLSIKK--QIWFQFSLS-------MIWVSYLLAIFTNPGKP-------------- 65
           ++ ++++S+ +  QIW++F +S       +   +Y   I T PG P              
Sbjct: 21  YLWTSYVSLTRINQIWYKFLVSVDVFLVAIGLYTYYKVIITGPGSPLDYDTIKVYDMQAV 80

Query: 66  -PKNCKPIDFNDQRKWNTH-------CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMN 117
                 P +F  +R   T        C+ C+ +KP+R HHC  C++C+L MDHHCPW   
Sbjct: 81  ESGAELPPEFLSRRSITTKRDGRFRVCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPG 140

Query: 118 CVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPM 177
           C+G+ N   FI++L++    T + +V  L  ++ + +  +   Y     E+I   +L   
Sbjct: 141 CIGFNNQRFFIQYLLY---ATTYSIVIFLFSSIQLLHWFNTKQY---EVELIDFHLLSVW 194

Query: 178 DAFILLTISLLFIRCFN-NQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNE 236
              + +++SL F   F+  Q+ +  T +E     R       ++ L ++  T   + PN 
Sbjct: 195 LLGVAVSVSLSFFTGFSIYQVTKNQTTVEMHIYRRY------REELEILADTCGSINPNR 248

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 60/106 (56%), Gaps = 2/106 (1%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C  +KP+R HHC  CN+C L MDHHCPW  +CVG++N   F++FL +  + + ++L+
Sbjct: 105 CQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVLL 164

Query: 144 HLLKRTMTMWNLRHLPSYIFDRNEII--FLTILIPMDAFILLTISL 187
               +  + +      S + D + ++   L+++  +  F   T ++
Sbjct: 165 MTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIATFAFTTYTI 210

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 87/193 (45%), Gaps = 27/193 (13%)

Query: 12  VAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFTNPGKPPKNCK- 70
           V IP  + S   + +H    S++      ++F +  ++ +VS++    T+PG  P+N   
Sbjct: 81  VTIPMVLFSI--FETHRLWYSDYGYKVLVVFFYYFWTLCFVSFIKTATTDPGVLPRNVHV 138

Query: 71  PIDFND----QRKWN----------------THCKKCNNYKPERSHHCKTCNQCVLMMDH 110
           P   ND    Q  +N                 +C  C  ++P R+ HC TC  C++  DH
Sbjct: 139 PSVENDYEIPQEYYNMITLPTGNPLIANIEVKYCTTCRIWRPPRASHCSTCEACIITHDH 198

Query: 111 HCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIF 170
           HC W  NC+G +N+ +F  FL+  +I T F++ +   R     + +  P  I     ++ 
Sbjct: 199 HCKWVNNCIGQRNYHYFFTFLVSCVIATAFIIANCAIRVSRSVHAKDAPVAIL----LLI 254

Query: 171 LTILIPMDAFILL 183
              L+    FILL
Sbjct: 255 YCGLVVCYPFILL 267

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 37/51 (72%)

Query: 83  HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMW 133
           +C  C  +KP+RSHHC +CN+C L  DHHCPW  +C+G+ N   F++FLM+
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMY 159

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 76/154 (49%), Gaps = 12/154 (7%)

Query: 6   KYPWLGVAIPSFIISFIGYNSHYF-------ILSNFLSIKKQIWFQFSLSMIWVSYLLAI 58
           ++ W   AIP+F +S   Y +  F       I S    +++ +    +LS   ++ LL I
Sbjct: 47  RFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTI 106

Query: 59  FTNPGKPPKNCKPIDFNDQRKWNT--HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTM 116
           +  P K       +D  D+  +++   C+ C   K  R+ HC  C+QCV + DHHC W  
Sbjct: 107 WIKP-KSTYASPMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWAN 165

Query: 117 NCVGYKNFPHFIRFLMWIIITT--GFLLVHLLKR 148
           NC+G  N+ +F  FL+  +  T  GFL +  L+R
Sbjct: 166 NCIGRGNYQYFYLFLVSNVFLTNYGFLRLLFLQR 199

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 4/70 (5%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C +YKP RS HC  C++CVL+ DHHC W  NCVG  N+ +F  FL    IT  F L 
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFL----ITNTFSLT 192

Query: 144 HLLKRTMTMW 153
           +   R +T++
Sbjct: 193 YAFIRLLTIF 202

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 64/124 (51%), Gaps = 21/124 (16%)

Query: 41  IWFQFSLSMIWVSYLLAIFTNPGKPPKNCK----------PIDFNDQRKWNTH------- 83
           I+F +  +++ +S++    ++PG  P+N            P ++ +     TH       
Sbjct: 111 IFFYYFWAIMLISFIRTATSDPGVLPRNIHLGQLQNNYQTPQEYYNLITLPTHSSVLEDI 170

Query: 84  ----CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTG 139
               C+ C  ++P R+ HC TCN CV++ DHHC W  NCVG +N+  F+ FL+  I ++ 
Sbjct: 171 TIKYCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSV 230

Query: 140 FLLV 143
           FLL 
Sbjct: 231 FLLT 234

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%)

Query: 71  PIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRF 130
           PI    Q    T+C+ C  ++P RS HC  C+ CV+ +DHHC W  NCVG +N+ +F+ F
Sbjct: 183 PIKDESQYVEITYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIF 242

Query: 131 LMWIIITTGFLLVH 144
           L   I+T  FLL++
Sbjct: 243 LTSTIMTVIFLLIN 256

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 8/89 (8%)

Query: 65  PPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNF 124
           P  N  P+   D R    +C  C  ++P R+ HC TC  CV+  DHHC W  NCVG +N+
Sbjct: 166 PKSNVDPLSKIDIR----YCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNY 221

Query: 125 PHFIRFLMWIIITTGFLL----VHLLKRT 149
            +FI FL+  ++   FL+    +H+ +R+
Sbjct: 222 RYFIIFLIGTVLAELFLIANCSIHIARRS 250

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 51/80 (63%), Gaps = 3/80 (3%)

Query: 83  HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLL 142
           +C  C  ++P R+ HC TC  C+L  DHHC W  NC+G +N+ +FI FL   I+++ FL+
Sbjct: 180 YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFLI 239

Query: 143 VHLLKRTMTMWNLRHLPSYI 162
            +    ++ +++ R+LPS +
Sbjct: 240 ANC---SIHIYHHRNLPSKV 256

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 61/125 (48%), Gaps = 12/125 (9%)

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
           NT C  C   KP RS HC  CN+CVL+ DHHC W  NC+G  N+ +F  FL+   +  G+
Sbjct: 134 NTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGY 193

Query: 141 LLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNNQIVRG 200
             + ++   +T ++    P+        I LT LI   AF    I L+F       +  G
Sbjct: 194 AFLRII--LLTAYSDIGFPN--------IVLTFLILSGAF--FAILLVFTYLQFALVYDG 241

Query: 201 MTQIE 205
           MT  E
Sbjct: 242 MTTNE 246

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 15/127 (11%)

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
           N +C+ C   KP RS HC  CNQCVL +DHHC W  NCVG  N+ +F  FL+   ++  +
Sbjct: 132 NINCRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLSMSY 191

Query: 141 LLVHLLKRTMTMWNLRHLPSYIFDRNEIIF--LTILIPMDAFILLTISLLFIRCFNNQIV 198
             +    R+M++  L+  P+  + R+ + F  LT    +   +   + L  +R       
Sbjct: 192 AFI----RSMSIVGLK--PNIKYPRSILAFNLLTGCFALICIVFTYLQLCMVR------- 238

Query: 199 RGMTQIE 205
            GMT  E
Sbjct: 239 EGMTTNE 245

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%)

Query: 83  HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLL 142
           +C+ C  ++P RS HC TCN CV++ DHHC W  NC+G +N+  F+ FL+  +I++  LL
Sbjct: 174 YCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIILL 233

Query: 143 V 143
            
Sbjct: 234 A 234

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMW--IIITT 138
            T C+ C+  KP RS HC  CN+C+LM+DHHC W  NC+G  N+ +F  FL+    +++ 
Sbjct: 129 GTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSY 188

Query: 139 GFLLVHLLKRTMTMWNLRHLP 159
            FL +  ++      N++  P
Sbjct: 189 SFLRLTSIQLMSQTENIKTKP 209

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C  CN  KP RS HC  C  C+L+ DHHC W  NC+G  N+ +F  FL+   I+  +  +
Sbjct: 139 CSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFL 198

Query: 144 HLLKRTMT 151
            LL  T++
Sbjct: 199 RLLHITLS 206

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 41/70 (58%)

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
           +T CK C   KP RS HC  C+QC+L+ DHHC W  NC+G  NF +F  FL    +   +
Sbjct: 134 DTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLFDNTLFMSY 193

Query: 141 LLVHLLKRTM 150
             + LL+ T+
Sbjct: 194 ASMRLLEITL 203

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 21/124 (16%)

Query: 41  IWFQFSLSMIWVSYLLAIFTNPGKPPKNCK----------PIDFNDQRKWNTH------- 83
           I+F +   + +++++    ++PG  P+N            P ++ +     TH       
Sbjct: 111 IFFYYFWVVTFIAFIRTATSDPGVLPRNIHLGQLQNNYQIPQEYYNLITLPTHPSVHNDI 170

Query: 84  ----CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTG 139
               C  C  ++P RS HC TCN CV++ DHHC W  NC+G +N+  F+ FL+  I ++ 
Sbjct: 171 TIKYCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSI 230

Query: 140 FLLV 143
            LLV
Sbjct: 231 LLLV 234

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 61/128 (47%), Gaps = 20/128 (15%)

Query: 41  IWFQFSLSMIWVSYLLAIFTNPGKPPKNCK--------------------PIDFNDQRKW 80
           I F +S ++ ++S++    T+PG  P+N                      P    +    
Sbjct: 126 ILFYYSWTLCFLSFIKTATTDPGTLPRNIHLPQLRNDYELPSEYYSIITLPSSSTNSPIQ 185

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
             +C  C  ++P R+ HC TCN C++  DHHC W  NCVG +N+ +F+ F+   ++T   
Sbjct: 186 LKYCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLTIIL 245

Query: 141 LLVHLLKR 148
           L+++   R
Sbjct: 246 LVINCSVR 253

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 4/77 (5%)

Query: 83  HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLL 142
           +C+ C  ++P R+ HC  C  CV+  DHHC W  NCVG +N+ +F+ FL+   + + FLL
Sbjct: 177 YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLASIFLL 236

Query: 143 ----VHLLKRTMTMWNL 155
               +HL +R  ++ ++
Sbjct: 237 ANCAIHLARRRRSISDM 253

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (65%)

Query: 83  HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLL 142
           +C  C  ++P RS HC TCN CV++ DHHC W  NC+G +N+  F+ FL+  I+++  LL
Sbjct: 174 YCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILL 233

Query: 143 V 143
            
Sbjct: 234 T 234

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 59/123 (47%), Gaps = 21/123 (17%)

Query: 41  IWFQFSLSMIWVSYLLAIFTNPGKPPKNCKPIDFND-----QRKWN-------------- 81
           I + F L  I  S+L A  ++PG  P+N    D N      Q  +N              
Sbjct: 112 ILYYFYLLTI-CSFLRAACSDPGIVPRNVHIPDLNASYKIPQEYYNYAILPTKNPNASVS 170

Query: 82  -THCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
             +C+ C  ++P RS HC  C+ CVL  DHHC W  NC+G +N+  F+ FLM   I+   
Sbjct: 171 MKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCIL 230

Query: 141 LLV 143
           L++
Sbjct: 231 LIL 233

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 41/75 (54%), Gaps = 7/75 (9%)

Query: 76  DQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLM--- 132
           D    + +C KC  +KP+R HHC  C++C L  DHHC W   C+GY N   F+ FL+   
Sbjct: 163 DSTGRHRYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYAS 222

Query: 133 ----WIIITTGFLLV 143
               WI I T + LV
Sbjct: 223 VYAFWICIITTWDLV 237

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (56%)

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
           +  C  C   KP RS HC  CN+C+L+ DHHC W  NC+G  N+  F  FL+  I++  +
Sbjct: 133 DVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSY 192

Query: 141 LLVHL 145
             + L
Sbjct: 193 AFLRL 197

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 21/124 (16%)

Query: 41  IWFQFSLSMIWVSYLLAIFTNPGKPPKNCK-PI---DFNDQRKWN--------------- 81
           I F +  ++  VS++    ++PG  P+N   PI   +F   R +                
Sbjct: 114 ILFYYFWAICLVSFIKTATSDPGVLPRNVHVPIVGEEFQLPRSYYNIITLPSAHPEGKTV 173

Query: 82  --THCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTG 139
              +C  C  ++P R+ HC TC  CVL  DHHC W  NC+G +N+ +F+ FL    + T 
Sbjct: 174 DVKYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATT 233

Query: 140 FLLV 143
             +V
Sbjct: 234 LCIV 237

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 60/124 (48%), Gaps = 20/124 (16%)

Query: 41  IWFQFSLSMIWVSYLLAIFTNPGKPPKNCK----------PIDFNDQRKWNT-------- 82
           I+F ++    + S++    ++PG  P+N            P ++ ++    T        
Sbjct: 154 IFFYYTWGTCFTSFIKTATSDPGVLPRNIHLSQISNNFKIPQEYYNEVTLPTGNPESTIN 213

Query: 83  --HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
             +C  C  ++P RS HC  C  C++  DHHC W  NC+G +N+  F+ FL+    T+ F
Sbjct: 214 IKYCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIF 273

Query: 141 LLVH 144
           L+++
Sbjct: 274 LIIN 277

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 35/63 (55%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C   KP RS HC  CN C+ + DHHC W  NCVG  N+ +F  FL   ++   +  +
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFI 195

Query: 144 HLL 146
            L+
Sbjct: 196 RLI 198

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (50%), Gaps = 10/102 (9%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C+ C   K  RS HC  C +C+ + DHHC W  NCVGY N+ +F  FL+    +   LL 
Sbjct: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL----SNCLLLT 184

Query: 144 HLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTI 185
           +   R +T++ +         + +  FL++ +   AF L+ I
Sbjct: 185 YASLRLLTLFRITAF------KKDKFFLSLFLLTTAFSLIAI 220

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 76/145 (52%), Gaps = 14/145 (9%)

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
           N  C+ C   K  RS HC  C +C+L+ DHHC W  NC+G  N+ +F  FL+    +   
Sbjct: 130 NIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL----SNCS 185

Query: 141 LLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNNQIVR- 199
           +L +   R  ++      PS ++  N+  FL+++I +  F +++IS  +++     +VR 
Sbjct: 186 MLSYATIRLSSV-----APSGLWRSNK-SFLSLMILVCCFAVISISFTYMQ---FALVRD 236

Query: 200 GMTQIEFWELERLENLFYNKKLLPM 224
           GMT  E  +   +  L  N++LL +
Sbjct: 237 GMTTNEKDKWYTIHKLMRNEQLLKL 261

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%)

Query: 83  HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLL 142
           +C  C  ++P R+ HC+ C  CV   DHHC W  NCVG +N+ +F+ FL     T   L 
Sbjct: 185 YCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATCATCTVLF 244

Query: 143 V 143
           V
Sbjct: 245 V 245

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 41/61 (67%)

Query: 83  HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLL 142
           +C  C+ ++P R+ HC  C  C+ + DHHC W  NCVG +N+ +FI FL+  I+++ F++
Sbjct: 189 YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFII 248

Query: 143 V 143
           +
Sbjct: 249 I 249

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 35/62 (56%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C  C   KP RS HC  CN+CVL+ DHHC W  NC+G  N+  F  FL+  I +  +  +
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195

Query: 144 HL 145
            L
Sbjct: 196 RL 197

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 26/133 (19%)

Query: 48  SMIWVSYLLAIFTNPGKPPKNCKPIDFNDQRKWN--------------------THCKKC 87
           ++ + S++    T+PG  P+N       D  K                       +C  C
Sbjct: 131 TLCFASFISTGATDPGTLPRNIHLAQLQDDYKLPLEYYSIITLPSPVANAPVRLKYCTTC 190

Query: 88  NNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLK 147
             ++P R+ HC  C+ C+L  DHHC W  NC+G +N  +F+ FL   ++++ +LL     
Sbjct: 191 RIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWLL----- 245

Query: 148 RTMTMWNLRHLPS 160
            T     LRH  S
Sbjct: 246 -TCCALKLRHAGS 257

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 36/66 (54%)

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
           N  CK C   KP RS HC  C++C+L+ DHHC W  NC+G  N+  F  F+    +T  +
Sbjct: 132 NVSCKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFIGGNSLTMIY 191

Query: 141 LLVHLL 146
               LL
Sbjct: 192 CFTRLL 197

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 33/62 (53%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C  C   K  RS HC  CN+CVL+ DHHC W  NC+G  N+  F  FL   I +  +  +
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195

Query: 144 HL 145
            L
Sbjct: 196 RL 197

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 83  HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLL 142
           +C  C  ++P R+ HC  C  CVL  DHHC W  NCVG +N+ +F+ FL+   +    L+
Sbjct: 159 YCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLI 218

Query: 143 V 143
            
Sbjct: 219 A 219

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 31/49 (63%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLM 132
           C  C+  KP RS HC  CN+C+L+ DHHC W  NC+G  N+  F  FL+
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLI 184

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 52/108 (48%), Gaps = 18/108 (16%)

Query: 47  LSMIWVSYLLAIFTNP---GKPPKNCKPIDFNDQRKW---------NTHCKKCNNYKPER 94
           L+ I VS LL +FT P   G   +   P     + +W         NT C+ C+  K  R
Sbjct: 94  LAAIPVSGLLTMFTRPEGCGGRDQGVAP----SEGQWPYDGILYYPNTTCRSCHTVKWAR 149

Query: 95  SHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLM--WIIITTGF 140
           S HC  C +C+ + DHHC W   C+G  NF +F  FL    +I+T  F
Sbjct: 150 SKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTYAF 197

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 83  HCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLM 132
           +C  C  ++P R+ HC  C  C+L  DHHC W  NC+G +N+ +F+ FL+
Sbjct: 172 YCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLV 221

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%)

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
              C+ C   K  RS HC  C +C  + DHHC W  NC+G  N+ +F  FL   +  T +
Sbjct: 128 GVECRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVY 187

Query: 141 LLVHLL 146
               LL
Sbjct: 188 GFTRLL 193

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 26/47 (55%)

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHF 127
              C+ C   KP RS HC  C +CV + DHHC W  NCVG  N+  F
Sbjct: 123 GVECRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 60/140 (42%), Gaps = 9/140 (6%)

Query: 66  PKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFP 125
           P      D N   +W   C  C   K  RSHH    N C+   DH+C W    +G  N+ 
Sbjct: 104 PAKLYQCDSNGYPRW---CSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYK 160

Query: 126 HFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTI 185
            F+ FL +  ++ G + +  +   +  +   +     FD N ++ L IL  M  F +  +
Sbjct: 161 QFVIFLFYCTVSFGIMWISAIVCYLK-YGRHYQEQNNFDGN-LVTLVILGAMGWFFVAGL 218

Query: 186 SLLFIRCFNNQIVRGMTQIE 205
            L  I    + +VR +T +E
Sbjct: 219 LLAHI----SYMVRNLTSLE 234

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 5/116 (4%)

Query: 76  DQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMW-- 133
           D + +   C  C + K ERSHH +    CV   DH+C W    +G KN+  F++++M+  
Sbjct: 119 DPQGYPMWCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFT 178

Query: 134 IIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLF 189
           I + T  L + L  + +  +N  H      + N II L IL+   AF +  +  +F
Sbjct: 179 IYLVTASLTIALFMKRIVDYNKEH--DLTLNLN-IIVLFILVLAFAFFVTPLFAVF 231

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 51/123 (41%), Gaps = 28/123 (22%)

Query: 47  LSMIWVSYLLAIFTNPGK----PPKNCKPIDFNDQRKWNTH------------------- 83
           L +IW  Y  AI   PG+    PP    P DF+  R  +                     
Sbjct: 66  LVIIW--YQAAIAVGPGRLPKVPPYMILPEDFSIDRIGDPAETAHSLVPPVCYQSCPRGN 123

Query: 84  ---CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF 140
              C  C++ K ER+HH      CV   DH C W    +G  N+  FI+F+M++ I + F
Sbjct: 124 PIWCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLF 183

Query: 141 LLV 143
           + V
Sbjct: 184 VFV 186

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 6/93 (6%)

Query: 64  KPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKN 123
           KPPK  +  D N    W THC+   + K  RSHH K   +C+L  DH+C W    +   N
Sbjct: 102 KPPKYYQ-CDKNGYPPWCTHCQ---SLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNN 157

Query: 124 FPHFIRFLMW--IIITTGFLLVHLLKRTMTMWN 154
           +  F++++ W  +++   +L + +  RT+ M N
Sbjct: 158 YRLFLQYVGWFNLLLLWYWLTIAVFIRTIGMLN 190

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 85/208 (40%), Gaps = 39/208 (18%)

Query: 43  FQFSLSMIWVSYLLAIFTNPGKPPK-------NCKPIDFNDQRKWNTH------------ 83
            Q  L +IW  + +A+   PGK P+       + +  D     K+  H            
Sbjct: 62  LQILLLLIW--FQIAVAVGPGKLPQVLPYLILSAQESDLGASEKYQNHGSDGSSICYQCD 119

Query: 84  -------CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIII 136
                  C  C + K ER+HH +    CV   DH C +  + +G  N+  F+++ +++ I
Sbjct: 120 PNGYPIWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTI 179

Query: 137 TTGFLLVHLLK--RTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFN 194
               +   ++   R++T  + R   S++        + ILI    F +   SLL  +   
Sbjct: 180 WLAIIWTSIVAYIRSITR-DYRGHGSHLNGN----LIAILILTTLFWITVTSLLLTQL-- 232

Query: 195 NQIVRGMTQIEFWELERLENLFYNKKLL 222
           N IV+  T IE   +ER    F  +K+ 
Sbjct: 233 NCIVKNKTSIEV--MERRRKAFSTRKMF 258

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 84/219 (38%), Gaps = 32/219 (14%)

Query: 65  PPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNF 124
           PP      D N    W   C  C + K  R+HH K    C+   DHHC W    +G  N+
Sbjct: 108 PPPVFYECDINGYPIW---CDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNY 164

Query: 125 PHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLT 184
             F +F+ +         + ++     + +  H   Y  D N I+ L + +P   F ++T
Sbjct: 165 LLFTQFVFYFSCLLLIFWISIVSYIKRIVDYPH-TGYKLDPNLIVILILSVP---FSIMT 220

Query: 185 ISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKVADNY 244
           +SL     +   + R  T +E   ++R      NKKL             N +  V   Y
Sbjct: 221 LSLFLSHVYFTFMNR--TSLEIINIKR------NKKL-------------NIKKFVC--Y 257

Query: 245 ADDLLSRRKKVRF--ENIVNFPYDIDIWTNMNTVMGSAF 281
            D     R  +    E++ N      IW N   V+G+ F
Sbjct: 258 LDKTSGNRYVIEMSPEDMANIWKKRSIWENFKEVLGNNF 296

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 61/140 (43%), Gaps = 6/140 (4%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143
           C +C + K ER+HH      CV   DH+C W    +G  N+  F++F+ +  I    + V
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIWV 182

Query: 144 HLLKRTMTMWNLR-HLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNNQIVRGMT 202
            ++     +   R + P + F+ N II L   I      L T+ L F   +   I +  T
Sbjct: 183 SIVSYIHMIIRKRPNQPHHHFNTNLIIILVFAI---LGWLFTVGLFFANIY--YISKNRT 237

Query: 203 QIEFWELERLENLFYNKKLL 222
            +E    +  +N    KK +
Sbjct: 238 SLEMLLQKHKKNSPLKKKFI 257

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 59  FTNP--GKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTM 116
           FT+P   KPP     I   D+  + T C  C + K  R+HH      CV   DH+C W  
Sbjct: 103 FTSPQVNKPPL----IYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLG 158

Query: 117 NCVGYKNFPHFIRFLMWI 134
             +G  N+  FI+FL+++
Sbjct: 159 TLIGAGNYLLFIQFLVYM 176

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 36/72 (50%)

Query: 76  DQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWII 135
           D + +   C  C + K ER+HH  T   CV   DH+C W    VG KN+  FI+F M+  
Sbjct: 119 DPQGYPIWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSMYFF 178

Query: 136 ITTGFLLVHLLK 147
                +L+ + K
Sbjct: 179 FYFVIVLIPVCK 190

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 4/86 (4%)

Query: 60  TNPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCV 119
           T   KPP+    I   D + +   C  C + K  R+HH  T   C+   DH+C W    V
Sbjct: 105 TRSIKPPR----IYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIV 160

Query: 120 GYKNFPHFIRFLMWIIITTGFLLVHL 145
           G KN+  F++F  +  + T +++  +
Sbjct: 161 GRKNYRLFVQFAFYFWLFTIYMIASI 186

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 76  DQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMW-- 133
           D + +   C  C + K  R+HH  T   C+   DH+C W    VG KN+  F++F  +  
Sbjct: 124 DPQGYPIWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFW 183

Query: 134 -----IIITTGFLLVHLLK 147
                +I++T   L  +++
Sbjct: 184 AFAIFVIVSTASFLPKIIR 202

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 4/72 (5%)

Query: 65  PPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNF 124
           PPK C   D +    W   C  C + K ER+HH      CV   DH+C W    +G  N+
Sbjct: 117 PPK-CYQSDPHGYPIW---CSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNY 172

Query: 125 PHFIRFLMWIII 136
             F++F+ +  I
Sbjct: 173 RLFVQFVAYFSI 184

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 13/134 (9%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGF--- 140
           C +    KP RS +    N  V   DH+CPW  N VG KN   F+ F++ +    G    
Sbjct: 464 CIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILSMETGIGLFTS 523

Query: 141 LLVHLLKRTMTMWNLRHLPSYIFDRNEII-------FLTILIPMDAFILLTISLL-FIRC 192
           L +    +   +++   L   +   +E+        F  +++   AF  L +SLL F++ 
Sbjct: 524 LCLEYFDQLEDLYDDDKLKCLLLGDDELCAGFTHDRFSFLIMAWSAFQFLWVSLLIFVQV 583

Query: 193 FNNQIVRGMTQIEF 206
           F  Q+ +G+T  EF
Sbjct: 584 F--QVTKGVTSYEF 595

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 62/141 (43%), Gaps = 11/141 (7%)

Query: 65  PPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNF 124
           PPK C   D N    W   C  C + K ERSHH      C+   DH+C W    +G  N+
Sbjct: 116 PPK-CYQSDPNGYPIW---CSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNY 171

Query: 125 PHFIRFLMWIIITTGFLLVHLLKRTMTMWNL-RHLPSYIFDRNEIIFLTILIPMDAFILL 183
             F++F  +    +  LL+  +   + + N+ +H  ++    N  +FLT+   +  ++  
Sbjct: 172 RPFVQFTGYF---SSLLLIMWVSICVFIRNITQHHHNHNSPLNANVFLTLAFAIFGWLFT 228

Query: 184 TISL---LFIRCFNNQIVRGM 201
           T  L   +F  C N   +  +
Sbjct: 229 TSMLASNIFYMCQNKTYLEAI 249

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%)

Query: 76  DQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWII 135
           D+R +   C  C + K  R+HH      CV   DH+C W    +G  N+  F++F  ++ 
Sbjct: 120 DERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLD 179

Query: 136 ITTGFLLVHLLKRTMTM 152
           +    L++ +  +   M
Sbjct: 180 LVVLILMISIATQMRQM 196

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 65  PPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNF 124
           PPK C   D +    W   C +C + K ER+HH      C+   DH+C W    +G  N+
Sbjct: 116 PPK-CYQSDPHGYPIW---CSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNY 171

Query: 125 PHFIRFLMW 133
             F++F  +
Sbjct: 172 RLFVQFAAY 180

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 3/68 (4%)

Query: 66  PKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFP 125
           P  C   D +    W   C  C + K ER+HH      CV   DH+C W    +G  N+ 
Sbjct: 122 PPRCYQCDPHGYPIW---CSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYR 178

Query: 126 HFIRFLMW 133
            F++F+ +
Sbjct: 179 LFVQFVTY 186

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 8/72 (11%)

Query: 64  KPP--KNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGY 121
           KPP    C P   N    W   C  C + K ER HH +    C+   DH+C W    +G 
Sbjct: 101 KPPLYYQCDP---NGYPIW---CTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGR 154

Query: 122 KNFPHFIRFLMW 133
            N+  FI+++ +
Sbjct: 155 NNYRLFIQYVFY 166

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 62/150 (41%), Gaps = 23/150 (15%)

Query: 91  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRF--LMWIIITTGFLLV----H 144
           KP RS      N  V   DH+CPW  N VG KN   FI F  LM   I T F L      
Sbjct: 479 KPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIALMESGIFTFFALCLEYFD 538

Query: 145 LLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTI-----------SLLFIRCF 193
            L+        +    +I   ++   L   +  D F+ L +           SL+F++ F
Sbjct: 539 ELEDAYEDEYQKQGKCFILGDSD---LCSGLKYDKFVFLILSWAMLQSIWVASLIFVQAF 595

Query: 194 NNQIVRGMTQIEFWELERLENLFYNKKLLP 223
             QI +GMT  EF  L + EN      +LP
Sbjct: 596 --QICKGMTNSEFNVLMK-ENKAAGANVLP 622

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 15/115 (13%)

Query: 36  SIKKQIWFQFSLSMIWVSYLLAIFTNPGKPPKNCKPIDFNDQR------------KWNTH 83
           +I K  +  F +  I +S L  +F N  +     KP +FN               K++T+
Sbjct: 418 TIAKHSFGNFVMLSIIIS-LSYLFVNLVRSDPGTKPAEFNHDSIRETITNLMLIGKFDTN 476

Query: 84  --CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIII 136
             C + +  KP RS +    +  V   DH CPW  N +G KN   F+ F++ ++I
Sbjct: 477 NFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVI 531

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 56/133 (42%), Gaps = 22/133 (16%)

Query: 91  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRF--LMWIIITTGFLLV----- 143
           KP RS      N  V   DH+CPW  N VG KN   F+ F  LM   I T F L      
Sbjct: 478 KPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFITLMECGILTFFKLCLEYFD 537

Query: 144 ----------HLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTISLLFIRCF 193
                       L +   + +        +DR   +FL +L  +   I +  SL+F++ F
Sbjct: 538 ELEDSYEDRNQELGKCFILGHSDLCSGLRYDR--FVFLVLLWALLQSIWVA-SLIFVQTF 594

Query: 194 NNQIVRGMTQIEF 206
             QI +GMT  EF
Sbjct: 595 --QIFKGMTNSEF 605

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 55/115 (47%), Gaps = 13/115 (11%)

Query: 35  LSIKKQIWFQFSLSMI--WVSYLLAIF--TNPGKPP--KNCKPI-----DFNDQRKWNTH 83
           ++I+ Q    F L +I   VSYLL +   ++PG+ P  KN + I     D     K+++ 
Sbjct: 402 VTIQDQYTANFLLMIIILAVSYLLVVLVKSDPGRIPTEKNTQVIRETIKDLLATGKFDSK 461

Query: 84  --CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIII 136
             C +    KP RS      N  V   DH+CPW  N +G +N   F+  ++ + I
Sbjct: 462 NFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEI 516

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 65/146 (44%), Gaps = 16/146 (10%)

Query: 68  NCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHF 127
           NC   D +    W   C  C + K  R+ H      CV   DH+C W    +G+KN+  F
Sbjct: 103 NCYQSDPHGYPVW---CSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLF 159

Query: 128 IRFLMW--IIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAFILLTI 185
           ++F+ +  +++   ++ + +  R +  ++ R       + N I+ L I         L  
Sbjct: 160 VQFVFYFAVLLMIVWITISVYIRDIRQYHAR------LNANLIVLLII----SGIGWLMT 209

Query: 186 SLLFIRCFNNQIVRGMTQIEFWELER 211
           S LF+  +   + + +T IE  +L++
Sbjct: 210 SGLFVS-YIYYMSQNLTSIEVIDLKK 234

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%)

Query: 76  DQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWII 135
           D + +   C  C + K  R+HH      CV  +DH+C W    +G +N+  F +FLM  +
Sbjct: 114 DTQGYPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFL 173

Query: 136 ITTGFLLVHLLK 147
           +    + V ++ 
Sbjct: 174 MHALIIFVSVVS 185

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 62/133 (46%), Gaps = 22/133 (16%)

Query: 91  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTG---FLLVHL-- 145
           KP RS      N  V   DH+CPW  N VG KN   FI F+   ++ +G   FL + L  
Sbjct: 479 KPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIT--LMESGIFTFLALCLEY 536

Query: 146 ---LKRTMTMWNLRHLPSYIFDRNEI---------IFLTILIPMDAFILLTISLLFIRCF 193
              L+      + ++   +I   +++         +FL +L  +   I +  SL+F++ F
Sbjct: 537 FDELEDAHEDTSQKNGKCFILGASDLCSGLIYDRFVFLILLWALLQSIWVA-SLIFVQAF 595

Query: 194 NNQIVRGMTQIEF 206
             QI +GMT  EF
Sbjct: 596 --QICKGMTNTEF 606

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 69/158 (43%), Gaps = 19/158 (12%)

Query: 81  NTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRF---LMWIIIT 137
           N  C +    KP RS +       V   +H+CPW  N +G KN   F+ F   + + +  
Sbjct: 428 NNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSVQYEMFL 487

Query: 138 TGFLLVHLLKRTMTMW-NLRHLPSYIFDRNEII-----------FLTILIPMDAFILLTI 185
             +L +   K+T  ++  +       F +NE +           FL I I M+ F+ L  
Sbjct: 488 FMWLCLEYFKKTNHIYEQVEEYAKCTFLKNETLCKGSNYDPSTFFLFIWISMN-FVWLG- 545

Query: 186 SLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLP 223
            +L ++CF  QI +G+T  E + L + E       L+P
Sbjct: 546 GMLIVQCF--QIFKGITSPELYALIKEERKAEALNLIP 581

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 56/134 (41%), Gaps = 26/134 (19%)

Query: 91  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTM 150
           KP RS      N  V   DH+CPW  N +G KN   FI F++ + I  G L+   L    
Sbjct: 470 KPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISVEI--GILIFVCL---- 523

Query: 151 TMWNLRHLPSYIFDRNEIIF-------LTILIPMDAFILLTIS-----------LLFIRC 192
           TM     L  Y  D+ +          L   +  D F LL ++           L+ ++ 
Sbjct: 524 TMKYFDFLEDYFEDKKKFSCGILGDDELCAGLIFDRFSLLVMTWSLIQSLWVGILIMVQF 583

Query: 193 FNNQIVRGMTQIEF 206
           F  QI RG+T  EF
Sbjct: 584 F--QISRGVTNYEF 595

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 61/132 (46%), Gaps = 20/132 (15%)

Query: 91  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWI---IITTGFLLVHL-- 145
           KP RS +    N  V   DH+CPW  N VG KN   FI F+  +   I T  FL + L  
Sbjct: 479 KPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITSMESGIFT--FLALCLEY 536

Query: 146 ---LKRTMTMWNLRHLPSYIFDRNEIIF------LTILIPMDAFI--LLTISLLFIRCFN 194
              L+      + ++   +I   +++         T LI + A +  +   SL+F++ F 
Sbjct: 537 FDELEDAYEEISQKNSKCFILGDSDLCSGLAHDKFTFLIMLWALLQSIWVASLIFVQAF- 595

Query: 195 NQIVRGMTQIEF 206
            QI +G+T  EF
Sbjct: 596 -QICKGLTNSEF 606

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 62/136 (45%), Gaps = 19/136 (13%)

Query: 91  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHL----- 145
           KP RS         +   DH+CPW  N VG KN   F+ F+  I +   ++  HL     
Sbjct: 469 KPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVAV-WIFAHLCLEYF 527

Query: 146 --LKRTMTMWNLRHLPSYIFDRNEI-------IFLTILIPMDAFILLTIS-LLFIRCFNN 195
             L+     +N   L  ++   +E+       +F T+++    F  + +  L+F++ F  
Sbjct: 528 DELEDNYDDYN-GDLKCFLIGDSELCAGLTYDLFTTLILLWAVFQSIWVGCLVFVQAF-- 584

Query: 196 QIVRGMTQIEFWELER 211
           QI +G+T  E+ +L R
Sbjct: 585 QIFKGVTNYEYSKLMR 600

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 50/123 (40%), Gaps = 23/123 (18%)

Query: 47  LSMIWVSYLLAIFTNPGKPPKNCKPIDFNDQRKWNT--------------HCKKCNNYKP 92
           L  I+  ++  IF++PG     C PI+ + +    T               C +    KP
Sbjct: 411 LMQIYYLFIKLIFSDPG-----CVPIETDHENVRGTIKELLDTGKFDIKNFCLETWIRKP 465

Query: 93  ERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTM 152
            RSH        V   DH CPW  N +G KN  +F    MW I+ T   +   +  TM  
Sbjct: 466 LRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNF----MWFILLTEVGIWFFISLTMKY 521

Query: 153 WNL 155
           +++
Sbjct: 522 FDI 524

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 91  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWI 134
           KP RS +    N  V   DH CPW  N VG KN  +FI F++ +
Sbjct: 481 KPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLV 524

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 99/224 (44%), Gaps = 26/224 (11%)

Query: 48  SMIWVSYLLAIFTNPGKPPKNCKP-IDFNDQRKW--------NTHCKKCNNYKPERSHHC 98
           +++ + Y   IF++PG  P+     +  ND  K         +T C K    KP R    
Sbjct: 360 TLLLLCYGRLIFSDPGCIPEETDTDLIRNDIEKLIKLGSFNCHTFCLKTWIRKPVRCSLS 419

Query: 99  KTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWI---IITTGFL---LVHLLKRTMTM 152
           K   Q V   DH+C W  N VG KN   +I FL+ +   ++T G L      L+++T   
Sbjct: 420 KLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLILLETFLMTFGVLNWRYFGLMEKTAEC 479

Query: 153 WNL-RHLPSYIFDRNEIIFLTIL-IPMDAFILLTISLLFIRCFNNQIVRGMTQIEFWELE 210
           +   R +  + +   +++FL ++     A  +  + +L +R    +I  G+T    +EL 
Sbjct: 480 FLFNRTIICHGYKNLKVVFLFLVWTIFQAIFVGNLLMLQLR----KIAYGITT---FELV 532

Query: 211 RLENLFYNKKLLPMIIATLWEVYPNERTKVADNYADDLLSRRKK 254
            L+    N+ L   I    ++V   E  K  ++ + D+ +  KK
Sbjct: 533 FLKEFVRNRSLETKICNDYFDV--REAAKCDESASADISTCPKK 574

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 55/132 (41%), Gaps = 14/132 (10%)

Query: 30  ILSNFLSIKKQIWFQFSLSMIW--VSYLLAIF--TNPGKPPKNCKPIDFNDQRKWNTHCK 85
           I  N L   K ++    L +++  VS LL I   ++PG  P +  P +            
Sbjct: 389 ITRNTLKYHKGVYANIILPVLFITVSSLLVILMQSDPGSIPASSDPKEIRATMSELLRIG 448

Query: 86  KCNNYK---------PERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIII 136
           K +            P RS +    N  +   DH+CPW  N +G+ N   F+ F+M++ I
Sbjct: 449 KFDAKHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQI 508

Query: 137 TTGFLLVHLLKR 148
              F+ V L  R
Sbjct: 509 GV-FIFVRLSIR 519

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%)

Query: 91  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWI 134
           KP RS +    +  +L  DH+CPW  N VG KN   FI F++ +
Sbjct: 463 KPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILAL 506

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWII 135
           C      KP RS   +     ++  DH CPW  N VG  N   FI FL+ ++
Sbjct: 454 CVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLV 505

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 21/123 (17%)

Query: 41  IWFQFSLSMIWVSYLLAIFTNPGK-PPKNCKPIDFNDQR----------KWNTH--CKKC 87
           I F   L  + + +   ++++PG   P+     DFN+ R          K++T   C + 
Sbjct: 408 ILFVAVLGCVHLLFFQLVYSDPGVLEPET----DFNEIRNKISELLKIGKFDTKNFCIET 463

Query: 88  NNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLK 147
              KP R       ++ VL  DH+CPW  N VG  N   F    M+ +++ G  +V  +K
Sbjct: 464 WQRKPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKF----MYYVMSVGLGIVCFVK 519

Query: 148 RTM 150
            +M
Sbjct: 520 LSM 522

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWI 134
           C +    KP RS +       V   DH+CPW  N VG KN   F+ F + +
Sbjct: 448 CVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTV 498

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 43/107 (40%), Gaps = 17/107 (15%)

Query: 45  FSLSMIWVSYLL--AIFTNPGKPPKNCKPIDFNDQRKWNTHCKKCNNY------------ 90
           F +S+I V Y     I +NPG+  +N    D    RK      +   +            
Sbjct: 418 FGVSIIGVIYEFYKLIRSNPGRKNRNH---DMESVRKTIQTLMELGKFDIRHFCLETWVR 474

Query: 91  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIIT 137
           KP RS         V   DH+CPW  N +G +N   FI F+ +  +T
Sbjct: 475 KPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVT 521

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 92  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRF 130
           P R+ + +  +  +L  DH+CPW  N +G++N   FI F
Sbjct: 456 PLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 83/209 (39%), Gaps = 24/209 (11%)

Query: 37  IKKQIWFQFSLSMIWVSYLLAIFTNPGKPPKNCKPIDFNDQRKW---------NTHCKKC 87
           I K + F  +  + ++ +L  + ++PG    +   I   +  K             C + 
Sbjct: 389 IMKNVQFLVTSLLTFILFLKLVRSDPGCLKTDDSLISIQETIKQLIQLGKFDRENFCVET 448

Query: 88  NNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWI---IITTGFLLVH 144
              KP RS         V   DH CPW  N +G KN   F+ F + +   +    +L + 
Sbjct: 449 LERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALTVQYHMFLFMWLCLA 508

Query: 145 LLKRTMTMWNL--RHLPSYIFDRNEIIFLTILIPMDAFILLTIS--------LLFIRCFN 194
             KRT  ++     +    +F    +   +   P   F+ + +S        +L ++CF 
Sbjct: 509 YFKRTNHIYEQVDGYARCALFKNETLCKGSNYDPSTFFLFIWVSVNFLWLGAMLIVQCF- 567

Query: 195 NQIVRGMTQIEFWELERLENLFYNKKLLP 223
            QI++G+T  E + L + E    +  L+P
Sbjct: 568 -QILKGITVPELFILIKEERRAKSFSLIP 595

>CAGL0K07590g Chr11 (749181..752939) [3759 bp, 1252 aa] {ON} highly
           similar to uniprot|P36006 Saccharomyces cerevisiae
           YKL129c or uniprot|Q04439 Saccharomyces cerevisiae
           YMR109w myosin like proteins
          Length = 1252

 Score = 35.4 bits (80), Expect = 0.30,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 8/86 (9%)

Query: 286 IFGVPDRNGLKFEKNEISLYEPGSS--VEDLLLSLPW------PPDKGRNFISNKDTSVE 337
           IFG+ D+N  + +K+ + L    S+  V ++    P       PP  G   I + +  VE
Sbjct: 534 IFGITDKNKDQLQKDLVELLSTTSNSFVREIFPDQPQTDSRRRPPTSGDKIIKSANELVE 593

Query: 338 SLVYDGEQVVRNRASNDTNISTINKD 363
           +L       +R    NDT  STI  D
Sbjct: 594 TLSKAQPSYIRTIKPNDTKSSTIYDD 619

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 52/135 (38%), Gaps = 19/135 (14%)

Query: 91  KPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTM 150
           KP RS         V   DH CPW  N +G +N   F+ F++  + T  F+ + L     
Sbjct: 459 KPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL-CLETCIFVFLKLCMEYF 517

Query: 151 TMWNLRHLPSYIFDRNEIIFLTILIP---MDAFILLTIS-----------LLFIRCFNNQ 196
            +        Y  D N  IF   L      D F  L ++           L F++ F  Q
Sbjct: 518 DVLEDTFEDDY--DLNCGIFGEDLCAGFFFDTFTFLVLAWTCFQGIWVGFLTFVQLF--Q 573

Query: 197 IVRGMTQIEFWELER 211
             +G+T  EF  L +
Sbjct: 574 TAKGVTNYEFSTLSK 588

>NDAI0B00790 Chr2 (184290..184961) [672 bp, 223 aa] {ON} Anc_5.36
          Length = 223

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 6/38 (15%)

Query: 70  KPIDFNDQRKWNT----HCKKCNN--YKPERSHHCKTC 101
           KP ++N    W      HCKKCNN  YK +  H CK+C
Sbjct: 80  KPSNYNPSIPWTYPAGFHCKKCNNTGYKLKNGHSCKSC 117

>Ecym_5188 Chr5 (394647..395918) [1272 bp, 423 aa] {ON} similar to
           Ashbya gossypii ACR246W
          Length = 423

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 19/98 (19%)

Query: 11  GVAIPSFIISFIGYNSHYFILSNFLSIKKQIW------------------FQFSLSMIWV 52
           G  +PS ++SF  +     +L  F++I  Q W                  F  S S I  
Sbjct: 314 GTKVPS-LMSFKPHTEVAMVLEEFVTIYGQDWDKLAKLNSMDDWSILDTLFASSTSKIGE 372

Query: 53  SYLLAIFTNPGKPPKNCKPIDFNDQRKWNTHCKKCNNY 90
            Y L +     K P+  K +DFN+ + W  +    N+Y
Sbjct: 373 QYGLDVRKIDLKEPQKVKVLDFNESKPWLKNSDDLNDY 410

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 22/51 (43%)

Query: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWI 134
           C +    K  RS +       V   DH+CPW  N +G KN    + F M +
Sbjct: 442 CVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKNHKLSLFFAMTV 492

>SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 809

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 25/62 (40%), Gaps = 4/62 (6%)

Query: 99  KTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHL 158
           K C  C   M+     T   +      H  R    II T G LL+ L   TMT+   RHL
Sbjct: 568 KCCQSCTNAMNEFLKLTPELIASLPLYHISR----IIYTVGMLLLRLRYVTMTVAAFRHL 623

Query: 159 PS 160
            S
Sbjct: 624 QS 625

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 92  PERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIIT 137
           P RS + +     +   DH CPW  N +G  N   F  F++ + I+
Sbjct: 476 PLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVVLLEIS 521

>TPHA0N01860 Chr14 complement(395074..396195) [1122 bp, 373 aa] {ON}
           Anc_2.664 YIR034C
          Length = 373

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 50/122 (40%), Gaps = 20/122 (16%)

Query: 233 YPNERTKVAD--NYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVP 290
           YPNE + + D  NY    + +   V  +        I I   +      A +++   GVP
Sbjct: 168 YPNESSLIKDLKNYYTRAVKKNNGVAPK--------ILIIGALGRCGSGAIDFLKKIGVP 219

Query: 291 DRNGLKFEKNEISLYEPGSSVED-------LLLSLPWPP---DKGRNFISNKDTSVESLV 340
           DRN +K++ NE     P   + D       + LS P PP   DK  N    K T+V  + 
Sbjct: 220 DRNIIKWDMNETKKGGPFKEIVDSDIFINCIYLSKPIPPFVNDKILNNPHRKLTTVVDVS 279

Query: 341 YD 342
            D
Sbjct: 280 AD 281

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,017,668
Number of extensions: 2126630
Number of successful extensions: 7940
Number of sequences better than 10.0: 145
Number of HSP's gapped: 7982
Number of HSP's successfully gapped: 145
Length of query: 389
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 278
Effective length of database: 40,753,473
Effective search space: 11329465494
Effective search space used: 11329465494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)