Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C026406.26ON42742720640.0
TDEL0G044306.26ON3472295704e-69
SAKL0E01408g6.26ON3072435595e-68
YOL001W (PHO80)6.26ON2932495561e-67
CAGL0E02541g6.26ON3422455531e-66
Smik_15.1696.26ON2912315421e-65
Skud_15.1616.26ON2932325421e-65
KLTH0C11110g6.26ON2802295367e-65
Suva_15.1746.26ON2952235342e-64
Kwal_56.224436.26ON2802285272e-63
KNAG0I017506.26ON3242265293e-63
NCAS0D021506.26ON3692235333e-63
Kpol_1037.306.26ON3672165307e-63
TPHA0J003806.26ON3562285235e-62
KLLA0D01287g6.26ON3452275131e-60
ZYRO0C07634g6.26ON3822105117e-60
Ecym_30296.26ON3512215088e-60
TBLA0A071606.26ON2682154956e-59
ACR001C6.26ON3462264948e-58
Ecym_43367.240ON3852121755e-13
Smik_9.1407.240ON2851661672e-12
Suva_9.1497.240ON2861861663e-12
Kwal_23.58077.240ON4652111677e-12
ADL075W7.240ON2071551581e-11
Skud_9.1197.240ON2851581592e-11
NCAS0A134807.240ON4482371613e-11
KNAG0D016307.240ON4381951613e-11
YIL050W (PCL7)7.240ON2851601566e-11
SAKL0F08602g7.240ON4741571596e-11
KAFR0I018407.240ON3251461433e-09
KLLA0C08305g7.240ON4091781434e-09
KLTH0A04268g7.240ON5801101445e-09
NCAS0E032207.240ON3411811426e-09
TDEL0H020207.240ON3631851401e-08
KNAG0L014707.240ON3541461391e-08
KAFR0L008807.240ON3131221353e-08
NDAI0A025607.240ON5031191364e-08
TPHA0C010907.240ON3851411347e-08
CAGL0M12342g7.240ON4571191339e-08
ZYRO0C08118g7.240ON4051461123e-05
TBLA0C048507.289ON368821097e-05
NCAS0A137707.289ON3121151089e-05
TBLA0D040707.240ON661601091e-04
NCAS0D040706.236ON4731131052e-04
NDAI0E047707.240ON303186999e-04
Smik_5.1897.240ON41560980.002
Skud_7.1396.236ON434142980.002
Skud_5.1737.240ON42060970.002
YER059W (PCL6)7.240ON42060970.002
Suva_5.1677.240ON42460970.003
Kpol_1020.87.289ON296109950.003
AFR159C7.289ON308115930.005
Kpol_1033.137.240ON25060920.006
Suva_4.1187.289ON30979920.007
Suva_14.503.70ON27996920.008
KLLA0E13223g3.70ON28296920.008
YDL127W (PCL2)7.289ON308103900.012
TPHA0A005803.70ON289128900.012
Smik_4.1107.289ON308103900.013
Kpol_2000.147.289ON31073900.015
TDEL0H015507.289ON309112890.016
KNAG0B029307.289ON31281880.026
KLTH0H03674g6.236ON484119880.027
CAGL0J09328g7.289ON297101870.030
TBLA0A078903.70ON361103870.038
Kwal_23.52313.70ON25681850.040
TDEL0E028005.347ON199109840.044
SAKL0A03938g6.236ON50185860.048
TBLA0J006507.289ON363105860.050
CAGL0J10846g5.347ON22999840.052
ZYRO0C09284g7.289ON311101850.058
TPHA0P008107.289ON247105840.058
KNAG0F018706.236ON48397850.059
YNL289W (PCL1)3.70ON27996840.060
Smik_14.423.70ON27996840.061
CAGL0E02233g3.70ON26698840.068
SAKL0F09856g7.289ON33599840.073
KNAG0A014903.70ON262144830.075
Skud_4.1287.289ON308103840.077
Skud_14.483.70ON27996830.091
YDL179W (PCL9)7.289ON304111820.13
NDAI0A022707.289ON330102820.14
Kwal_23.60067.289ON304109810.14
KLLA0B02024g6.236ON527108820.17
Ecym_80387.289ON31491810.18
Ecym_35353.70ON370112810.18
KLTH0A05346g7.289ON30179800.21
TBLA0A030905.347ON24097790.21
Skud_4.797.289ON309100800.22
TDEL0E007903.70ON25485790.23
KLTH0A01584g3.70ON28179790.29
TPHA0E027506.236ON605128790.37
SAKL0C12100g3.70ON31496780.38
Kpol_1020.163.70ON282163780.40
ZYRO0C02068g3.70ON330107760.61
AEL195W3.70ON237114750.80
NCAS0A098703.70ON29473750.82
Suva_4.687.289ON30584741.3
KAFR0A082803.70ON24196721.6
Smik_4.607.289ON30582713.0
CAGL0E05918g6.236ON481123713.4
TPHA0A032507.289ON28972694.5
TBLA0A053201.69ON162938696.9
NDAI0A060503.70ON28673687.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C02640
         (427 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   799   0.0  
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   224   4e-69
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   219   5e-68
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   218   1e-67
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   217   1e-66
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   213   1e-65
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   213   1e-65
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   211   7e-65
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   210   2e-64
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   207   2e-63
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   208   3e-63
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     209   3e-63
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   208   7e-63
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   206   5e-62
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   202   1e-60
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   201   7e-60
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   200   8e-60
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   195   6e-59
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   194   8e-58
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    72   5e-13
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    69   2e-12
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    69   3e-12
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    69   7e-12
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    65   1e-11
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    66   2e-11
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    67   3e-11
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    67   3e-11
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    65   6e-11
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    66   6e-11
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    60   3e-09
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    60   4e-09
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    60   5e-09
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    59   6e-09
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    59   1e-08
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    58   1e-08
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    57   3e-08
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    57   4e-08
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    56   7e-08
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    56   9e-08
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    48   3e-05
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    47   7e-05
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    46   9e-05
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    47   1e-04
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     45   2e-04
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    43   9e-04
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    42   0.002
Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W ...    42   0.002
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    42   0.002
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    42   0.002
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    42   0.003
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    41   0.003
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    40   0.005
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    40   0.006
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    40   0.007
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    40   0.008
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    40   0.008
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    39   0.012
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    39   0.012
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    39   0.013
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    39   0.015
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    39   0.016
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    39   0.026
KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly...    39   0.027
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    38   0.030
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    38   0.038
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    37   0.040
TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON...    37   0.044
SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly...    38   0.048
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    38   0.050
CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]...    37   0.052
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    37   0.058
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    37   0.058
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    37   0.059
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    37   0.060
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    37   0.061
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    37   0.068
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    37   0.073
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    37   0.075
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    37   0.077
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    37   0.091
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    36   0.13 
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      36   0.14 
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    36   0.14 
KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some s...    36   0.17 
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    36   0.18 
Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar...    36   0.18 
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    35   0.21 
TBLA0A03090 Chr1 (738446..739168) [723 bp, 240 aa] {ON} Anc_5.34...    35   0.21 
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    35   0.22 
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    35   0.23 
KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar...    35   0.29 
TPHA0E02750 Chr5 (574999..576816) [1818 bp, 605 aa] {ON} Anc_6.2...    35   0.37 
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    35   0.38 
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    35   0.40 
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    34   0.61 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    33   0.80 
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    33   0.82 
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    33   1.3  
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    32   1.6  
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    32   3.0  
CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {...    32   3.4  
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    31   4.5  
TBLA0A05320 Chr1 complement(1302526..1307415) [4890 bp, 1629 aa]...    31   6.9  
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    31   7.1  

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/427 (92%), Positives = 393/427 (92%)

Query: 1   MQGSSYRDESKPDNNICQDSNINVNKTSNTSSDTPSTQSHSTPNVITDAENPKHVKITLP 60
           MQGSSYRDESKPDNNICQDSNINVNKTSNTSSDTPSTQSHSTPNVITDAENPKHVKITLP
Sbjct: 1   MQGSSYRDESKPDNNICQDSNINVNKTSNTSSDTPSTQSHSTPNVITDAENPKHVKITLP 60

Query: 61  IKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGNYLLRL 120
           IKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGNYLLRL
Sbjct: 61  IKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGNYLLRL 120

Query: 121 TKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLSITHY 180
           TKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLSITHY
Sbjct: 121 TKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLSITHY 180

Query: 181 AKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKESGTSFS 240
           AKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKESGTSFS
Sbjct: 181 AKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKESGTSFS 240

Query: 241 YRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVDYFLMRPRRXXXXXXXXXXXXT 300
           YRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVDYFLMRPRR            T
Sbjct: 241 YRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVDYFLMRPRRISSASSIESAAAT 300

Query: 301 XXXXXXXXXQLTSVGESNYDNNNDSIGERSNAVTFALXXXXXXXXXXXXXYGDQPNLGSN 360
                    QLTSVGESNYDNNNDSIGERSNAVTFAL             YGDQPNLGSN
Sbjct: 301 PLPKPNPPPQLTSVGESNYDNNNDSIGERSNAVTFALSSTISNDSMSNSSYGDQPNLGSN 360

Query: 361 IQKESSAVDNVQNNTTTISGNNSEHRMKSQHKALSPTVAYTPLMLTQESRTLSALTSKKR 420
           IQKESSAVDNVQNNTTTISGNNSEHRMKSQHKALSPTVAYTPLMLTQESRTLSALTSKKR
Sbjct: 361 IQKESSAVDNVQNNTTTISGNNSEHRMKSQHKALSPTVAYTPLMLTQESRTLSALTSKKR 420

Query: 421 RLSGSES 427
           RLSGSES
Sbjct: 421 RLSGSES 427

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  224 bits (570), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 119/229 (51%), Positives = 151/229 (65%), Gaps = 4/229 (1%)

Query: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGNY 116
           I LP KF +C R DL VLISRML  LI+IND+ A      +   TRFHSRV PGIS+ NY
Sbjct: 33  IYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSKPENARGLTRFHSRVPPGISVYNY 92

Query: 117 LLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLS 176
           L+RLTK+  L+  VLLTAVYYIDLLS+V+P F+ +SLT HRF+LTA  VASK LCDS  +
Sbjct: 93  LIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVASKGLCDSFCT 152

Query: 177 ITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKESG 236
            THYAK GGV  +EL +LE  FLK + YR+LPRD N D C +E     F L + + +   
Sbjct: 153 NTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFTLYE-EPEMGQ 211

Query: 237 TSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVDYFLMRP 285
            S     L +SGYNVL  Y+R+I+ ++G     + SPD   V  +++RP
Sbjct: 212 NSRPQNSLKNSGYNVLDAYFRKIVQLVG---SYASSPDKSKVVNYVLRP 257

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  219 bits (559), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 159/243 (65%), Gaps = 20/243 (8%)

Query: 46  ITDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHS 105
           +T A      +I LP +F++C R  LVVLISRML +LI++ND+   D NL     TRFHS
Sbjct: 36  LTQAPEQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKNLK---LTRFHS 92

Query: 106 RVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIV 165
           RV PGIS+ NYL+RL K+  L+P+VL+ AVYYIDLLS+V+PSF+ NSLT HRF+LTA  V
Sbjct: 93  RVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTV 152

Query: 166 ASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYH---F 222
           ASK L DS  +  HYAK GGVQ +EL +LE  FLK + YR++PRD N   C  EY    F
Sbjct: 153 ASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVF 212

Query: 223 DTFALNDGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVDYFL 282
            TF L D +IK           P++G+NVL  YY+++I ++G   P + SPD  +   ++
Sbjct: 213 ITFPLAD-KIKG----------PNNGFNVLDTYYKKMIQLVG---PSNSSPDKTSKVSYV 258

Query: 283 MRP 285
           + P
Sbjct: 259 LEP 261

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  218 bits (556), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 157/249 (63%), Gaps = 8/249 (3%)

Query: 36  STQSHSTPNVITDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNL 95
           ST    + N+  D   PK   + LP  F +C R DLVVLISRMLV+LI IN+  A   + 
Sbjct: 3   STSGERSENIHEDQGIPK---VILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSD 59

Query: 96  PSNYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTA 155
                TR+HS++ P ISI NY +RLTKF  L+  VL+T++YYIDLL  V+P F+ NSLTA
Sbjct: 60  DQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTA 119

Query: 156 HRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDL 215
           HRF+LTA  VA+K LCDS  +  HYAK GGV+ +EL +LE  FLK + YR++PRD N  L
Sbjct: 120 HRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITL 179

Query: 216 CSMEYHFDTFALNDGQIKESG-TSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPD 274
           CS+E     F ++   +      S+SY   P SGYNVL  YYRRI+ ++G     + SPD
Sbjct: 180 CSIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVG---SFNASPD 236

Query: 275 -AVTVDYFL 282
            +  VDY L
Sbjct: 237 KSRKVDYVL 245

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  217 bits (553), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 159/245 (64%), Gaps = 12/245 (4%)

Query: 47  TDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYA-TRFHS 105
           TD E P    I LP  F++CP+ DLV+LI+RML  +I+IND+   +N     Y  TRFHS
Sbjct: 10  TDEEIPT---IKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENE--RKYGLTRFHS 64

Query: 106 RVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIV 165
           ++ P IS+ NY  RLTK+ +L+ SVLL+AVYYIDLLS V+P+F+ NSLTAHRF+LTA  +
Sbjct: 65  KIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTI 124

Query: 166 ASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTF 225
           ASK LCDS  + THY+K GGVQ NEL +LE  FL+ + YR++PRD N   C ME   + F
Sbjct: 125 ASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFF 184

Query: 226 ALNDGQIKESGTSF--SYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAV-TVDYFL 282
            L +    +   S    Y  + ++GYNVL  YY +II+++G     S SPD    V+Y +
Sbjct: 185 ILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVG---KYSSSPDKTKKVNYDI 241

Query: 283 MRPRR 287
             P +
Sbjct: 242 DMPAK 246

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  213 bits (542), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 151/231 (65%), Gaps = 9/231 (3%)

Query: 56  KITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYAT--RFHSRVIPGISI 113
           K+ LP  F +C R DLVVLISRMLV+LI IN+   +   +P N  T  R+HS++ P ISI
Sbjct: 20  KVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVS--KIPENQITLTRYHSKIPPNISI 77

Query: 114 GNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDS 173
            NY +RLTKF  L+  VL+T++YYIDLL   +P F+ NSLTAHRF+LTA  +A+K LCDS
Sbjct: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLCDS 137

Query: 174 CLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIK 233
             +  HYAK GGV+ +EL +LE  FLK + YR++PRD N  LCS+E     F ++   + 
Sbjct: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKNALG 197

Query: 234 ESG-TSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPD-AVTVDYFL 282
                S+SY   P SGYNVL  YYRRI+ ++G     + SPD +  +DY L
Sbjct: 198 SFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVG---SFNASPDKSKKIDYVL 245

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  213 bits (542), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 118/232 (50%), Positives = 151/232 (65%), Gaps = 11/232 (4%)

Query: 56  KITLPIKFMECPRRDLVVLISRMLVTLIKIND---TKANDNNLPSNYATRFHSRVIPGIS 112
           K+ LP +F +C R DLVVLISRMLV+LI IN+   TK  D+ +     TR+HS+V P IS
Sbjct: 20  KVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQIT---LTRYHSKVPPNIS 76

Query: 113 IGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCD 172
           I NY +RLTKF  L+  VL+T++YYIDLL   +P F+ NSLTAHRF+LTA  VA+K LCD
Sbjct: 77  IFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCD 136

Query: 173 SCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQI 232
           S  +  HYAK GGV+ +EL +LE  FLK + YR++PRD N  LCS+E     F  +    
Sbjct: 137 SFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNAP 196

Query: 233 KESG-TSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPD-AVTVDYFL 282
                 S+SY   P SGYNVL  YYRRI+ ++G     + SPD +  VDY L
Sbjct: 197 GSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVG---SFNASPDKSKKVDYVL 245

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  211 bits (536), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 151/229 (65%), Gaps = 14/229 (6%)

Query: 56  KITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGN 115
           ++ LP  F +CPR DLV+LISRML  LI+IND+   DN   S+  TRFHSRV P IS+ +
Sbjct: 31  EVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDN---SSELTRFHSRVPPQISVYD 87

Query: 116 YLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCL 175
           YL+RLT++  L+P+VL+ +VYYIDLLSA++ +FS NSLT HRF+LTA  V SK LCDS  
Sbjct: 88  YLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFC 147

Query: 176 SITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKES 235
           + +HYAK GGVQ +EL +LE+ FLK + YR+LPRD N   C  E     F         +
Sbjct: 148 TNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLFV--------T 199

Query: 236 GTSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVDYFLMR 284
            T     + P++G+NVL  YY++II+I+G       SPD     +++M+
Sbjct: 200 ATYAKENRGPNNGFNVLDTYYQKIIEIVGS---YDSSPDKTKRAHYVMK 245

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  210 bits (534), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 113/223 (50%), Positives = 147/223 (65%), Gaps = 10/223 (4%)

Query: 56  KITLPIKFMECPRRDLVVLISRMLVTLIKIND---TKANDNNLPSNYATRFHSRVIPGIS 112
           KI LP +F +C R DLVVLISRMLV+LI IN+   TK  D+ +     TR+HS++ P IS
Sbjct: 20  KIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQIT---LTRYHSKIPPNIS 76

Query: 113 IGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCD 172
           I NY +RLTKF  L+  VL+T++YYIDLL   +P F+ NSLTAHRF+LTA  VA+K LCD
Sbjct: 77  IFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCD 136

Query: 173 SCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQI 232
           S  +  HY+K GGV+ +EL +LE  FLK + YR+LPRD N  LCS+E    TF ++   +
Sbjct: 137 SFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDKNAL 196

Query: 233 KESG-TSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPD 274
                 S+SY     SGYNVL  YY+RI+ ++G       SPD
Sbjct: 197 GSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVG---SFDASPD 236

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  207 bits (527), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 147/228 (64%), Gaps = 14/228 (6%)

Query: 56  KITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGN 115
           ++ LP  F +C R DLV+LISRML  L +IND+   D+   +   TRFHSRV P IS+ +
Sbjct: 31  EVALPEDFSQCSRTDLVILISRMLSFLTRINDSVPKDD---AKELTRFHSRVPPQISVYD 87

Query: 116 YLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCL 175
           Y++RLT++  L+P+VL+ +VYYIDLLSA++PSFS NSLT HRF+LTA  VASK LCDS  
Sbjct: 88  YMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFC 147

Query: 176 SITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKES 235
           + +HYAK GGVQ +EL +LE+ FLK + YR+LPRD N   C  E     F          
Sbjct: 148 TNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTPTYSKSCR 207

Query: 236 GTSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVDYFLM 283
           G        P++G+NVL  YYR+II+I+G       SPD     +++M
Sbjct: 208 G--------PNNGFNVLDTYYRKIIEIVG---SFDSSPDKTKRAHYVM 244

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  208 bits (529), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 145/226 (64%), Gaps = 19/226 (8%)

Query: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKIND-----------------TKANDNNLPSNY 99
           ++LP  F  C R DL+ LISRMLV LI+IND                 T A D +  S  
Sbjct: 24  VSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSET 83

Query: 100 A-TRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRF 158
             TRFHS V P IS+ NYL+RLTK+  L+PSVLLT++YYIDLLS+V+P+F+ NSLT HRF
Sbjct: 84  KLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVHRF 143

Query: 159 ILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSM 218
           +LTA  VASK LCDS  +  HYAK GGVQ +EL +LE+ FLK I YRVLPRD N   C  
Sbjct: 144 LLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWCKY 203

Query: 219 EYHFDTFALNDGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIG 264
           E+    F + +     + +  ++ Q  +SGYNVL MYY +II ++G
Sbjct: 204 EHRAHEFTIYNKAALTNVSKPTHTQ-RNSGYNVLQMYYHKIIQLVG 248

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  209 bits (533), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 153/223 (68%), Gaps = 7/223 (3%)

Query: 49  AENPKHVKITL---PIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSN---YATR 102
           AE+P   KI +   P ++++C R DLVVL+SRMLV LI+ ND  +N +N  S+   + TR
Sbjct: 18  AESPMTSKIQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDSNMHLTR 77

Query: 103 FHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTA 162
           FHSR+ P ISI NYL RLTK+C ++  VLL+ +YYIDL +A +P+F+FNSLTAHRF+LTA
Sbjct: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTA 137

Query: 163 VIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHF 222
           + VA K LCDS  +   YAK GGVQ  EL +LE YFL+++ YR++PR  N  L  +E   
Sbjct: 138 ITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGN 197

Query: 223 DTFALNDGQIKESGTSF-SYRQLPHSGYNVLHMYYRRIIDIIG 264
             F L+   +K+   SF SY  LP +GY+VL++YY+ I+ I G
Sbjct: 198 QVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  208 bits (530), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 146/216 (67%), Gaps = 9/216 (4%)

Query: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKINDTK-ANDNNL---PSNYA----TRFHSRVI 108
           ITLP KF++C R DLV LI+RML  LI++ND   AN N L   P+N +    TRFHSRV 
Sbjct: 46  ITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHSRVP 105

Query: 109 PGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASK 168
           P IS+ NYL+RLTK+  L+  VLL+ VYYIDLLS+V+P F  NSLT HRF+LTA  +ASK
Sbjct: 106 PNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTIASK 165

Query: 169 SLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALN 228
            LCDS  + +HY+K GGV  +EL +LE  FL+ + YR++PRD N  LC +E+  + F ++
Sbjct: 166 GLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKFTMD 225

Query: 229 DGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIG 264
              +   G +       +SG+N+L +YY +I+ ++G
Sbjct: 226 FSDLSMVGMTVQSNH-QNSGFNILDIYYHKIVQLVG 260

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  206 bits (523), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 147/228 (64%), Gaps = 18/228 (7%)

Query: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKIND-----TKANDNNLPSN------------Y 99
           I LP  F++C R DLVVLISRML  LI+IND     T+ N   +P+              
Sbjct: 35  IMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNNMIN 94

Query: 100 ATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFI 159
            TRFHSRV P IS+ NYL+RLTK+  L+ SVLL+++YYIDLLS+V+P F  NSLT HRF+
Sbjct: 95  LTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVHRFL 154

Query: 160 LTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSME 219
           L A  VASK L DS  + +HYAK GGV+ +EL +LE  FL+ I YR++PRD N  LC +E
Sbjct: 155 LAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLCKLE 214

Query: 220 YHFDTFALNDGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIGVQR 267
                F L+ G +  +         P+SGYNVL++YYR+++ I+G+ +
Sbjct: 215 KKSSQFTLDLGDLLAANIQPELTH-PNSGYNVLNIYYRKMVQIVGLLK 261

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  202 bits (513), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 151/227 (66%), Gaps = 12/227 (5%)

Query: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGNY 116
           I LP +++ C R  LVV+ISRML  LI+IND  AN+    +   TRFHS+  P I++  Y
Sbjct: 19  IPLPEEYLRCSRTHLVVIISRMLSFLIQIND--ANNAGNQTMELTRFHSKAAPSITVYQY 76

Query: 117 LLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLS 176
           L+RLTK+  L+ SVLL+AVYYIDLLSAV+P F+ NSLT HRF+LTA  +ASK LCDS  +
Sbjct: 77  LIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCT 136

Query: 177 ITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKESG 236
            THY+K GGVQ +EL +LE  FL+ ++YR++PRD N + C +E    +  L    I    
Sbjct: 137 NTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNML----IPMKN 192

Query: 237 TSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAVTVDYFLM 283
            S   ++ P +G+NVL  YYR+I+ ++G   P++ SPD  +  +F M
Sbjct: 193 AS---QRGPDNGFNVLQNYYRKIVQLVG--NPLN-SPDKTSTYFFKM 233

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  201 bits (511), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 104/210 (49%), Positives = 137/210 (65%), Gaps = 2/210 (0%)

Query: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGNY 116
           + LP +F EC R DLV+LISRML  LI++ND+ +          T+FHS+V PGIS+ NY
Sbjct: 45  VILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISVYNY 104

Query: 117 LLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLS 176
           L+RLTK+  L   VL+ AVYYIDL+S+V+P+F+ NSLT HRF+LTA  VASK LCDS  +
Sbjct: 105 LMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDSFCT 164

Query: 177 ITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALN--DGQIKE 234
            THYAK GGV  +EL +LE   L+ I YR++PRD N   C++E     F L+  DG    
Sbjct: 165 NTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGDDWT 224

Query: 235 SGTSFSYRQLPHSGYNVLHMYYRRIIDIIG 264
              S       +SGYNVL  YY +I+ ++G
Sbjct: 225 PILSNLSGNRNNSGYNVLDTYYNKIVQLVG 254

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  200 bits (508), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 141/221 (63%), Gaps = 14/221 (6%)

Query: 56  KITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGN 115
           +  LP KF++C R  LVVLISRML +LI++ND     N L     TRFHSRV P IS+ +
Sbjct: 22  EFRLPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTESNTL---QLTRFHSRVPPSISVYD 78

Query: 116 YLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCL 175
           YL+RLTK+  L+  VLL +VYYIDLLS+VFP F  +SLT HRF+LTA  VASK LCDS  
Sbjct: 79  YLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDSFC 138

Query: 176 SITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALND--GQIK 233
           + THYAK GGVQ NEL +LE  FL  + YR+LPRD+N   CS E+   TF+  +     +
Sbjct: 139 TNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPADAE 198

Query: 234 ESGTSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPD 274
           +   S   R      ++VL  YY R+I +IG    +  SPD
Sbjct: 199 QDQKSEENR------FDVLENYYHRMIHLIG---NLDASPD 230

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  195 bits (495), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 103/215 (47%), Positives = 141/215 (65%), Gaps = 15/215 (6%)

Query: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSN-----YATRFHSRVIPGI 111
           + L   FM+C + DL+ LISRML   I IND+     N+ +N     + TRFHS+V P I
Sbjct: 12  VVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNI 71

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLC 171
           SI +YL+RLTK+  L+ SVL+T+VYYIDLLS V+P FS NSLT HR++LTA  +ASK LC
Sbjct: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLC 131

Query: 172 DSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFAL--ND 229
           DS  + +HYAK GG++ NEL +LE  FL+ ++YRV+PRD    LC +EY +       ND
Sbjct: 132 DSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPIEDINND 191

Query: 230 GQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIG 264
             I +        +L +SGYNVL  YY +++ ++G
Sbjct: 192 IHIPD--------ELQNSGYNVLSTYYNKMVQLVG 218

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  194 bits (494), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 143/226 (63%), Gaps = 14/226 (6%)

Query: 39  SHSTPNVITDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSN 98
           SH T   +T+ E        LP +F+ C R  LVVLISRML +LI +ND +  D + P  
Sbjct: 6   SHETSESVTEME--------LPRQFLSCSRTYLVVLISRMLTSLIGMNDAQG-DKSKPIK 56

Query: 99  YATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRF 158
             TRFHSRV P IS+ NYL+RLTK+  L+  VLL +VYYIDLL+ V+P F  +SLT HRF
Sbjct: 57  L-TRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRF 115

Query: 159 ILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSM 218
           +LTA  VASK LCDS  + THYAK GGVQ +EL +LE  FL+ + YR+LPRD N   CS+
Sbjct: 116 LLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSL 175

Query: 219 EYHFDTFALNDGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIG 264
           E     F+ ++  + +        Q  ++G+ VL  YY R+I +IG
Sbjct: 176 ERQERIFSYSNIPMDKDCA----LQDRNNGFGVLEKYYHRMIHLIG 217

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 99/212 (46%), Gaps = 27/212 (12%)

Query: 11  KPDNNICQDSNINVNKTSNTSSDTPSTQSHSTP---NVITDAENPKHVKITLPIKFMECP 67
           KP+  +  D    +      S D+P       P    V TD +  +H+ I    KF   P
Sbjct: 144 KPEKGLTDDITSQIE-----SQDSPQVIEFVHPARREVYTDTKG-EHMDIA---KF---P 191

Query: 68  RRDLVVLISRMLVTLIKINDT----KANDNNLPSNYATR---FHSRVIPGISIGNYLLRL 120
              L+ +++ +L  +IK ND     +   +++ S Y      F  + IP I++G+Y  R+
Sbjct: 192 TDKLLEMLTSLLYKIIKSNDRLKSFEQEKHDINSKYVAHVLSFRGKHIPAITLGDYFARI 251

Query: 121 TKFCILQPSVLLTAVYYIDLLS----AVFPS-FSFNSLTAHRFILTAVIVASKSLCDSCL 175
            K+C +   V L+ + Y D ++    A+ P  F  +S   HR I+ AV V++K   D   
Sbjct: 252 QKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFY 311

Query: 176 SITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
           S + YA+ GG+  +EL  LE  F  L  + ++
Sbjct: 312 SNSRYARVGGISLHELNRLELQFSILCDFELI 343

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 79/166 (47%), Gaps = 19/166 (11%)

Query: 61  IKFMECPRRDLVVLISRMLVTLIKINDTKAN-DNNLPSNYATRF-------HSRVIPGIS 112
           +  ++ P  +L++++S +L  +I +ND   +    +P +   +F       + + +P I 
Sbjct: 100 LNIVDFPTDELIIMVSALLNKIITVNDATTDISQQVPGDTEEKFLTPILAFYGKNVPEID 159

Query: 113 IGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPS-----------FSFNSLTAHRFILT 161
           +  YL R+ K+C     + L+ + Y D +S  +             F  +S   HR ++T
Sbjct: 160 VVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMDSGNIHRLLIT 219

Query: 162 AVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
            + + +K L D   S + YAK GG+   EL  LE  FL L  +++L
Sbjct: 220 GITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 85/186 (45%), Gaps = 28/186 (15%)

Query: 61  IKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATR------------FHSRVI 108
           +  ++ P  +L++++S +L  ++K ND   +    PS                 F+ + +
Sbjct: 101 LNIVDFPTDELILMVSALLNKIVKANDETTD----PSQQVVEDGEDELLAPVLAFYGKNV 156

Query: 109 PGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPS-----------FSFNSLTAHR 157
           P I++  YL R+ K+C     + L+ + Y D +S  + S           F  +S   HR
Sbjct: 157 PEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHR 216

Query: 158 FILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL-PRDKNTDLC 216
            ++T + + +K + D   S + YAK GG+   EL  LE  FL L  +++L  R++     
Sbjct: 217 LLITGITICTKFMSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLLVSREEMQKYA 276

Query: 217 SMEYHF 222
            + Y F
Sbjct: 277 DLLYKF 282

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 93/211 (44%), Gaps = 31/211 (14%)

Query: 23  NVNKTSNTSSDTPSTQSHSTPNVITDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTL 82
           +V+ + +T +D P  Q    PN       PK  ++   I+    P   L+ +++ +L  +
Sbjct: 228 SVSNSYSTHNDRPLKQRAPVPN-----SEPKLSEVPELIQIATFPTDRLLSMLTALLDKI 282

Query: 83  IKIND------------------TKANDNNLPSNYATR---FHSRVIPGISIGNYLLRLT 121
           +K ND                  T+  DN+   N A+    F  + +P I++  Y  R+ 
Sbjct: 283 VKSNDQLNRDRPFDEDQFLASARTEDADNDTRPNIASEILSFRGKHVPAITLQQYFQRIQ 342

Query: 122 KFCILQPSVLLTAVYYIDLLSAVFPS-----FSFNSLTAHRFILTAVIVASKSLCDSCLS 176
           K+C     V L+ + Y D ++          F  +S   HR I++AV V++K   D   S
Sbjct: 343 KYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYS 402

Query: 177 ITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
            + YA+ GG+   EL  LE  FL L  + ++
Sbjct: 403 NSRYARVGGISLKELNHLELQFLVLCDFELI 433

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 77/155 (49%), Gaps = 12/155 (7%)

Query: 65  ECPRRDLVVLISRMLVTLIKIND-------TKANDNNLPSNYATRFHSRVIPGISIGNYL 117
           + P   L+ +++ +L  +IK ND        K + NN    +   F  + IP I++G+Y 
Sbjct: 20  QFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLGDYF 79

Query: 118 LRLTKFCILQPSVLLTAVYYIDLLS----AVFPS-FSFNSLTAHRFILTAVIVASKSLCD 172
            R+ K+C +   V L+ + Y D ++    A+ P  F  +S   HR I+ AV V++K   D
Sbjct: 80  ARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSD 139

Query: 173 SCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
              S + YA+ GG+   EL  LE  F  L  + ++
Sbjct: 140 FFYSNSRYARVGGISLEELNRLELQFSILCDFELI 174

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 76/158 (48%), Gaps = 21/158 (13%)

Query: 70  DLVVLISRMLVTLIKIND---------TKANDNNLPSNYATRFHSRVIPGISIGNYLLRL 120
           +L+ +IS +L  ++  ND         +K N + L +     F+ + +P IS+  YL R+
Sbjct: 109 ELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILA-FYGKSVPEISVVQYLERI 167

Query: 121 TKFCILQPSVLLTAVYYIDLLSAVFPSFS-----------FNSLTAHRFILTAVIVASKS 169
            K+C     + L+ + Y D +S  +  FS            +S   HR ++T + + +K 
Sbjct: 168 QKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITICTKF 227

Query: 170 LCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
           L D   S + YAK GG+   EL  LE  FL L  +++L
Sbjct: 228 LSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 99/237 (41%), Gaps = 37/237 (15%)

Query: 7   RDESKPDNNICQDSNINVN----KTSNTSSDTPSTQSHSTPNVITDAENPKHVKITLPIK 62
           R+++  ++N  QD+NI+      + SN+   TPS Q   T +  T+  N         I 
Sbjct: 167 RNDTYWEDNKEQDANISRTEPSPQLSNSKDTTPSNQ-MDTIDSETNMANKTTEDDNESIN 225

Query: 63  FMECPRRDLVVLISRMLVTLIKIND-----------------TKANDNNLPSNYATRFHS 105
             E P   L+ +++ +L  ++K ND                 ++ N NN        F  
Sbjct: 226 IAEFPTNKLLEMLTALLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAFRG 285

Query: 106 RVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLS----------AVFPS-----FSF 150
           + +P IS+  Y  R+ K+C     V L+ + Y D +S             P+     F  
Sbjct: 286 KHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFVM 345

Query: 151 NSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
           +S   HR I+  V V +K   D   S + YA+ GGV   EL  LE  FL L  + ++
Sbjct: 346 DSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 84/195 (43%), Gaps = 34/195 (17%)

Query: 61  IKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPS------------NYATRFHSRVI 108
           I     P  D++ +++ +L  ++  ND + N+   P+            N  T F+ + +
Sbjct: 233 ISIATLPIDDILQMLTALLDKIVSSND-ELNNGGPPAGCEDKQQDHDTINAITSFYGKHV 291

Query: 109 PGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVF--------------------PSF 148
           P I+I  YLLR+ K+C     + L+ + + D +S  F                     +F
Sbjct: 292 PQITIEQYLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDSDEQAPHQTF 351

Query: 149 SFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL- 207
             +S   HR ++  V V++K   D   S   YA+ GG+   E+  LE  FL L  +++L 
Sbjct: 352 VMDSYNIHRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFLILCDFKLLI 411

Query: 208 PRDKNTDLCSMEYHF 222
           P D+      + Y F
Sbjct: 412 PIDELQRYAELLYRF 426

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 75/160 (46%), Gaps = 19/160 (11%)

Query: 67  PRRDLVVLISRMLVTLIKINDTKANDNNLPSNYAT--------RFHSRVIPGISIGNYLL 118
           P  +L+++IS +L  +I  ND   + +   S+            F+ + +P I++  YL 
Sbjct: 106 PTDELILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLE 165

Query: 119 RLTKFCILQPSVLLTAVYYIDLLSAVFPS-----------FSFNSLTAHRFILTAVIVAS 167
           R+ K+C     + L+ + Y D +S  +             F  +S   HR ++T V + +
Sbjct: 166 RIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICT 225

Query: 168 KSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
           K L D   S + YAK GG+   EL  LE  FL L  +++L
Sbjct: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 16/157 (10%)

Query: 67  PRRDLVVLISRMLVTLIKINDTKANDNNLPS---NYATR---FHSRVIPGISIGNYLLRL 120
           P   L+ +++ +L  ++K ND   N N   S   +Y ++   F  + +P IS+  Y  R+
Sbjct: 295 PNNKLLNMLTSLLNKIVKSNDQLRNTNVQESAFNDYTSQVLSFRGKHVPAISLDQYFQRI 354

Query: 121 TKFCILQPSVLLTAVYYIDLLSAVF----------PSFSFNSLTAHRFILTAVIVASKSL 170
            K+C     V L+ + Y D ++               F  +S   HR I+ AV V++K  
Sbjct: 355 QKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDSYNIHRLIIAAVTVSTKFF 414

Query: 171 CDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
            D   S + YA+ GG+   EL  LE  FL L  + ++
Sbjct: 415 SDFFYSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 69/146 (47%), Gaps = 20/146 (13%)

Query: 82  LIKINDT--KANDN--------NLPSNYATRFHSRVIPGISIGNYLLRLTKFCILQPSVL 131
           ++K ND   +AND+        N  +N    FH + +P I+I  Y  R+ K+C     V 
Sbjct: 150 IVKSNDAIERANDHDTLLLDSTNPFANSLLCFHGKHVPDITIEKYFNRIQKYCPTTNDVF 209

Query: 132 LTAVYYIDLLSAVFPSFSF----------NSLTAHRFILTAVIVASKSLCDSCLSITHYA 181
           L  +   D ++    + SF          +S   HRFI+  V V +K L D   S + YA
Sbjct: 210 LLLLIAFDRIAKRCNTDSFGNKSQQLFVMDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYA 269

Query: 182 KYGGVQPNELLMLEAYFLKLIKYRVL 207
           K GG+  +E+  LE  FL L  ++++
Sbjct: 270 KVGGISVHEMNNLELQFLVLCDFKLI 295

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 77/178 (43%), Gaps = 37/178 (20%)

Query: 67  PRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATR---------FHSRVIPGISIGNYL 117
           P   L+ +++ +L  +IK ND+  +  N  ++             F  + +PGI++  Y 
Sbjct: 195 PTYKLLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYF 254

Query: 118 LRLTKFCILQPSVLLTAVYYID-------------LLSAVFPS---------------FS 149
            R+ K+C     VLL+ + + D             ++S V                  F 
Sbjct: 255 QRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFV 314

Query: 150 FNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
            +S   HR I+ A+ V++K + D   S + YA+ GG+   EL  LE  FL L  +R++
Sbjct: 315 MDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLI 372

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 5/110 (4%)

Query: 103 FHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLS-----AVFPSFSFNSLTAHR 157
           F  + +P I++  Y  R+ K+C     V L+ + Y D ++     A    F  +S   HR
Sbjct: 435 FRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHR 494

Query: 158 FILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
            I++AV V++K   D   S + YA+ GG+   EL  LE  FL L  + ++
Sbjct: 495 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 73/181 (40%), Gaps = 42/181 (23%)

Query: 61  IKFMECPRRDLVVLISRMLVTLIKINDT-----------KANDNNLPSNYATR----FHS 105
           I   +   + L+ +IS +L  LIK ND            + +D+N   +   R    F  
Sbjct: 127 IDITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRG 186

Query: 106 RVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVF-------------------- 145
           + IP I +  Y  R+ K+C     VLL  + Y D +S V                     
Sbjct: 187 KHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLR 246

Query: 146 -------PSFSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYF 198
                    F  +S   HR I++A+ V++K   D   S + YAK GG+  +E+  LE  F
Sbjct: 247 NYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQF 306

Query: 199 L 199
           L
Sbjct: 307 L 307

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 74/185 (40%), Gaps = 44/185 (23%)

Query: 67  PRRDLVVLISRMLVTLIKINDTKA-------------NDNNLPSNYATRFHSRVIPGISI 113
           P   L+ +++ +L  +IK ND  A             N+NN+  N    F  + IP IS+
Sbjct: 147 PTEKLLEMLTALLDKIIKSNDRLASSNPTLNQERELMNNNNVYLNSVLSFRGKHIPQISL 206

Query: 114 GNYLLRLTKFCILQPSVLLTAVYYIDLLS------------------------------- 142
            +Y  R+ K+C     V L+ + Y D +S                               
Sbjct: 207 EHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDMPAKQQQQTQQT 266

Query: 143 AVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLI 202
               +F  +S   HR ++  V V++K   D   S + YA+ GG+   EL  LE  FL L 
Sbjct: 267 QQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQELNHLELQFLVLC 326

Query: 203 KYRVL 207
            + +L
Sbjct: 327 DFELL 331

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 63/146 (43%), Gaps = 19/146 (13%)

Query: 81  TLIKIND-TKANDNNLPS--NYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYY 137
           TL+K+ND  +  D    S  N    F  + IP I++  Y  R+ K+C     V L+ + Y
Sbjct: 186 TLLKVNDDARDTDGYYESAVNAILSFKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIY 245

Query: 138 IDLLSAVFPS----------------FSFNSLTAHRFILTAVIVASKSLCDSCLSITHYA 181
            D +S    S                F  NS   HR I+  V V++K   D   S   YA
Sbjct: 246 FDRISEKCNSIPRGGDDDKVQDDTLLFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYA 305

Query: 182 KYGGVQPNELLMLEAYFLKLIKYRVL 207
           K GG+   E+  LE  FL L  + +L
Sbjct: 306 KVGGISLREMNYLELQFLVLCDFSLL 331

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 57/122 (46%), Gaps = 12/122 (9%)

Query: 98  NYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLL----SAVFPS------ 147
           N    F  + IP I++  Y  R+ K+C     V L+ + Y D +    ++ F +      
Sbjct: 170 NAMLSFKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNP 229

Query: 148 --FSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYR 205
             F  +S   HR I+  V V++K L D   S + YAK GG+   EL  LE  FL L  + 
Sbjct: 230 QIFVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFN 289

Query: 206 VL 207
           +L
Sbjct: 290 LL 291

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 52/119 (43%), Gaps = 14/119 (11%)

Query: 103 FHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPS--------------F 148
           F  + +P I++  Y  R+ K+C     V L+ + Y D +S    S              F
Sbjct: 352 FKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMF 411

Query: 149 SFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
             +S   HR I+  + V +K   D   S + YA+ GG+   EL  LE  FL L  + ++
Sbjct: 412 VMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 58/141 (41%), Gaps = 36/141 (25%)

Query: 103 FHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSA------------------- 143
           F  + +P IS+  Y  R+ K+C +   V L+ + Y D +S                    
Sbjct: 208 FRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADE 267

Query: 144 ----------------VFPS-FSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGV 186
                           V P  F  +S   HR I+TAV V++K   D   S + YA+ GG+
Sbjct: 268 SQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGI 327

Query: 187 QPNELLMLEAYFLKLIKYRVL 207
              EL  LE  FL L  ++++
Sbjct: 328 SLQELNHLELQFLILCDFQLM 348

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 53/119 (44%), Gaps = 14/119 (11%)

Query: 103 FHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPS--------------F 148
           F  + +P I++  Y  R+ K+C     V L+ + Y D +S    S              F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 149 SFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
             +S   HR ++  V V +K   D   S + YA+ GG+  +EL  LE  FL L  + +L
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 53/146 (36%), Gaps = 41/146 (28%)

Query: 103 FHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPS--------------- 147
           F  + IP IS+ +Y  R+ K+C     V L+ + Y D +S    S               
Sbjct: 234 FRGKHIPQISLEHYFQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTSANDAG 293

Query: 148 --------------------------FSFNSLTAHRFILTAVIVASKSLCDSCLSITHYA 181
                                     F  +S   HR I+    V++K   D   S + YA
Sbjct: 294 NNNNGHDNVKQQVHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYA 353

Query: 182 KYGGVQPNELLMLEAYFLKLIKYRVL 207
           + GG+   EL  LE  FL L  + +L
Sbjct: 354 RVGGISLQELNYLELQFLILCDFELL 379

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 126 LQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSLCDSCLSITHYAKY- 183
           +Q   L+T V Y+  L A+ PS  +    T HR  L  +I+A+K+L DS     H+AKY 
Sbjct: 66  VQTPTLMTTVVYLKKLKAIIPSNVYGIETTRHRMFLGCLIIAAKTLNDSSPLNKHWAKYT 125

Query: 184 -GGVQPNELLMLEAYFLKLIKY 204
            G +Q  E+  +E   L   K+
Sbjct: 126 NGLLQLREVNTIEREILTYFKW 147

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 57/115 (49%), Gaps = 5/115 (4%)

Query: 105 SRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAV 163
           + +IP +S  N++  L K   +Q   L+    Y+  L ++ P   +    T HR  L  +
Sbjct: 44  AHIIPTLS--NFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIETTRHRIFLGCL 101

Query: 164 IVASKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLC 216
           I+A+K+L DS     H+A+Y  G +Q  E+  +E   L+   + V  + K+  +C
Sbjct: 102 ILAAKTLNDSSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIIC 156

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 31/60 (51%)

Query: 148 FSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
           F  +S   HR I+  V VA+K   D   S   YAK GG+   EL  LE  FL L  +++L
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 47/114 (41%), Gaps = 21/114 (18%)

Query: 61  IKFMECPRRDLVVLISRMLVTLIKINDTKA--------NDNNLPSNYATR---------- 102
           +   E P   L+ +++ +L  +IK ND  A        N N  P N  T           
Sbjct: 381 LNIAEFPTTKLLEMLTALLNKIIKSNDCLAGIQPDALTNVNTPPQNLTTNNGEVPNYLSS 440

Query: 103 ---FHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSL 153
              F  + IP I++  Y  R+ K+C +   V L+ + Y D +S    + S N +
Sbjct: 441 ILSFRGKHIPQITLFQYFQRIQKYCPISNDVFLSLLVYFDRISKRCNTISSNDV 494

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 45/113 (39%), Gaps = 8/113 (7%)

Query: 103 FHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPS--------FSFNSLT 154
           F  +  P +S  +++ R+   C   P V L A Y +  L  +           F F    
Sbjct: 340 FKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKLRFKFEKSD 399

Query: 155 AHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
            HR I+  V +A+K L D   S  ++ K  G+    L  LE   L  +K   L
Sbjct: 400 VHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLLLCLKNECL 452

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 75/186 (40%), Gaps = 44/186 (23%)

Query: 76  SRMLVTLIKINDTKANDN-----------NLPSNYATRFHSRVIPG----ISIGNYLLRL 120
           +RM++ ++K  D K ++N           N+P++         +      I +  YL  L
Sbjct: 114 TRMIIQVLKKIDRKFDENYENGLIHYQKINIPADDIKHVLQSFLGNHRLKIELEEYLNTL 173

Query: 121 TKFCILQPSVLLTAVYYID-LLSAVF-------PSFSF----------------NSLTAH 156
            + C +    LL  + Y+D ++  ++       P + F                NS T H
Sbjct: 174 QRHCPMNTIDLLALLIYLDRIIQNLYKYPLDKKPIYQFMASRFQHKQTCLSRIVNSCTVH 233

Query: 157 RFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLP-----RDK 211
           R IL  + V+SK L D   S   YA+  G+   EL  LE  FL+L  + +        D 
Sbjct: 234 RLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNLSVSLNELEDY 293

Query: 212 NTDLCS 217
            T LCS
Sbjct: 294 GTALCS 299

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%)

Query: 148 FSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
           F  +S   HR I+  + V++K L D   S + Y++ GG+   EL  LE  FL L  + +L
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 53/131 (40%), Gaps = 24/131 (18%)

Query: 33  DTPSTQSHSTPNVITDAE--NPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDTKA 90
           D  + QS +  + I D +  NP+    T  +   E P   L+ +++ +L  +IK ND  A
Sbjct: 130 DARTVQSSTQEDKILDGDRSNPQ---ATPSLNIAEFPTDKLLKMLTALLTKIIKSNDRTA 186

Query: 91  NDN----------------NLPSNYAT---RFHSRVIPGISIGNYLLRLTKFCILQPSVL 131
             N                +    Y +    F  + +P I +  Y  R+ K+C     V 
Sbjct: 187 ATNPSLTQEIENGRCLTLTDDEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVF 246

Query: 132 LTAVYYIDLLS 142
           L+ + Y D +S
Sbjct: 247 LSLLVYFDRIS 257

>Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W
           (REAL)
          Length = 434

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 63/142 (44%), Gaps = 12/142 (8%)

Query: 70  DLVVLISRMLVTLIKINDTKA---NDNNLPSNYATRFHSRVIPGISIGNYLLRLTKFCIL 126
           D +   S  +  L+K++D +    + N++       F+ +  P +S  ++L R+   C  
Sbjct: 264 DALANFSETIELLLKLSDDEKCTISKNDVEKKEYANFYMKSKPSLSSVDFLRRIQDKCEY 323

Query: 127 QPSVLLTAVYYIDLL---------SAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLSI 177
           +P+V L A + +D L         +A+           HR I+ +V +++K L D   S 
Sbjct: 324 EPAVYLVATFLMDTLFLTRNERNNNALQLKLKLQEKEVHRVIIASVRLSTKLLEDFVHSH 383

Query: 178 THYAKYGGVQPNELLMLEAYFL 199
            +++K  GV    L  LE   L
Sbjct: 384 EYFSKVCGVSKRLLSKLEISLL 405

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%)

Query: 148 FSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
           F  +S   HR I+  + V++K L D   S + Y++ GG+   EL  LE  FL L  + +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 53/127 (41%), Gaps = 20/127 (15%)

Query: 35  PSTQSHSTPNVITDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDTKA---- 90
           P+ QS +  + I D +   + ++T  +   E P   L+ +++ +L  +IK ND  A    
Sbjct: 137 PTDQSSTQEDKILDGD-ISNQQVTPSLNIAEFPTDKLLKMLTALLTKIIKSNDRTAATNP 195

Query: 91  -------NDNNLPSNYATR--------FHSRVIPGISIGNYLLRLTKFCILQPSVLLTAV 135
                  N   L    + R        F  + +P I +  Y  R+ K+C     V L+ +
Sbjct: 196 SLTQEIENGKCLTLTDSERKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLL 255

Query: 136 YYIDLLS 142
            Y D +S
Sbjct: 256 VYFDRIS 262

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%)

Query: 148 FSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
           F  +S   HR I+  + V++K L D   S + Y++ GG+   EL  LE  FL L  + +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 60/150 (40%), Gaps = 22/150 (14%)

Query: 12  PDNNICQDSNINVNKTSNTSSDTPSTQSHSTPNVITDAENPKHVKITLPIKFMECPRRDL 71
           P NN  Q S+   N  +     T + QS +  + I D +   + ++T  +   E P   L
Sbjct: 116 PKNNERQLSD--TNNLNEKVQGTHTVQSSTQEDKILDGD-TSNSQVTPSLNIAEFPTDKL 172

Query: 72  VVLISRMLVTLIKINDTKANDN-------------NLPSNYAT------RFHSRVIPGIS 112
           + +++ +L  +IK ND  A  N              L  N          F  + +P I 
Sbjct: 173 LKMLTALLTKIIKSNDRTAATNPSLTQEIENGRCLALSDNEKKYLSPVLGFRGKHVPQIG 232

Query: 113 IGNYLLRLTKFCILQPSVLLTAVYYIDLLS 142
           +  Y  R+ K+C     V L+ + Y D +S
Sbjct: 233 LDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 262

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%)

Query: 148 FSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
           F  +S   HR I+  + V++K L D   S + Y++ GG+   EL  LE  FL L  + +L
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 44/114 (38%), Gaps = 22/114 (19%)

Query: 48  DAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDN-------------N 94
           D  NP+    T  +   E P   L+ +++ +L  +IK ND  A  N              
Sbjct: 156 DKSNPQ---ATPSLNIAEFPTDKLLKMLTALLTKIIKSNDRTAAANPSLTQEIENGKSPT 212

Query: 95  LPSNYAT------RFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLS 142
           L  N          F  + +P I +  Y  R+ K+C     V L+ + Y D +S
Sbjct: 213 LTDNEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRIS 266

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 52/109 (47%), Gaps = 8/109 (7%)

Query: 120 LTKFC----ILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCL 175
           +T  C    +  P+++ T VY   L + + P+      T HR  L  +I+ASK+L DS  
Sbjct: 53  ITNLCLKSNVQTPTLMATTVYLKKLKNIIPPNVYGIESTRHRIFLGCLILASKTLNDSSP 112

Query: 176 SITHYAKY--GGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHF 222
              H+A+Y  G +Q  E+  +E   L+   + +  +    DL S   HF
Sbjct: 113 LNKHWARYTSGILQLREVNTIERELLEYFDWNI--QITTDDLVSSLEHF 159

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 5/115 (4%)

Query: 111 ISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTA-HRFILTAVIVASKS 169
           +S+ +++  L K   +Q   L++ V Y+  L ++ P+  +   T+ HR  L  +I+A+K+
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIETSRHRMFLGCLILAAKN 102

Query: 170 LCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHF 222
           L DS     H+ +Y  G +   E+  +E   L+   + +  R  N DL S   HF
Sbjct: 103 LNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNL--RITNQDLISCLSHF 155

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%)

Query: 148 FSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
           F  +S   HR I+  V V++K   D   S + YA+ GG+   EL  LE  FL +  + +L
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%)

Query: 86  NDTKANDNNLPSNYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLS 142
           ND   N +N  +     F  + IP IS+  Y  R+ K+C +   V ++ + Y D +S
Sbjct: 25  NDLLMNKDNSMAQSVLSFRGKHIPQISLEQYFQRIQKYCPITNDVFISLLVYFDRIS 81

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 3/79 (3%)

Query: 107 VIPGISIGNYLLRLTKFCILQ-PSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVI 164
            +P   +  ++ RL K   +Q P+++ T+VY + L S + PS  +    T HR  L  +I
Sbjct: 43  ALPAPPLVKFINRLIKHSNVQTPTLMATSVYLVKLRS-IIPSNVYGIETTRHRIFLGCLI 101

Query: 165 VASKSLCDSCLSITHYAKY 183
           +A+K+L DS     H+A+Y
Sbjct: 102 LAAKTLNDSSPLNKHWAEY 120

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           S+  ++ RL ++  +    LLTAV Y++ L  + P  +     T HR  L  +I+++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 171 CDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKY 204
            DS     H+AKY  G     ++ ++E   L+L+ +
Sbjct: 114 NDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           S+  ++ RL ++  +  S LLT V Y++ L  + PS +     T HR  L  +I+++K  
Sbjct: 58  SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLACLILSAKYH 117

Query: 171 CDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKY 204
            DS     H+ KY  G     ++ ++E   L+L ++
Sbjct: 118 NDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEW 153

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 3/103 (2%)

Query: 107 VIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIV 165
            +P   +  ++ RL K   +Q   L+    Y+  L ++ PS  +    T HR  L  +I+
Sbjct: 43  ALPAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLIL 102

Query: 166 ASKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRV 206
           A+K+L DS     H+A+Y  G +   E+  +E   L+   + V
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDV 145

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 7/128 (5%)

Query: 92  DNNLPSNYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN 151
           +N LPS   +  +S+     S+  ++ +L ++  +  S LLT   Y+  L  + P  + N
Sbjct: 37  NNELPSPPVSPGNSKESKLPSLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPKDA-N 95

Query: 152 SL--TAHRFILTAVIVASKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRVL 207
            L  T HR  L  +I+++K   DS     H+A+Y  G     ++ ++E   L L+ + + 
Sbjct: 96  GLPSTIHRIFLACLILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDI- 154

Query: 208 PRDKNTDL 215
            R K  DL
Sbjct: 155 -RIKEEDL 161

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 3/103 (2%)

Query: 107 VIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIV 165
            +P   +  ++ RL K   +Q   L+    Y+  L ++ PS  +    T HR  L  +I+
Sbjct: 43  ALPAPPLTEFINRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIETTRHRIFLGCLIL 102

Query: 166 ASKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRV 206
           A+K+L DS     H+A+Y  G +   E+  +E   L+   + V
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDV 145

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           SI  ++  L K   +Q S L+ +  Y+  L ++ P+  +    T HR  L  +I+A+KSL
Sbjct: 44  SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPANVYGIESTKHRIFLGCLILAAKSL 103

Query: 171 CDSCLSITHYAKY 183
            DS     H+ KY
Sbjct: 104 NDSSPLNKHWTKY 116

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 108 IPGISIGNYLLRLTKFCILQ-PSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVA 166
           +P  S+ N++  L     +Q P+++ TAVY   L S +  +      T HR  L  +I+A
Sbjct: 44  LPAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIETTRHRIFLGCLILA 103

Query: 167 SKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLC 216
           +K+L DS     H+A Y  G +  +E+  +E   L+   + V    K+   C
Sbjct: 104 AKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITC 155

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 128 PSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKY-GGV 186
           P+++ + VY + L   + P+      T HR  L  +I+A+K+L D+     H++K+   +
Sbjct: 65  PTLMASTVYLVRLKDILPPNIIGIETTRHRLFLGCLIIAAKTLNDNSPLNKHWSKHTNNL 124

Query: 187 QPN-ELLMLEAYFLKLIKYRV 206
            PN E+ ++E   L  +++RV
Sbjct: 125 LPNREINIIERELLSYLRWRV 145

>KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly
           similar to uniprot|P53124 Saccharomyces cerevisiae
           YGL134W PCL10 Pho85p cyclin recruits activates and
           targets Pho85p cyclin-dependent protein kinase to its
           substrate
          Length = 484

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 8/119 (6%)

Query: 95  LPSNYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLL------SAVFPSF 148
           LPS +AT F    +P ++  +YL RL       P V LTA + +  L        +    
Sbjct: 346 LPS-FAT-FVMESVPTLAYEDYLKRLHCKFSFAPIVYLTAAHLLQTLFLTRVDEELHCKH 403

Query: 149 SFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVL 207
             +    HR ++ ++ +A+K L D   S +++++  G+    L  LE  FL+ + +  L
Sbjct: 404 HLDPRQVHRLVIASIRLATKLLEDCVHSHSYFSRICGISKKLLTKLEVAFLECLNFEGL 462

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 49/101 (48%), Gaps = 3/101 (2%)

Query: 107 VIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIV 165
            IP   +  ++ +L K+  +Q   L+    ++  L ++ P+  +    T HR  L  +I+
Sbjct: 43  AIPAPKLELFIKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIETTRHRIFLGCLIL 102

Query: 166 ASKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKY 204
           ++K+L DS     H+A+Y  G +   E+  +E   L+   +
Sbjct: 103 SAKTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDW 143

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 52/103 (50%), Gaps = 4/103 (3%)

Query: 108 IPGI-SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIV 165
           IP + S+  ++ R+ ++  +Q S LL  V Y++ L  + P+ +     T HR  L  +I+
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLIL 114

Query: 166 ASKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRV 206
           ++K   DS     H+A Y  G     ++ ++E   L L+ + +
Sbjct: 115 SAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNL 157

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 104 HSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTA 162
           H R +P  S+  ++ RL ++  +  S LLTA  Y++ L  + P  +     T+HR  L  
Sbjct: 53  HKRTLP--SLMTFVTRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPSTSHRIFLAC 110

Query: 163 VIVASKSLCDSCLSITHYAKY 183
           +I+++K   DS     H+A Y
Sbjct: 111 LILSAKFHNDSSPQNKHWAAY 131

>TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON}
           Anc_5.347 YHR071W
          Length = 199

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 8/109 (7%)

Query: 135 VYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLML 194
           +Y   L +   P F+  S    R  L+ +I+A K L D+  ++  +    G+  N+L ++
Sbjct: 93  IYDGQLWNGKLPDFARCS---KRIFLSCLILAHKYLNDNSFTMKTWNMISGLSQNDLCLM 149

Query: 195 EAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKESGTSFSYRQ 243
           E + L+ + YR+L  ++  DL  +E   D+ A       E       RQ
Sbjct: 150 ERWGLEKLDYRLLVAEE--DLTKLE---DSLATKKRTFDEEVLGGEMRQ 193

>SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly
           similar to uniprot|Q6B153 Saccharomyces cerevisiae
           YPL219W PCL8 Cyclin interacts with Pho85p
           cyclin-dependent kinase (Cdk) to phosphorylate and
           regulate glycogen synthase also activates Pho85p for
           Glc8p phosphorylation
          Length = 501

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 7/85 (8%)

Query: 109 PGISIGNYLLRLTKFCILQPSVLLTAVYYIDLL-------SAVFPSFSFNSLTAHRFILT 161
           P +S   YL R+    +  P V LTA Y +  L       S +  SF       HR I+ 
Sbjct: 374 PSLSYEEYLERIHSKLMFSPVVYLTATYLLHELTLTRQQDSKLALSFPLKITQIHRIIIA 433

Query: 162 AVIVASKSLCDSCLSITHYAKYGGV 186
           ++ +A+K L D   S  +++K  GV
Sbjct: 434 SIRLAAKLLEDFVHSHAYFSKVCGV 458

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 5/105 (4%)

Query: 105 SRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAV 163
           S+ IP +++  ++ RL     +Q   L++ + Y+  L  + PS       T HR  +  +
Sbjct: 41  SQQIPSLAL--FIKRLIVHSNVQTPTLMSTLVYLTKLREIIPSDVVGIETTRHRIFIGCL 98

Query: 164 IVASKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRV 206
           I+A+KSL DS     H+ +Y  G  +  E+  +E   L+   + V
Sbjct: 99  ILAAKSLNDSSPLNRHWTQYTNGLFKIQEINTIERELLEYFNWDV 143

>CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]
           {ON} similar to uniprot|P38794 Saccharomyces cerevisiae
           YHR071w PCL5 cyclin like protein interacting with PHO85P
          Length = 229

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 46/99 (46%), Gaps = 9/99 (9%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLL-----SAV-FPSFSFNSLTAHRFILTAVIV 165
           SI N+L  +TK   +   +LL A  Y D L      A+  P F++      R +L  +I+
Sbjct: 72  SIANFLKEVTKRAHISRDILLLASIYFDKLIKSHEGAINVPEFAY---CGKRLLLVCIIL 128

Query: 166 ASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKY 204
           A K   D   S+  + +  G+    + ++E + LK + Y
Sbjct: 129 AHKFSNDITFSMRVWTQVSGLPTRSIAIMERWCLKQLNY 167

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 3/101 (2%)

Query: 109 PGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVAS 167
           P   +  ++  L  +  +Q   L+    Y+  L ++ P+  F    T HR  L  +I+A+
Sbjct: 43  PAPPLMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIETTRHRIFLGCLILAA 102

Query: 168 KSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRV 206
           K+L DS     H+A Y  G +   E+  +E   L+   + V
Sbjct: 103 KTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNV 143

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 53/105 (50%), Gaps = 5/105 (4%)

Query: 105 SRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTA-HRFILTAV 163
           S  IP  S+ +++  + K+  ++   L+ +  +++ L  + P +     TA HR  L  +
Sbjct: 39  SLAIP--SLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCL 96

Query: 164 IVASKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRV 206
           I+ASK+L DS     H+ KY  G +   E+  +E   L+ + + V
Sbjct: 97  ILASKTLNDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 45/97 (46%), Gaps = 8/97 (8%)

Query: 98  NYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLL--------SAVFPSFS 149
           +  +RF  + IP +S  +++ R+   C     V L+A Y + +L        +++   F 
Sbjct: 346 DLCSRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLERSAESNSLELKFK 405

Query: 150 FNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGV 186
                 HR I+  V +++K L D   S  +++K  GV
Sbjct: 406 LQRDGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 37.0 bits (84), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           S+  ++ RL ++  +    LLTA  Y++ L  + P  +     T HR  L  +I+++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLACLILSAKFH 113

Query: 171 CDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKY 204
            DS     H+A+Y  G     ++ ++E   L+L+ +
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           S+  ++ RL ++  +    LLTA  Y++ L  + P  +     T HR  L  +I+++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 171 CDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKY 204
            DS     H+A+Y  G     ++ ++E   L+L+ +
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 3/98 (3%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           S+  ++ RL ++  +    LL  V Y++ L  + P  +     T HR  L  +I++SK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPSTIHRLFLACLILSSKCH 113

Query: 171 CDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRV 206
            DS     H+A+Y  G     ++ ++E   L+L+ + +
Sbjct: 114 NDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDI 151

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 51/99 (51%), Gaps = 3/99 (3%)

Query: 111 ISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKS 169
           +S+ +++  L     +Q   L++ V Y+  L ++ P+  +    T HR  L  +I+A+K+
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIETTRHRIFLGCLILAAKN 101

Query: 170 LCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRV 206
           L DS     H+++Y  G +   E+  +E   L+   +++
Sbjct: 102 LNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKL 140

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 36.6 bits (83), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 65/144 (45%), Gaps = 5/144 (3%)

Query: 80  VTLIKINDTKANDNNLPSNYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYID 139
           VTL  + +T A     P +  T    +     S+  ++ +L ++  +    LLT V Y++
Sbjct: 27  VTLKVLPNTPAQQYPSPPSSPTELSGKEPRLPSLRTFITKLVRYTNVYTPTLLTTVCYLN 86

Query: 140 LLSAVFPSFSFN-SLTAHRFILTAVIVASKSLCDSCLSITHYAKY--GGVQPNELLMLEA 196
            L  + P  +     T HR  L  +I+++K   DS     H+AKY  G     ++ ++E 
Sbjct: 87  KLKRILPKDAKGLPSTIHRLFLACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMER 146

Query: 197 YFLKLIKY--RVLPRDKNTDLCSM 218
             L L+ +  RV   D   DL ++
Sbjct: 147 QLLNLLNWDLRVEQEDLILDLQTL 170

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 3/103 (2%)

Query: 107 VIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIV 165
            +P   +  ++  L K   +Q   L+    Y+  L ++ PS  +    T HR  L  +I+
Sbjct: 43  ALPAPPLTKFINGLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLIL 102

Query: 166 ASKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRV 206
           A+K+L DS     H+A+Y  G +   E+  +E   L+   + V
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDV 145

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           S+  ++ RL ++  +    LLTA  Y++ L  + P  +     T HR  L  +I+++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 171 CDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKY 204
            DS     H+A+Y  G     ++ ++E   L+L+ +
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 56/111 (50%), Gaps = 14/111 (12%)

Query: 128 PSVLLTAVYYIDLLSAVFPS--FSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKY-- 183
           P+++ T+VY ++ L +V P   +  N+ T HR  L  +I+A+K+L DS     H+  Y  
Sbjct: 65  PTLMATSVY-LNKLKSVIPKNVYGINT-TRHRIFLGCLILAAKTLNDSSPWNKHWTTYTE 122

Query: 184 GGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALNDGQIKE 234
           G ++  E+  +E   L+ + + V  R    DL       D+ +   G IKE
Sbjct: 123 GLLRIREVNTIERELLEYLNWDV--RITTPDL------IDSLSYFLGPIKE 165

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 5/102 (4%)

Query: 108 IPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVA 166
           IP +S  N++  L     +Q   L+    Y+  L  + P   +    T HR  L  +I+A
Sbjct: 50  IPPLS--NFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMETTRHRIFLGCLILA 107

Query: 167 SKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRV 206
           +K+L DS     H+ KY  G +   E+  +E   L+  ++ V
Sbjct: 108 AKTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNV 149

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 111 ISIGNYLLRLTKFCILQ-PSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKS 169
           +S+ N++  L     +Q P+++ TAVY   L S +  +      T HR  L  +I+A+K+
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 170 LCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLC 216
           L DS     H+A Y  G +   E+  +E   L+   + +    +   +C
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNLQFSTQELAIC 153

>KLLA0B02024g Chr2 (176585..178168) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|P53124 Saccharomyces
           cerevisiae YGL134W PCL10 Pho85p cyclin recruits
           activates and targets Pho85p cyclin-dependent protein
           kinase to its substrate
          Length = 527

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 48/108 (44%), Gaps = 9/108 (8%)

Query: 97  SNYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTA----VYYIDL-LSAVFPSFSF- 150
           SN    F  +  P +SI  YL R+   C   P + LTA    V Y D+        F   
Sbjct: 386 SNIRAIFQMKSAPTLSISQYLDRIESKCSFPPIIYLTASFLLVTYCDIKFDTGSGKFHLE 445

Query: 151 NSLT---AHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLE 195
           N +T    HR ++  + +A+K L D   S ++++K  G+    L  LE
Sbjct: 446 NPITESMTHRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLE 493

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 128 PSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGG-- 185
           P+++ T VY   L S + P+      T HR  L  +I+ASK+L DS     H+ +Y    
Sbjct: 61  PTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCLILASKNLNDSSPMNKHWCQYTNSL 120

Query: 186 VQPNELLMLEAYFLKLIKYRVLPRDKNTDLC 216
           +   E+  +E   L+   + +L  +K+   C
Sbjct: 121 LSLREVNTVERELLEYFNWDLLITNKDLITC 151

>Ecym_3535 Chr3 (1015509..1016621) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AEL195W
          Length = 370

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 56/112 (50%), Gaps = 5/112 (4%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           S+  ++ ++ ++  +  + LLT V Y++ L  V P  +     T+HR  L  +I+++K  
Sbjct: 115 SLTTFIAKIVRYTNVYTATLLTTVVYLNKLKKVLPKDATGIPSTSHRIFLACLILSAKFH 174

Query: 171 CDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKY--RVLPRDKNTDLCSM 218
            DS     H+ +Y  G     ++ ++E   LKL  +  RV   D + +L S+
Sbjct: 175 NDSSPLNKHWTEYTDGLFTIQDVNLMERQLLKLFDWNIRVSEHDLHENLSSL 226

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 128 PSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKY--GG 185
           P+++ TAVY   L S +  +      T HR  L  +I+A+K+L DS     H+A Y  G 
Sbjct: 61  PTLMSTAVYLSKLRSIIPANVHGMETTRHRVFLGCLIIAAKNLNDSSPMNKHWASYTNGL 120

Query: 186 VQPNELLMLEAYFLKLIKY 204
           +   E+  +E   L+   +
Sbjct: 121 LNTREVNTIERELLEYFDW 139

>TBLA0A03090 Chr1 (738446..739168) [723 bp, 240 aa] {ON} Anc_5.347
           YHR071W
          Length = 240

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 7/97 (7%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSL----TAHRFILTAVIVAS 167
           +I  +L ++ K   L  S++L +  Y    S +F     NS      + R +L ++I+A 
Sbjct: 59  TISAFLTQIIKRSKLSKSLVLYSTLY---ASKIFSKHQCNSPEFANCSKRILLLSIIIAH 115

Query: 168 KSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKY 204
           K   D+  SI  +++  G++  EL+ +E + L+ + Y
Sbjct: 116 KFNNDNTFSIKTWSQISGLKSTELINMERWCLQTLDY 152

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 126 LQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSLCDSCLSITHYAKY- 183
           +Q   L+    Y++ L  + P+  +    T HR  L  +I+A+K+L DS     H++ Y 
Sbjct: 61  VQTPTLMATTVYLNKLKNIIPTNVYGIETTRHRIFLGCLILAAKTLNDSSPWNKHWSTYT 120

Query: 184 -GGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHF 222
            G ++  E+  +E   L+   + V  +  ++DL +   HF
Sbjct: 121 EGLLKVREVNTIERELLEYFNWDV--KITSSDLINALAHF 158

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPS-FSFNSLTAHRFILTAVIVASKSL 170
           S+ +++ RL +   +  S LLT   Y++ L  + P   S    T HR  L  +I+++K  
Sbjct: 51  SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPSTVHRIFLACLILSAKFH 110

Query: 171 CDSCLSITHYAKYGGVQPNELLMLE 195
            DS     H+AKY     +EL  LE
Sbjct: 111 NDSSPLNRHWAKYT----DELFTLE 131

>KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 281

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 106 RVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVI 164
           R +P  S+  ++ RL ++  +  S LLTA  Y++ L  + P  +     T HR  L  +I
Sbjct: 83  RALP--SLMTFITRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPSTGHRIFLACLI 140

Query: 165 VASKSLCDSCLSITHYAKY 183
           +++K   DS     H+A Y
Sbjct: 141 LSAKYHNDSSPQNKHWAAY 159

>TPHA0E02750 Chr5 (574999..576816) [1818 bp, 605 aa] {ON} Anc_6.236
           YGL134W
          Length = 605

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 54/128 (42%), Gaps = 22/128 (17%)

Query: 103 FHSRVIPGISIGNYLLRLTKFCILQPS------VLLTAVYYI-----DLLSAVFPSFSFN 151
           F  +  P ++  N++ R+   C+   +      VLL +++ +     +L+   +P     
Sbjct: 469 FKMKSTPTVTYQNFIERIQSKCLFDETIYLGTIVLLQSLFLVREKETNLIKLKYP---LE 525

Query: 152 SLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIK-------- 203
               HR ++ ++ V+SK L D   S  + +K  GV    L  LE   L  IK        
Sbjct: 526 ESYVHRLLIASIRVSSKVLQDFVHSHEYISKVFGVSKRLLTKLEVSLLLCIKNEGLMISA 585

Query: 204 YRVLPRDK 211
            R+L  DK
Sbjct: 586 ERLLASDK 593

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           S+  ++ +L ++  +  S LLT V Y+  L  + P  +     T HR  L  +I+++K  
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPSTTHRIFLACLILSAKFH 114

Query: 171 CDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKY 204
            DS     H+++Y  G     ++ ++E   L+L+ +
Sbjct: 115 NDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHW 150

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 71/163 (43%), Gaps = 20/163 (12%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           S+  ++ +L ++  +  S LLT   Y+  L  + P  +     T HR  L  +I+++K  
Sbjct: 54  SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPSTIHRMFLACLIISAKYH 113

Query: 171 CDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFALN 228
            DS     H+A+Y  G     ++ ++E   L L+ + +  R    DL       D   L 
Sbjct: 114 NDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNWDL--RINENDLI-----LDLRHLL 166

Query: 229 DGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISP 271
           +  +++   S+  +++  S     H Y         +QRP+SP
Sbjct: 167 EPIMRDLEISYQRKKILKSKSEQ-HQY---------IQRPVSP 199

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 5/107 (4%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPS-FSFNSLTAHRFILTAVIVASKSL 170
           S+ +++ RL +   +  S LL    Y++ L  + P   S    T HR  L  +I+++K  
Sbjct: 87  SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPSTIHRMFLACLILSAKFH 146

Query: 171 CDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRVLPRDKNTDL 215
            DS     H+AKY  G     ++ ++E   ++L+ + +  R  N DL
Sbjct: 147 NDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDL--RVTNDDL 191

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 55/114 (48%), Gaps = 7/114 (6%)

Query: 106 RVIPGISIGNYLLRLTKFC-ILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVI 164
           R +P  SI  ++ RL ++  +   ++L TAVY   L   +    +    TAHR  L  +I
Sbjct: 49  RTLP--SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLI 106

Query: 165 VASKSLCDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLC 216
           +++K   DS     H+ KY  G     ++ ++E   L+L  + V  R  + DLC
Sbjct: 107 LSAKFHNDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNV--RVGHRDLC 158

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           S+  ++ RL ++  +    LLT V Y++ L  + P  +     T HR  L  +I+++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 171 CDSCLSITHYAKY 183
            DS     H+ KY
Sbjct: 114 NDSSPLNKHWVKY 126

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 3/84 (3%)

Query: 126 LQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSLCDSCLSITHYAKY- 183
           +Q   L+    Y++ L ++ P   +    T HR  L  +I+A+K+L DS     H+  Y 
Sbjct: 61  VQTPTLMATTVYLNKLKSIIPKNVYGIETTRHRIFLGCLILAAKTLNDSSPWNKHWTTYT 120

Query: 184 -GGVQPNELLMLEAYFLKLIKYRV 206
            G ++  E+  +E   L+   + V
Sbjct: 121 EGLLKVREVNTIERELLEYFNWDV 144

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 47/96 (48%), Gaps = 3/96 (3%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           ++  ++ +L ++  +    LL  + Y++ L  + P  +     T HR  L  +I+++K+ 
Sbjct: 55  TLREFICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPSTLHRIFLACLIISAKNH 114

Query: 171 CDSCLSITHYAKY--GGVQPNELLMLEAYFLKLIKY 204
            DS     H+ KY  G     ++ ++E + L L+ +
Sbjct: 115 NDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNW 150

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 4/82 (4%)

Query: 128 PSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSLCDSCLSITHYAKY--G 184
           P+++ T+VY ++ L  + P   +    T HR  L  +I+A+K+L DS     H+  Y  G
Sbjct: 66  PTLMATSVY-LNKLRNIIPRNVYGIETTRHRIFLGCLILAAKTLNDSSPWNKHWTTYTEG 124

Query: 185 GVQPNELLMLEAYFLKLIKYRV 206
            ++  E+  +E   L+   + V
Sbjct: 125 LLRVREVNTIERELLEYFNWDV 146

>CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {ON}
           similar to uniprot|Q08966 Saccharomyces cerevisiae
           YPL219w PCL8
          Length = 481

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 50/123 (40%), Gaps = 17/123 (13%)

Query: 92  DNNLPSNYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN 151
           DNN   +Y   F  +  P IS  +++ R+   C+    + L A Y   LL  +F +  +N
Sbjct: 338 DNNENYHY---FSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATY---LLQILFLTREYN 391

Query: 152 SL-----------TAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLK 200
                          HR I+  + +A+K L D   S  +  K  G+    +  LE   + 
Sbjct: 392 DGPLRLKHKLQQNEVHRVIVGTIRIATKLLEDFVHSHQYICKVCGISKKLMTKLELALIF 451

Query: 201 LIK 203
            +K
Sbjct: 452 CLK 454

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 8/72 (11%)

Query: 120 LTKF----CI---LQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSLC 171
           L KF    C+   +Q   L+     ++ L  + PS  +    T HR  L  +I+++KSL 
Sbjct: 49  LAKFIKNICVKSNVQTPTLMATTVLLEKLKKIIPSNVYGIESTRHRIFLGCLILSAKSLN 108

Query: 172 DSCLSITHYAKY 183
           DS     H+AKY
Sbjct: 109 DSSPLNKHWAKY 120

>TBLA0A05320 Chr1 complement(1302526..1307415) [4890 bp, 1629 aa]
           {ON} Anc_1.69 YLR189C
          Length = 1629

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 22/38 (57%), Gaps = 7/38 (18%)

Query: 19  DSNINVNKTS-------NTSSDTPSTQSHSTPNVITDA 49
           + NIN+ K S       NTS  TP T S STP V+TDA
Sbjct: 866 EENINLTKLSTGHSTKLNTSGITPETSSKSTPAVLTDA 903

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFN-SLTAHRFILTAVIVASKSL 170
           S+  ++  L ++  +    LLT V Y++ L  + P  +     T HR  L  +I+++K  
Sbjct: 54  SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 171 CDSCLSITHYAKY 183
            DS     H+ KY
Sbjct: 114 NDSSPLNKHWVKY 126

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,817,012
Number of extensions: 1852103
Number of successful extensions: 11202
Number of sequences better than 10.0: 149
Number of HSP's gapped: 11413
Number of HSP's successfully gapped: 161
Length of query: 427
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 315
Effective length of database: 40,638,807
Effective search space: 12801224205
Effective search space used: 12801224205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)