Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C026306.22ON58058028550.0
NCAS0D021606.22ON56353823070.0
TDEL0G044706.22ON54254320720.0
KAFR0A050706.22ON56453920660.0
CAGL0E02629g6.22ON54853820540.0
KNAG0F028906.22ON56354520190.0
Kpol_1037.276.22ON54654419980.0
TPHA0J003506.22ON55954419970.0
TBLA0G009706.22ON55954519900.0
YOR002W (ALG6)6.22ON54454119800.0
Smik_15.1716.22ON54454119780.0
Suva_15.1776.22ON54454119700.0
KLLA0D01221g6.22ON56653919710.0
Skud_15.1636.22ON54454119590.0
SAKL0E01364g6.22ON54154319310.0
ZYRO0C07744g6.22ON54753619240.0
KLTH0C11176g6.22ON53653318800.0
Kwal_56.224376.22ON53653418730.0
Ecym_30276.22ON54954418720.0
ACR004W6.22ON56353318480.0
CAGL0L10450g5.669ON5504163156e-30
Kwal_55.217425.669ON5554182997e-28
TBLA0A093105.669ON5464242961e-27
NCAS0G004505.669ON5704222891e-26
ZYRO0A11506g5.669ON5564202882e-26
TPHA0J013805.669ON5754222846e-26
KLTH0F17666g5.669ON5554182836e-26
KAFR0D024405.669ON5754202783e-25
ADR210C5.669ON5722672774e-25
YOR067C (ALG8)5.669ON5774162741e-24
Suva_8.1185.669ON5764142741e-24
NDAI0F005105.669ON5704232731e-24
Kpol_1018.735.669ON6214202722e-24
TDEL0B025405.669ON5694102679e-24
Smik_15.2475.669ON5772602651e-23
Skud_15.2345.669ON5772602633e-23
KNAG0L019205.669ON5684232501e-21
SAKL0G00836g5.669ON5614162472e-21
KLLA0F16621g5.669ON5614182454e-21
Ecym_40515.669ON6044192447e-21
Kpol_1014.412.30ON74174751.9
TDEL0A007302.30ON75474742.0
CAGL0C05489g2.30ON74574742.1
KLLA0D19272g2.30ON74245698.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C02630
         (580 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...  1104   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   893   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   802   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   800   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   795   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   782   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   774   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   773   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   771   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   767   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   766   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   763   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   763   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   759   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   748   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   745   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   728   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   726   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   725   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   716   0.0  
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   125   6e-30
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   119   7e-28
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   118   1e-27
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   115   1e-26
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   115   2e-26
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   114   6e-26
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   113   6e-26
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   111   3e-25
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   111   4e-25
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   110   1e-24
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   110   1e-24
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   109   1e-24
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   109   2e-24
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   107   9e-24
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   106   1e-23
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   105   3e-23
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...   100   1e-21
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   100   2e-21
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...    99   4e-21
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...    99   7e-21
Kpol_1014.41 s1014 (78673..80898) [2226 bp, 741 aa] {ON} (78673....    33   1.9  
TDEL0A00730 Chr1 complement(121965..124229) [2265 bp, 754 aa] {O...    33   2.0  
CAGL0C05489g Chr3 (528599..530836) [2238 bp, 745 aa] {ON} simila...    33   2.1  
KLLA0D19272g Chr4 (1618994..1621222) [2229 bp, 742 aa] {ON} simi...    31   8.1  

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score = 1104 bits (2855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/580 (93%), Positives = 545/580 (93%)

Query: 1   MVPKKKTLMKNGXXXXXXXXXXXXXXXXXXXXXXXMNNNQPLETETSKESFYASPLYDFL 60
           MVPKKKTLMKNG                       MNNNQPLETETSKESFYASPLYDFL
Sbjct: 1   MVPKKKTLMKNGSTSTVTSSSSQKSKVEDTKKSKKMNNNQPLETETSKESFYASPLYDFL 60

Query: 61  YPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEAQRHWMEITQYLPIS 120
           YPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEAQRHWMEITQYLPIS
Sbjct: 61  YPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEAQRHWMEITQYLPIS 120

Query: 121 QWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYEGQDLKTFMRLTVLA 180
           QWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYEGQDLKTFMRLTVLA
Sbjct: 121 QWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYEGQDLKTFMRLTVLA 180

Query: 181 SESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILIDHGHFQFNSVMLGLTV 240
           SESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILIDHGHFQFNSVMLGLTV
Sbjct: 181 SESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILIDHGHFQFNSVMLGLTV 240

Query: 241 YTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSLFHPRLFNIPRFAAISF 300
           YTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSLFHPRLFNIPRFAAISF
Sbjct: 241 YTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSLFHPRLFNIPRFAAISF 300

Query: 301 ATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFEDKVANFWCVTNVIFKYKA 360
           ATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFEDKVANFWCVTNVIFKYKA
Sbjct: 301 ATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFEDKVANFWCVTNVIFKYKA 360

Query: 361 NFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFYLFSFQVHEKXXXX 420
           NFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFYLFSFQVHEK    
Sbjct: 361 NFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFYLFSFQVHEKTILM 420

Query: 421 XXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQYWVCLILSNWLIGNFSF 480
                   YTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQYWVCLILSNWLIGNFSF
Sbjct: 421 PLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQYWVCLILSNWLIGNFSF 480

Query: 481 ITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYVMMGVIHFVDYFIEPPS 540
           ITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYVMMGVIHFVDYFIEPPS
Sbjct: 481 ITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYVMMGVIHFVDYFIEPPS 540

Query: 541 AYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580
           AYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL
Sbjct: 541 AYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/538 (78%), Positives = 468/538 (86%), Gaps = 1/538 (0%)

Query: 43  ETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFG 102
           + +  +ESFYASPLYD LYPFRPAGSQWMTEY IVLF++IIRCAVGLGP+SG+  PPMFG
Sbjct: 27  KHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFG 86

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDS 162
           DFEAQRHWMEITQ+LPI +WYWFDL+YWGLDYPPLTA+HSY+CGKIGSFF PNWF L  S
Sbjct: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSS 146

Query: 163 RGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLI 222
           RGYE QDLKTFMRLTVL SE+L YIP VVYF KWLGK R QSPIGQFIA AAIL QPSLI
Sbjct: 147 RGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLI 206

Query: 223 LIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSK 282
           LIDHGHFQ+NSV LGLTVY +NNLLDEFYA AAVCFVLSICFKQM LYYSPIFFAYLLSK
Sbjct: 207 LIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSK 266

Query: 283 SLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFE 342
           SLF P+LFNIPRF AI+ AT+C+F  M+GP+Y FGG+  G+ N+LQSI RIFPFARGIFE
Sbjct: 267 SLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQ-GLNNVLQSIHRIFPFARGIFE 325

Query: 343 DKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSAC 402
           DKVANFWCVTNVIFKYK  FTQ++LQLYSL+LT++ FLPAM++IL YP+KYLL YALSAC
Sbjct: 326 DKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSAC 385

Query: 403 SMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSL 462
           SM+FYLFSFQVHEK            YTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGL+L
Sbjct: 386 SMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTL 445

Query: 463 QYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLS 522
           QYWVCL+LSNWLIGNFSFITP FLPKVLTPGPS+  +GENY   +LLP N  WKVIIVLS
Sbjct: 446 QYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLS 505

Query: 523 YVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580
           Y+ MG IH +D F+ PP AYPDLWVILNCTLGFGCF LFW+WNYYKLFSM KK++H L
Sbjct: 506 YIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/543 (70%), Positives = 450/543 (82%), Gaps = 4/543 (0%)

Query: 38  NNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNT 97
            N+  +  T +ESFYASPLYDFLYPFRPAGSQW+TEY+IVLFA+II CAVG G YSG  +
Sbjct: 4   KNKEAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFS 63

Query: 98  PPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWF 157
           PPMFGDFEAQRHWMEITQ+L  SQWYWFDL+YWGLDYPPLTA+HSY+ GKIGSF +P WF
Sbjct: 64  PPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWF 123

Query: 158 TLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILF 217
            L +SRG E  DLKTFMR TVL SE L YIPAVVYFTKWLGK R +SPIGQFI+ AAILF
Sbjct: 124 ELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILF 183

Query: 218 QPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFA 277
           QPSL+LIDHGHFQ+N VMLGLTVY +N+L +EFYA AA+CFVLSICFKQMALYY+PIFFA
Sbjct: 184 QPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFA 243

Query: 278 YLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFA 337
           YLLSKSLF PR FN PR  AI+ AT+ +FA+M+ P+Y FG   GG+ N++QS+ RIFPFA
Sbjct: 244 YLLSKSLFSPR-FNFPRLFAIAVATVLSFAAMYAPLYIFG---GGLANVIQSVHRIFPFA 299

Query: 338 RGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLY 397
           RGIFEDKVANFWCVTNV FKYK  F QEQLQLYSLI T++ FLPA++VI LYP+K+++ Y
Sbjct: 300 RGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICY 359

Query: 398 ALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKK 457
           AL+ CSMSFYLFSFQVHEK            YTS++ +VLS  +W+NN+GLFTL+PLLKK
Sbjct: 360 ALATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKK 419

Query: 458 DGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKV 517
           DGL+LQY+VC  LSNWL+GNFSF+TP+FLPK LTPGPS+  +  NYRR + LPSN IWK+
Sbjct: 420 DGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKI 479

Query: 518 IIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNI 577
           IIV SY  MGV+H VD+ + PP +YPDLWV+LNC LGFGCF LFWLW+YY LF+M +K +
Sbjct: 480 IIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTL 539

Query: 578 HQL 580
            QL
Sbjct: 540 QQL 542

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/539 (69%), Positives = 443/539 (82%), Gaps = 3/539 (0%)

Query: 42  LETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMF 101
           L  E  +E FYASPLYDFLYPFRPAG+QW+ +YIIV FA+IIRCA+GLG YSG    PMF
Sbjct: 29  LNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMF 88

Query: 102 GDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGD 161
           GDFEAQRHWMEITQ+LPIS+WYWFDLQYWGLDYPPLTA+HSY+ GKIGSF  P WFTL D
Sbjct: 89  GDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLND 148

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
           SRG E + +K++MR TVL SE++ Y PA++YF+KW GK RNQSPIGQ+IA  AILFQPSL
Sbjct: 149 SRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSL 208

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           +LIDHGHFQ+NSVMLGLTVY +NNLLD+FY+ A+VCFVLSICFKQM+LYY+PIFF YLLS
Sbjct: 209 MLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLS 268

Query: 282 KSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIF 341
           KSLF PRLFNIPR   I+  TI TF +M+ P+Y FG   GG+ NL+QS+ RIFPFARGIF
Sbjct: 269 KSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFG---GGLENLIQSVHRIFPFARGIF 325

Query: 342 EDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSA 401
           EDKVANFWCVTN++ KYK  FTQ+QLQLYSL  T++ FLPA+++I+LYP+K+LL YAL+A
Sbjct: 326 EDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAA 385

Query: 402 CSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLS 461
           CSMSF+LFSFQVHEK            YTSTD NVLS V W+NN+ LFTLWPLLKKDGL 
Sbjct: 386 CSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLI 445

Query: 462 LQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVL 521
           LQY VC  LSNWL+GNFSF+TP+FLPK+LTPGPSI  + ENY R +LLP N +WKV+IV 
Sbjct: 446 LQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVS 505

Query: 522 SYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580
           SY+ M V H++D+F+EPP+ YPD+W+ LNC +GFG FV FW+W YY LF++  K +  L
Sbjct: 506 SYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/538 (70%), Positives = 446/538 (82%), Gaps = 4/538 (0%)

Query: 43  ETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFG 102
           E+E  +ESFYASPLYDFL+PFRPAGSQW+TE+II++FA+IIRCA+GLGPYSG+   PM G
Sbjct: 15  ESEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHG 74

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDS 162
           DFEAQRHWMEITQ+LPIS+WY++DL+YWGLDYPPLTAFHSYL GK+G+F  P+WF L  S
Sbjct: 75  DFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSS 134

Query: 163 RGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLI 222
           RG E Q LK +MR TVL SE++ Y+PAVVYFTKWLG+RRNQSPIGQFIA AAILFQPSL+
Sbjct: 135 RGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSLM 194

Query: 223 LIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSK 282
           LIDHGHFQ+NS+MLG TVY +NNLLDEFYA AA+CFVLSICFKQM+LYY+PIFFAYLL +
Sbjct: 195 LIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLGR 254

Query: 283 SLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFE 342
           S+F P+LFNIPRF +IS AT+ TF +MF P Y FGG +G    L Q+++RIFPFARGIFE
Sbjct: 255 SMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDG----LAQTVRRIFPFARGIFE 310

Query: 343 DKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSAC 402
           DKVANFWCV N I K+K  FT +QL++YSLILT++ F PAM++I+LYPRK+LL YAL+AC
Sbjct: 311 DKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAAC 370

Query: 403 SMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSL 462
           SMSFYLFSFQVHEK            +TS D NVLS VSW+NN+ LFTLWPLLK++GL L
Sbjct: 371 SMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYL 430

Query: 463 QYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLS 522
           QY+VC  LSNWLIGNFSFITPRFLPK +TPGPSI  + +NYRR +LLP +  WK+IIV S
Sbjct: 431 QYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSS 490

Query: 523 YVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580
           Y+ M   HF+D FIE P  +PDLWVILNCT+GF  F LFWLW YYK  ++ KKNI  L
Sbjct: 491 YIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/545 (67%), Positives = 440/545 (80%), Gaps = 4/545 (0%)

Query: 36  MNNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGF 95
           +  N+       +E FYASP+YDFLYPFR  GSQW+TEYIIV+F +II+ A+GLG YSGF
Sbjct: 23  LQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGF 82

Query: 96  NTPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPN 155
            TPPMFGDFEAQRHWMEITQ+LP+SQWYWFDLQYWGLDYPP TA+HSYL GKIG+F  P 
Sbjct: 83  QTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPP 142

Query: 156 WFTLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAI 215
           WF L  SRG E   +K++MR TVL SE + YIPA+VYFTKW+G+R+ QSPIGQF+A AAI
Sbjct: 143 WFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAI 202

Query: 216 LFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIF 275
           LFQP+L+LIDHGHFQ+N VMLGLTVY +NNLLD FYA AAVCFVLSICFKQMALYY+PIF
Sbjct: 203 LFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIF 262

Query: 276 FAYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFP 335
           FA LLSKSLF PRLFNIPRF +++FAT+ +   MF P+Y F    GG+ N+LQSI RIFP
Sbjct: 263 FAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIF----GGVGNVLQSIHRIFP 318

Query: 336 FARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLL 395
           FARGIFEDKVANFWCVTNV FKYK  FTQ +LQ YSL+ T++ F PA ++++ YP+K+L+
Sbjct: 319 FARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLI 378

Query: 396 LYALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 455
            Y L+ACSM+F+LFSFQVHEK            +TST+ N LS V W+NN+ LFTLWPLL
Sbjct: 379 PYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLL 438

Query: 456 KKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIW 515
           KKDGL LQY VCL++ NWL+GNFSFITPRFLPK+LTPGPSI  + ENYRR +LLP N IW
Sbjct: 439 KKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIW 498

Query: 516 KVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKK 575
           K+II++SY+ M +IH ++Y I  PS YPDLWV LNCT+GFGCFVLFW+W YYKL ++  K
Sbjct: 499 KIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNK 558

Query: 576 NIHQL 580
            I +L
Sbjct: 559 TIQEL 563

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/544 (67%), Positives = 443/544 (81%), Gaps = 10/544 (1%)

Query: 39  NQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTP 98
           N+P+E     ESF+ASPLYDFL PFRP  +QW+TEYIIV+FA+I+RCA+GLG YSG   P
Sbjct: 11  NKPVE-----ESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGMGNP 65

Query: 99  PMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFT 158
           PMFGDFEAQRHWMEITQ+LPIS+WY+FDL+YWGLDYPPLTA+HSY+ G IGSF   +WF 
Sbjct: 66  PMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFA 125

Query: 159 LGDSRGYEGQ--DLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAIL 216
           L DSRGYE +  DLKT+MR TV+ SE + YIP V+YFTKW+G+ R QS IGQ+IA AAIL
Sbjct: 126 LNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAIL 185

Query: 217 FQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFF 276
           FQPSL+LIDHGHFQ+NSVMLGLTVY +NNLLDEFYA AA+CFVLSICFKQMALYY+PIFF
Sbjct: 186 FQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFF 245

Query: 277 AYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPF 336
            YLL +SLF  + FNI RF +I+ +T+  F SM+ P+Y FGG   G+ N++QS+ RIFPF
Sbjct: 246 GYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGG---GLRNVIQSVHRIFPF 302

Query: 337 ARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLL 396
           ARG+FEDKVANFWCVTN+  KYK  +TQ++LQLYSLI T++ FLPA++ IL YP+K+LL 
Sbjct: 303 ARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLP 362

Query: 397 YALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLK 456
           YAL+ACSMSFYLFSFQVHEK            YTSTD NVLS VSW+NN+GLFTLWPLLK
Sbjct: 363 YALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPLLK 422

Query: 457 KDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWK 516
           KDGL+LQY VC  LSNWLIGNFSFITP+FLPK+LTPGP +    + Y R +LLP N +WK
Sbjct: 423 KDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWK 482

Query: 517 VIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKN 576
           +IIV SY++M +IH  + F+ PP  YPD+WV++NC LGFGCFVLFWLWNYYK+F++  K 
Sbjct: 483 IIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKT 542

Query: 577 IHQL 580
           +  L
Sbjct: 543 LQYL 546

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/544 (67%), Positives = 442/544 (81%), Gaps = 3/544 (0%)

Query: 37  NNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFN 96
           N+   L+     E FYASPLY FL PF+   +QW++ YIIVLFA+IIRCA+GLGPYSG N
Sbjct: 19  NDISSLDETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMN 78

Query: 97  TPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNW 156
             PMFGDFEAQRHWMEITQ+LPISQWY++DLQYWGLDYPPLTA+HSY+CG IG FF P W
Sbjct: 79  EAPMFGDFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAW 138

Query: 157 FTLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAIL 216
           F L  SRG E ++LKTFMRLT + SE + YIPA++YFT W+GK+R QSP+GQ+IA AAIL
Sbjct: 139 FELETSRGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAIL 198

Query: 217 FQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFF 276
           FQP L+LIDHGHFQ+NSVMLGLTVY +NNLLD+ YA AA+ FV+SICFKQM+LYY+PIFF
Sbjct: 199 FQPCLMLIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFF 258

Query: 277 AYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPF 336
           AYLL +SLF  + FN+ RF  I+ AT+ +F ++F P+Y FG   GG  N++QS+ RIFPF
Sbjct: 259 AYLLGRSLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFG---GGKRNIIQSVHRIFPF 315

Query: 337 ARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLL 396
           ARGIFEDKVANFWCVTNVI KYK N+TQ++LQLYSLILT++ FLPAM+ IL +P+K+LL 
Sbjct: 316 ARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLP 375

Query: 397 YALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLK 456
           Y+L+AC+MSF+LFSFQVHEK            YTSTD NVLS VSW+NN+ LFTLWPLLK
Sbjct: 376 YSLAACAMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLK 435

Query: 457 KDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWK 516
           KDG+ LQY VC ILSNWLIGNFSF TPRFLPK+LTPGP I  +  +YRR +LLP+N IWK
Sbjct: 436 KDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWK 495

Query: 517 VIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKN 576
           +IIVLSY++M  I  ++ F+EPP  YPD++V+LNCTLGF CF  FWLWNYYKLF++T KN
Sbjct: 496 IIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKN 555

Query: 577 IHQL 580
           +  L
Sbjct: 556 LQYL 559

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/545 (69%), Positives = 443/545 (81%), Gaps = 12/545 (2%)

Query: 47  SKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEA 106
            +E+FYASPL+DFLYPFRP GSQW+TEY+I++FAIIIRCA+ LG YSG  TPPMFGDFEA
Sbjct: 16  EEEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEA 75

Query: 107 QRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYE 166
           QRHWMEITQ+LPIS+WYWFDLQYWGLDYPP TA+HSY  GK+GSFF P+WF L  SRGYE
Sbjct: 76  QRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYE 135

Query: 167 GQD--LKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILI 224
             D  LKT+MR TV+ SE++ YIPAVVYFTKWLGK RNQSPIGQFIA AAILFQPSL+LI
Sbjct: 136 SDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLI 195

Query: 225 DHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSL 284
           DHGHFQ+NSVMLGLTVY +NNLLDEFY  AA+CFVLS+CFKQMALYYSPIFF YLLSKSL
Sbjct: 196 DHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSL 255

Query: 285 FHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENG---------GITNLLQSIKRIFP 335
            HP   NI RF  ++ +T+ +F  MFGPIY FG  +          G+ NL+Q I+RIFP
Sbjct: 256 VHPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFP 314

Query: 336 FARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLL 395
           FARGIFEDKVANFWCVTNV+ KY+  FTQEQLQ YSL+ T+I FLP+M+ I LYPRK+L+
Sbjct: 315 FARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLI 374

Query: 396 LYALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 455
            YAL+ACSMSF+LFSFQVHEK            YTSTD NVLS V W+NN+ LFTLWPLL
Sbjct: 375 PYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLL 434

Query: 456 KKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIW 515
           +KDGL LQY+VC  LSNWLIGNFSFITP+FLP  LTPGPSI  + ++YRR +LLP N +W
Sbjct: 435 RKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILW 494

Query: 516 KVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKK 575
           K+II+ SY++MG +  +D F +PP+ YPDLW+ILNCT+GFGCF+LFWLWN YK+  M  K
Sbjct: 495 KIIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNK 554

Query: 576 NIHQL 580
            ++ L
Sbjct: 555 TLNDL 559

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/541 (68%), Positives = 437/541 (80%), Gaps = 6/541 (1%)

Query: 42  LETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMF 101
           L  + ++ESFYASP+YDFLYPFRP G+QW+ EYII + A+I+RC +GLGPYSG  +PP++
Sbjct: 8   LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLY 67

Query: 102 GDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGD 161
           GDFEAQRHWMEITQ+LP+S+WYW+DLQYWGLDYPPLTAFHSYL G IGSFF P+WF L  
Sbjct: 68  GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEK 127

Query: 162 SRGYEGQD--LKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQP 219
           SRG+E  D  LKT+MR TV+ S+ L Y PAV+YFTKWLG+ RNQSPIGQ IA +AILFQP
Sbjct: 128 SRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQP 187

Query: 220 SLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYL 279
           SL+LIDHGHFQ+NSVMLGLT Y +NNLLDE+YA AAVCFVLSICFKQMALYY+PIFFAYL
Sbjct: 188 SLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYL 247

Query: 280 LSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARG 339
           LS+SL  P+ FNI R   I+FAT+ TFA +F P+YF GG   G+ N+ Q I RIFPFARG
Sbjct: 248 LSRSLLFPK-FNIARLTVIAFATLATFAIIFAPLYFLGG---GLKNIHQCIHRIFPFARG 303

Query: 340 IFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYAL 399
           IFEDKVANFWCVTNV  KYK  FT +QLQLYSLI T+I FLPAM++ LL+P+K+LL Y L
Sbjct: 304 IFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVL 363

Query: 400 SACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDG 459
            ACSMSF+LFSFQVHEK            Y+STD NVLS VSW+NN+ LFTLWPLLKKDG
Sbjct: 364 IACSMSFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDG 423

Query: 460 LSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVII 519
           L LQY V  +LSNWLIGNFSFITPRFLPK LTPGPSI  +  +YRR +LLP N +WK  I
Sbjct: 424 LHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFI 483

Query: 520 VLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQ 579
           + +Y+ MG  HF+D F+ PPS YPDLWV+LNC +GF CF +FWLW+YYK+F+   K++  
Sbjct: 484 IGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKD 543

Query: 580 L 580
           L
Sbjct: 544 L 544

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/541 (67%), Positives = 437/541 (80%), Gaps = 6/541 (1%)

Query: 42  LETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMF 101
           L  + ++ESFYASP+YDFLYPFRP G+QW+ EYII + A+I+RC +GLGPYSG  +PP+ 
Sbjct: 8   LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLH 67

Query: 102 GDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGD 161
           GDFEAQRHWMEITQ+LP+S+WYW+DLQYWGLDYPPLTAFHSYL G IGSFF P+WF L  
Sbjct: 68  GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDK 127

Query: 162 SRGYEGQD--LKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQP 219
           SRG+E  D  LKT+MR TV+ S+ L Y PAV+YFTKWLG+ RNQSPIGQ IA +AILFQP
Sbjct: 128 SRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQP 187

Query: 220 SLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYL 279
           SL+LIDHGHFQ+NSVMLGLT Y +NNLLDE+YA AA+CFVLSICFKQMALYY+PIFFAYL
Sbjct: 188 SLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYL 247

Query: 280 LSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARG 339
           LS+SL  P+ FNI R   ISFAT+ TFA M  P+YF GG   G+ N+ Q I RIFPFARG
Sbjct: 248 LSRSLLFPK-FNIARLTVISFATLATFALMLAPLYFLGG---GLKNIYQCIHRIFPFARG 303

Query: 340 IFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYAL 399
           IFEDKVANFWCVTNV  KYK  F+ +QLQLYSL+ T+I FLPAM++ LL+P+K+LL Y L
Sbjct: 304 IFEDKVANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVL 363

Query: 400 SACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDG 459
            ACSMSF+LFSFQVHEK            Y+STD NVLS VSW+NN+ LFTLWPLLK+DG
Sbjct: 364 IACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDG 423

Query: 460 LSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVII 519
           L LQY V  +LSNWLIGNFSFITPRFLPK LTPGPSI  +  +YRR +LLP N +WK  I
Sbjct: 424 LHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFI 483

Query: 520 VLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQ 579
           + +Y+ MG+ HF+D F+ PPS YPDLWV+LNCT+GF CF +FW+W+YYK+F+   K++  
Sbjct: 484 IGTYIAMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKD 543

Query: 580 L 580
           L
Sbjct: 544 L 544

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/541 (67%), Positives = 438/541 (80%), Gaps = 6/541 (1%)

Query: 42  LETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMF 101
           L  + ++ESFYASP+YDFLYPFRP G+QW+ EYII + A+I+RCA+GLGPYSG  TPP+ 
Sbjct: 8   LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLH 67

Query: 102 GDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGD 161
           GDFEAQRHWMEITQ+LP+S+WYW+DLQYWGLDYPPLTAFHSYL G IG+FF P+WF L  
Sbjct: 68  GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDK 127

Query: 162 SRGYEGQD--LKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQP 219
           SRG+E  D  LKT+MR TV+ S+ L Y PAV+YFTKWLG+ RNQSPIGQ IA AAILFQP
Sbjct: 128 SRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQP 187

Query: 220 SLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYL 279
           SL+LIDHGHFQ+NSVMLGLT Y +NNLLDE+YA AA+CFVLSICFKQMALYY+PIFFAYL
Sbjct: 188 SLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYL 247

Query: 280 LSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARG 339
           LS+SLF P+ FNI R   I+FAT+ TF+ MF P+YF GG   G+ N+ Q I R+FPFARG
Sbjct: 248 LSRSLFFPK-FNIARLTVIAFATLATFSLMFAPLYFLGG---GLRNIYQCIHRMFPFARG 303

Query: 340 IFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYAL 399
           IFEDKVANFWCV+N+  KYK  F+ +QLQLYSL+ T++ FLPAM++ LL+P+K+LL Y L
Sbjct: 304 IFEDKVANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVL 363

Query: 400 SACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDG 459
            ACSMSF+LFSFQVHEK            Y+STD NVLS VSW+NN+ LFTLWPLLKKDG
Sbjct: 364 IACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDG 423

Query: 460 LSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVII 519
           L LQY V  +L+NWLIGNFSFITPRFLPK LTPGPSI  +  +YRR +LLP N +WK  I
Sbjct: 424 LHLQYVVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFI 483

Query: 520 VLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQ 579
           + +Y+ MG+ HF+D F+ PP  YPDLWV+LNC +GF CF +FW+W+YYK+F+   K++  
Sbjct: 484 IGTYIAMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKD 543

Query: 580 L 580
           L
Sbjct: 544 L 544

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/539 (66%), Positives = 431/539 (79%), Gaps = 5/539 (0%)

Query: 42  LETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMF 101
           ++   S E+F+ASP+YDFL PFRP G+QW  +Y+IV+FA+IIRCAVGLG YSG NTPPMF
Sbjct: 33  MKKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMF 92

Query: 102 GDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGD 161
           GDFEAQRHWMEITQ+LP+ +WYW+DLQYWGLDYPPLTA+HSYL GK+GSFF+  WF L  
Sbjct: 93  GDFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLES 152

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
           SRGYE  +LK++MR TV+ SE L YIPAV+YFTKW+GK R+QSPIGQ+IA AAILFQP+L
Sbjct: 153 SRGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPAL 212

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           IL+DHGHFQ+N VMLG+TVYTLNNLLD FYA  A+CFVLS+CFKQMALYYSPIFFAYLLS
Sbjct: 213 ILVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLS 272

Query: 282 KSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIF 341
           KS + P + N+PR  AIS +T   F   FGPIY FGG      NL+QS+ RIFPFARGIF
Sbjct: 273 KSTYSPGI-NLPRLFAISVSTALAFIGSFGPIYIFGGYK----NLVQSMHRIFPFARGIF 327

Query: 342 EDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSA 401
           EDKVANFWCV+N+  KY+  FTQ+ LQLYSL+ T+I  LP+ ++  LYP+++LL YAL+A
Sbjct: 328 EDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAA 387

Query: 402 CSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLS 461
           CSMSF+LFSFQVHEK            YTS D NVLS V W+NN+ LFTLWPLLKKD L 
Sbjct: 388 CSMSFFLFSFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLV 447

Query: 462 LQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVL 521
           LQY V  + SNWLIGNFSF+TPRFLPK LTPGPSI  +  +YRR +LLP + IW++IIV 
Sbjct: 448 LQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVG 507

Query: 522 SYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580
           SY+ MG+IHF+DY++ PPS YPDLWV+ NC+LGF CFV FW+WN YKLF M    +  L
Sbjct: 508 SYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/541 (67%), Positives = 436/541 (80%), Gaps = 6/541 (1%)

Query: 42  LETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMF 101
           L  + ++ESFYASP+YDFLYPFRP G+QW+ EYII + A+I+RCA+GLGPYSG ++PP+ 
Sbjct: 8   LVNKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLH 67

Query: 102 GDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGD 161
           GDFEAQRHWMEITQ+LP+S+WYW+DLQYWGLDYPPLTAFHS L G IG+FF P+WF L  
Sbjct: 68  GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDK 127

Query: 162 SRGYEGQD--LKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQP 219
           SRG+E  D  LKT+MR TV+ S+ L Y PAV+YFTKWLG+ RNQSPIGQ IA AAILFQP
Sbjct: 128 SRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQP 187

Query: 220 SLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYL 279
           SL+LIDHGHFQ+NSVMLGLT Y +NNLLDE+YA AAVCFVLSICFKQMALYY+PIFFAYL
Sbjct: 188 SLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYL 247

Query: 280 LSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARG 339
           LS+SL  P+ FNI R   I+FAT+ TF+ +  P+YF GG   G+ N+ Q I RIFPF+RG
Sbjct: 248 LSRSLLFPK-FNIARLTVIAFATLATFSVILAPLYFLGG---GLRNIHQCIYRIFPFSRG 303

Query: 340 IFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYAL 399
           IFEDKVANFWCVTN+  KYK  FT +QLQLYSL+ T+I FLPAM++ LL+P+K+LL Y L
Sbjct: 304 IFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVL 363

Query: 400 SACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDG 459
            ACSMSF+LFSFQVHEK            Y+STD NVLS VSW+NN+ LFTLWPLLKKDG
Sbjct: 364 IACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDG 423

Query: 460 LSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVII 519
           L LQY V  +LSNWLIGNFSFITPRFLPK LTPGPSI  +  +YRR +LLP N +WK  I
Sbjct: 424 LHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFI 483

Query: 520 VLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQ 579
           + +Y+ MGV H +D F+ PPS YPDLWV+LNC +GF CF +FW+W+YYK+F+   K++  
Sbjct: 484 IGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKD 543

Query: 580 L 580
           L
Sbjct: 544 L 544

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/543 (66%), Positives = 434/543 (79%), Gaps = 5/543 (0%)

Query: 37  NNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFN 96
           +  +P   +  KESF+ASPL+DFL PFRP  +QW  +YIIVLFA+IIRC VGLG +SG N
Sbjct: 3   SKRKPYSRKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMN 62

Query: 97  TPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNW 156
            PPM GDFEAQRHWME+T  LP+SQWYW+DL YWGLDYPPLTA+HSY+ GK+G  F P W
Sbjct: 63  VPPMHGDFEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTW 122

Query: 157 FTLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAIL 216
           F LG SRG E  DLK++MR TVL SE L YIP V+YF KW+GK R Q+PIGQ+IA AAIL
Sbjct: 123 FQLGVSRGQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAIL 182

Query: 217 FQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFF 276
           FQPSLILIDHGHFQ+NSVMLGLTVY +NNLLDE+YA AA+CFVLS+CFKQMALYY+PIFF
Sbjct: 183 FQPSLILIDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFF 242

Query: 277 AYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPF 336
           +YLLSKSLF P LFN+PR  A++ AT+ +FA+MF P+Y +    GGI N+LQSI RIFPF
Sbjct: 243 SYLLSKSLFSP-LFNLPRLLAVAAATLISFAAMFFPLYMW----GGIRNVLQSIHRIFPF 297

Query: 337 ARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLL 396
           +RGIFEDKVANFWC +N+  KYK  +TQ QLQ+YSL  T + FLPA ++I  YP+K+L+ 
Sbjct: 298 SRGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIP 357

Query: 397 YALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLK 456
           YAL+ACSMSF+LFSFQVHEK            YTSTD NVLS VSW+NN+  FTLWPLLK
Sbjct: 358 YALTACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLK 417

Query: 457 KDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWK 516
           KDGL LQY   L+LSNWLIGNFSF+TPRFLPK LTPGPS   + ENYRR +LLP N  WK
Sbjct: 418 KDGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWK 477

Query: 517 VIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKN 576
           +IIV SY+ MG++H +D++++PP+ YPDLWV+LNC+LGF  F LFW+WNYYK+F++  K 
Sbjct: 478 LIIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKT 537

Query: 577 IHQ 579
           ++ 
Sbjct: 538 LYD 540

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/536 (68%), Positives = 436/536 (81%), Gaps = 4/536 (0%)

Query: 45  ETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDF 104
            T++ESFYASPLYDFLYPF+P GSQW+ EYII+LFA+IIRCA+GLGPYSG +  PM GDF
Sbjct: 16  NTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVKPMHGDF 75

Query: 105 EAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRG 164
           EAQRHW+EITQ+LPISQWY+FDL+YWGLDYPPLTA+HSY+ GK+GS   P+WF L  SRG
Sbjct: 76  EAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVSRG 135

Query: 165 YEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILI 224
            E  DLKT+MR TV+ SE + YIPAVVYFTKW+G+ R  SP+GQFIA AAILFQP+L+LI
Sbjct: 136 LESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPALMLI 195

Query: 225 DHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSL 284
           DHGHFQ+N VMLG TVY +N+L+DEFYA AA CFVLSICFKQMALYYSPIFFAYLL + +
Sbjct: 196 DHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLGRCV 255

Query: 285 FHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFEDK 344
           F   +   PRF +I+ ATI TF  M+ P+Y  G    G  N+LQS+ RIFPFARGIFEDK
Sbjct: 256 FKTGI-RFPRFLSIAMATIATFLVMYIPLYIMG---SGSQNVLQSVHRIFPFARGIFEDK 311

Query: 345 VANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSM 404
           VANFWCVTN+  KYK  FTQ+QLQLYSL+ T + FLPA++++LLYP+K+L+ +AL+ACSM
Sbjct: 312 VANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALAACSM 371

Query: 405 SFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQY 464
           SF+LFSFQVHEK            YTST+ +VLS VSW+NN+GLFTLWPLLKKDGL+LQY
Sbjct: 372 SFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLALQY 431

Query: 465 WVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYV 524
            VC    NWLIGNFSF+TP FLPK LTPGPS+  +  NYRR +LLP + IWK+IIV SY+
Sbjct: 432 CVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIVGSYI 491

Query: 525 MMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580
            MG IH +D F+ PP  YPDLWVILNCTLGFGCF+LFWLWNYYKLFS+  +++ QL
Sbjct: 492 SMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/533 (64%), Positives = 420/533 (78%), Gaps = 5/533 (0%)

Query: 48  KESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEAQ 107
           KESF+ASPLYDFL PFRP  +Q+  EY+IV+FA++IRCAVGLG +SG  T PM GDFEAQ
Sbjct: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68

Query: 108 RHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYEG 167
           RHWME+T  LP+SQWYWFDLQYWGLDYPPLTA+HSY  GK+GS   P WF LG SRG E 
Sbjct: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128

Query: 168 QDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILIDHG 227
            +LK +MR TV+ SE+  YIPAV+YFTKW G +R QSPIGQ+IA AAILFQPSLILIDHG
Sbjct: 129 PELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188

Query: 228 HFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSLFHP 287
           HFQ+NSVMLGLTVY +NNLLD F+  AA+CF+LS+CFKQMAL+YSPIFFAYLLS+SLF P
Sbjct: 189 HFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSP 248

Query: 288 RLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFEDKVAN 347
             F   RF +++ +T+ TF  MF P+Y F    GG+ N+LQSI RIFPF+RGIFEDKVAN
Sbjct: 249 S-FKFSRFMSVALSTVITFCLMFSPLYVF----GGMKNVLQSIHRIFPFSRGIFEDKVAN 303

Query: 348 FWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFY 407
           FWCV+NVI KY  NFTQ+QLQ  S   T   FLP+  +++LYP+K+++ Y L+ACSM+F+
Sbjct: 304 FWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFF 363

Query: 408 LFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQYWVC 467
           LF FQVHEK            + STD NVL+ VSW+NN+ LFTLWPLLKKD L+LQY + 
Sbjct: 364 LFGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIM 423

Query: 468 LILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYVMMG 527
           ++LSNWLIGNFSF+TPRFLP  +TPGPS+  + E YRR + LP+N +WK++I+ SY++M 
Sbjct: 424 MLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMA 483

Query: 528 VIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580
           VIH +D F++PP+  PDLWV++NC LGF CF +FWLWN YKLF+M  K+I  L
Sbjct: 484 VIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/534 (63%), Positives = 422/534 (79%), Gaps = 5/534 (0%)

Query: 46  TSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFE 105
           +  E F+ASPLYDFL PFRP  +Q+  EY+IV+FA++IRCAVGLG +SG N+ P+ GDFE
Sbjct: 7   SKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHGDFE 66

Query: 106 AQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGY 165
           AQRHWME+T +LP+SQWYW+DLQYWGLDYPPLTA+HSY+ GK+GS     WF L  SRG 
Sbjct: 67  AQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSSRGI 126

Query: 166 EGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILID 225
           E  D+K +MR TV+ SE+  YIPAV+YFTKW G +R QSPIGQ+IA AAILFQPSLILID
Sbjct: 127 ENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILID 186

Query: 226 HGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSLF 285
           HGHFQ+NSVMLGLTVY++NNLLD +Y  AA+CFVLS+CFKQMALYYSP+FFAYLLS+ L 
Sbjct: 187 HGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSECLI 246

Query: 286 HPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFEDKV 345
            P L N+PRF +++F+T+ +F  +F P+Y FGG      N+LQSI RIFPF+RGIFEDKV
Sbjct: 247 SPSL-NVPRFLSVAFSTVISFCIIFSPLYVFGGTK----NVLQSIHRIFPFSRGIFEDKV 301

Query: 346 ANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSMS 405
           ANFWCV+NV+FKY  N+TQ++LQ +S+I T   FLP+ LV+L YP+K+++ +AL+ACSM+
Sbjct: 302 ANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMA 361

Query: 406 FYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQYW 465
           F+LFSFQVHEK            Y STD NVLS VSW+NN+ LFTLWPLLKKD L+LQY 
Sbjct: 362 FFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYG 421

Query: 466 VCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYVM 525
           + ++LSNWLIGNFSF+TPRFLPK +TPGPSI  + E YRR + LP N  WK+IIV SY++
Sbjct: 422 ILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLI 481

Query: 526 MGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQ 579
           M  IH +D+F+  P   PDLWV+LNC LGF CF +FWLW +YKLF+M   N+  
Sbjct: 482 MAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/544 (62%), Positives = 424/544 (77%), Gaps = 5/544 (0%)

Query: 37  NNNQPLETETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFN 96
              Q       +ESF+ASPLYDFLYP RP  +QW  +YII++FA+I+R AVGLG YSG  
Sbjct: 11  EKGQDTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKG 70

Query: 97  TPPMFGDFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNW 156
             P+FGDFEAQRHWMEIT  LPIS+WY++DL+YWGLDYPPLTA+HSY+ G++GSF    W
Sbjct: 71  KGPLFGDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATW 130

Query: 157 FTLGDSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAIL 216
           F L  SRG+E  DLK+FMR+TVL SE +CYIPAV+YFT+W+G+ RNQSPIGQ++A AAIL
Sbjct: 131 FKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAIL 190

Query: 217 FQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFF 276
           FQPSLILIDHGHFQ+N VMLGL VYT+NNLLDEFY FAA+CFVLS+ FKQMALYYSP+ F
Sbjct: 191 FQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIF 250

Query: 277 AYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPF 336
           AYL S+S ++PR FN PRFA I+ AT+ TF +++ P+  F    G   N++QS+ R+FPF
Sbjct: 251 AYLFSRSAYYPR-FNFPRFAGIAIATLLTFGALYAPLCLF----GDFRNIIQSVYRVFPF 305

Query: 337 ARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLL 396
           +RGIFEDKVANFWCVTNVI KY+  +TQ+QLQ Y L+ T IA  PA ++I LYP+K+LL 
Sbjct: 306 SRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLP 365

Query: 397 YALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLK 456
           YAL+ACSM+F+LFSFQVHEK            + ST+ +VLS V+W+NN+ LFTLWPLLK
Sbjct: 366 YALAACSMAFFLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLK 425

Query: 457 KDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWK 516
           KDGL LQY +  +LSNWL+GNFSF+TP FLPK LTPGPS+  + ++YRR +LLP N  W+
Sbjct: 426 KDGLLLQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWR 485

Query: 517 VIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKN 576
           +IIV SYV M  IH +D +++PP  YPD+WV+  C LGF CF  FWLWNYY+L+ M   +
Sbjct: 486 IIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSS 545

Query: 577 IHQL 580
           +++L
Sbjct: 546 LNEL 549

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/533 (63%), Positives = 418/533 (78%), Gaps = 5/533 (0%)

Query: 48  KESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEAQ 107
           KE+F+ASPLYDFLYP RP  +QW  +YIIV+FA+IIR AVGLG YSG   PPMFGDFEAQ
Sbjct: 36  KEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQ 95

Query: 108 RHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYEG 167
           RHWME+TQ++P+S+WY+  LQYWGLDYPPLTA+HSYL GK+GS+  P WF+L  SRGYE 
Sbjct: 96  RHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYES 155

Query: 168 QDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILIDHG 227
           +DLK++MRLTV+ SE   YIPAV+YFT+W+G+RR QSPIGQ+IA AAILFQP+LILIDHG
Sbjct: 156 EDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALILIDHG 215

Query: 228 HFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSLFHP 287
           HFQ+N VMLGLTV  +NNLLD++YA AAV FV S+ FKQMALYY+P+ F YLLS+S+++P
Sbjct: 216 HFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYYP 275

Query: 288 RLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFEDKVAN 347
           RL NIPRF A++ AT+  F  ++ P+Y      G I+ + QSI R+FPF RG+FEDKVAN
Sbjct: 276 RL-NIPRFVAVAVATLIAFGVLYAPLYLL----GNISAIFQSIHRVFPFERGLFEDKVAN 330

Query: 348 FWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFY 407
           FWCVTNV+ KYK  +T  QL+ +SL+LT  A LP++++  LYP+K++L YAL+ACSMSF+
Sbjct: 331 FWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFF 390

Query: 408 LFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQYWVC 467
           LF FQVHEK            YTSTD NVLS V+W+NNI LFTLWPLLKKDGLSLQY + 
Sbjct: 391 LFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIM 450

Query: 468 LILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYVMMG 527
            +LSNWLIGNFSFITP FLPKVLTPGPS+  + + YRR +LLPSN IW++IIV+SY+ +G
Sbjct: 451 FLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYICVG 510

Query: 528 VIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580
            IH  + +  P    PD+WV+ NC +G   F LFW+WN YK+F+M    I  L
Sbjct: 511 AIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  125 bits (315), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 107/416 (25%), Positives = 176/416 (42%), Gaps = 77/416 (18%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTA-FHSYLCGKIGSFFQPNWFTLGD 161
           DF+  R+W+ IT  LP+ QWY+     W LDYPP  A F  +L   + S+ + +      
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFVPSYVKSDGCLDIV 95

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G     F RLTV+ASE L ++   VY        R QS    F+  ++I   P  
Sbjct: 96  EVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAISPGF 151

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           ++IDH HFQ+N  +  + + ++    ++ Y +    + +++CFK + LY +P +F +LL 
Sbjct: 152 LIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFVFLLR 211

Query: 282 KSLFHPRLFNIPRFAAISF------------ATICTFASMFGPIYFFGGENGGITNLLQS 329
             + + + F    +  + F              I TFA  FGP  F         +L Q 
Sbjct: 212 AYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGPFIF---------DLPQL 262

Query: 330 IKRIFPFARGIFEDKVA-NFWCVTNVI--------------FKYKANFTQEQLQLYSL-- 372
           + R+FPF+RG+     A NFW + + I              +K  + F    L   SL  
Sbjct: 263 LTRLFPFSRGLTHAYWAPNFWAIYSTIDKILTMVFLKMPYTYKLASQFISPPLIPASLNE 322

Query: 373 ---------------------------------ILTIIAFLPAMLVILLYPRKYLLLYAL 399
                                            +LT++  + A++ +L  P     + ++
Sbjct: 323 IKAKMAANNNGSKGLVEDVYFVILPQIVPKLTFLLTLLYQVLAVVPVLFDPSFKRFMGSM 382

Query: 400 SACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 455
           + C ++ +LF + VHEK              S DR +LS    + + G  +L+PLL
Sbjct: 383 TLCGLASFLFGWHVHEKAIMLVIIPFSFLVIS-DRRLLSSFMLLTSAGYVSLFPLL 437

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  119 bits (299), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 105/418 (25%), Positives = 179/418 (42%), Gaps = 77/418 (18%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSY-LCGKIGSFFQPNWFTLGD 161
           DF+  R+W+ IT  LP+ QWY+ +   W LDYPP  A+  + L   + +  + +      
Sbjct: 44  DFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCLDIV 103

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G     F RLTV+ASE L ++   VY  K     R+      F+  ++I+  P  
Sbjct: 104 KVGQFGMPTIVFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVASSIVLSPGF 159

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           ++IDH HFQ+N  +  + + ++    ++ Y    + F ++ICFK + LY +P FF +LL 
Sbjct: 160 LIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVFLLR 219

Query: 282 K-----SLFHPRLFNI-------PRFAAISFATICTFASMFGPIYFFGGENGGITNLLQS 329
                 S FH + +N             +    +C F   F P          I+   Q 
Sbjct: 220 VYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPF---------ISQWPQL 270

Query: 330 IKRIFPFARGIFEDKVA-NFWCVTNV--------------IFKYKANF------------ 362
           + R+FPF+RG+     A NFW + ++              + K+   F            
Sbjct: 271 LSRLFPFSRGLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGE 330

Query: 363 TQEQLQLYSL-----------------------ILTIIAFLPAMLVILLYPRKYLLLYAL 399
            +++L  Y++                       ILT+   + A++ +L  P     + +L
Sbjct: 331 IKQKLLQYNVGTKGLVQDVYFVILPQIQPRLTFILTLFYQILAIIPVLFSPSFKRFVGSL 390

Query: 400 SACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKK 457
           + C  + +LF + VHEK             TS DR +L+  + + + G  +L+PLL +
Sbjct: 391 TLCGFASFLFGWHVHEKAIMLIIIPFSFLVTS-DRRLLTPFNLLASAGYVSLFPLLHE 447

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 102/424 (24%), Positives = 181/424 (42%), Gaps = 68/424 (16%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTA-FHSYLCGKIGSFFQPNWFTLGD 161
           DF+  R+W+ IT  LP+ +WY+ +   W LDYPP  A F  +L   +  F + +      
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G     F RLTV+ SE L ++   V+        + QS    F+  ++I+  P  
Sbjct: 103 PEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILSPGF 158

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           ++IDH HFQ+N  + G+ + ++    ++ Y    + + +++CFK + LY +P +F +LL 
Sbjct: 159 LMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 218

Query: 282 KSLFHPRLFNIPRFAAISFA------------TICTFASMFGPIYFFGGENGGITNLLQS 329
             + + + F    +  +                +C     FGP +          ++ Q 
Sbjct: 219 AYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFW---------RDMNQL 269

Query: 330 IKRIFPFARGIFEDKVA-NFWCVTNVIFK------YKANFTQ-------EQLQLY----- 370
           + R+FPF+RG+     A NFW + + + K       +  F +       E+ + +     
Sbjct: 270 LSRLFPFSRGLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNGSR 329

Query: 371 ------------------SLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFYLFSFQ 412
                             + +LT+   + A++ +L  P     + +L+ C  + +LF + 
Sbjct: 330 GLVEDVFFVILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLFGWH 389

Query: 413 VHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL-KKDGLSLQYWVCLILS 471
           VHEK                DR +LS    + + G  +L+PLL K     L+   CL L 
Sbjct: 390 VHEKAILLVIIPFSFL-VVCDRRLLSSFMLVGSAGYVSLFPLLFKGQDFLLK---CLYLI 445

Query: 472 NWLI 475
            W I
Sbjct: 446 VWCI 449

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 102/422 (24%), Positives = 176/422 (41%), Gaps = 83/422 (19%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGK-IGSFFQPNWFTLGD 161
           DF+  R+W+ +T  LP+ QWY+     W LDYPP  A+  ++  + +    + +      
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G+    F RL+V+ SE L ++    +      K R QS    FI   +I+  P  
Sbjct: 116 EIGKFGEPTVIFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVATSIILSPGF 171

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           +++DH HFQ+N  +  + + ++     + Y   AV +  ++CFK + LY +P +F +LL 
Sbjct: 172 LIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFLLR 231

Query: 282 KSLFHPRLF---------------NIPRFAAISFATICTFASMFGPIYFFGGENGGITNL 326
             + + + F               N+ R A +  + +      FGP  F         ++
Sbjct: 232 AYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLSIV---GVCFGPFIF---------DM 279

Query: 327 LQSIKRIFPFARGIFEDKVA-NFWCV--------TNVIFK----------------YKAN 361
            Q + R+FPF+RG+     A NFW +        T ++ K                + A 
Sbjct: 280 PQLLTRLFPFSRGLTHAYWAPNFWAIYSFTDKVLTTLMLKLPYVHTLATRFISAPFFPAT 339

Query: 362 FTQEQLQL-------------------------YSLILTIIAFLPAMLVILLYPRKYLLL 396
             + Q +L                          + ILT+   L A++ +L  P     +
Sbjct: 340 IKEIQKRLSEDNNGTKGLVQDVYFIVLPQIVPKLTFILTLFYQLLAVIPLLFDPSFKRFI 399

Query: 397 YALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLK 456
            +L+ C M+ YLF + VHEK                DR +LS     ++ G  +L+PLL 
Sbjct: 400 GSLTLCGMASYLFGWHVHEKAIMLVIIPFSFLVVC-DRRLLSSFMLASSAGYVSLFPLLY 458

Query: 457 KD 458
           ++
Sbjct: 459 EN 460

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  115 bits (288), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 106/420 (25%), Positives = 177/420 (42%), Gaps = 79/420 (18%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKI--GSFFQPNWFTLG 160
           DF+  R+W+ IT  LP+ QWY+     W LDYPP  A+  +   +   G+  Q     + 
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEIV 104

Query: 161 DSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPS 220
           D +G  G     F R TV+ SE L ++   V+        R QS    F+  ++I+  P+
Sbjct: 105 D-KGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLSPA 159

Query: 221 LILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLL 280
            +++DH HFQ+N  +  + + ++       Y + A  + +++CFK + LY +P +F +LL
Sbjct: 160 FLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLL 219

Query: 281 SKSLFHPRLFNIPRFAAISF------------ATICTFASMFGPIYFFGGENGGITNLLQ 328
                + + F    +  + F              I  FA  FGP          + +L Q
Sbjct: 220 RAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPF---------VKDLPQ 270

Query: 329 SIKRIFPFARGIFEDKVA-NFWC--------VTNVIFK--YKANFTQEQLQ--------- 368
            + R+FPF+RG+     A NFW         +T V+ K  Y   FT + +Q         
Sbjct: 271 VLTRLFPFSRGLTHAYWAPNFWALYSFLDKILTVVMLKLPYVHQFTSKFIQPPLIPSTID 330

Query: 369 -------------------LYSLIL---------TIIAFLPAMLVI--LLYPRKYLLLYA 398
                              ++ +IL          + AF   + VI  L  P     + +
Sbjct: 331 EIKQRIAQNNNGTKGLVQDVFFVILPQITPKLTFALTAFYQVLAVIPVLFDPSYKRFIGS 390

Query: 399 LSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKD 458
           L+ C ++ YLF + VHEK              + DR +L+    +   G  +L+PLL ++
Sbjct: 391 LTLCGLASYLFGWHVHEKAIMLAIVPFSFL-VACDRRLLTSYMLLAASGYVSLFPLLYEN 449

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  114 bits (284), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 110/422 (26%), Positives = 170/422 (40%), Gaps = 89/422 (21%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDS 162
           DF+  R+W+ IT  LPIS+WY+ +   W LDYPP  A+  ++  +       N   L   
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDGCLDIV 123

Query: 163 R-GYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G     F RLTV+ SE L +     Y      K R Q     F+  ++I+  P  
Sbjct: 124 EVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVLSPGF 179

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           ++IDH HFQ+N  +  + + ++     + Y   AV + +S+CFK + LY +P +F +LL 
Sbjct: 180 LIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFVFLLR 239

Query: 282 KSLFH------------------PRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGI 323
             + +                   RLF +    +  F TIC     F P  F        
Sbjct: 240 AYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIF-TIC-----FAPFIF-------- 285

Query: 324 TNLLQSIKRIFPFARGIFEDKVA-NFWCVTNVIFKY------------------------ 358
             L Q + R+FPF+RG+     A NFW + + I K                         
Sbjct: 286 -QLPQVLSRLFPFSRGLTHAYWAPNFWAMYSFIDKVLTFVMLRFPYVHKLMLSFTSSPIL 344

Query: 359 -------------KANFTQEQLQLY------------SLILTIIAFLPAMLVILLYPRKY 393
                          N T+  +Q Y            + +LT+   + A++ +L  P   
Sbjct: 345 PKTAAEIRERMAQNNNGTKGLVQDYFFVILPQITPKLTFLLTLFYQILAVIPLLFDPSYK 404

Query: 394 LLLYALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWP 453
             + +L+ C M+ YLF + VHEK              S DR +L     +   G  +L+P
Sbjct: 405 RFIGSLTLCGMASYLFGWHVHEKAIMLVIIPFSFLVVS-DRRLLISFMLVTAAGYVSLFP 463

Query: 454 LL 455
           LL
Sbjct: 464 LL 465

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  113 bits (283), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 105/418 (25%), Positives = 172/418 (41%), Gaps = 77/418 (18%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGK-IGSFFQPNWFTLGD 161
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  A+  +L  + +    Q +      
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQFVPQRVQDDGCLDIV 103

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
           + G  G     F R+TV+ SE L ++   VY  K     R+      F+  ++I+  P  
Sbjct: 104 AVGQFGLPTIVFQRVTVIVSEILLFVVLQVYINKSHISDRS----ANFVVASSIVLSPGF 159

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFA---- 277
           ++IDH HFQ+N  +  + + ++     + Y      F  ++CFK + LY +P FFA    
Sbjct: 160 LIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFAFLLR 219

Query: 278 -YLLSKSLFHPRLFNI-------PRFAAISFATICTFASMFGPIYFFGGENGGITNLLQS 329
            Y+L  S F  R +N             +    +  FA  F P          I  L Q 
Sbjct: 220 VYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPF---------IYQLPQL 270

Query: 330 IKRIFPFARGIFEDKVA-NFWCVTNVIFKYKANF-------------------------- 362
           + R+FPF+RG+     A NFW + + + K    F                          
Sbjct: 271 MSRLFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVTIDE 330

Query: 363 TQEQLQLYSL-----------------------ILTIIAFLPAMLVILLYPRKYLLLYAL 399
            + +LQ Y++                       ILT+   + A++ +L  P     + +L
Sbjct: 331 IKTKLQQYNVGTKGLVQDVYFVILPQIQPKLTFILTLFYQILAVIPVLFSPSFERFVGSL 390

Query: 400 SACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKK 457
           + C  + +LF + VHEK             T TDR +L+    + + G  +L+PLL +
Sbjct: 391 TLCGFASFLFGWHVHEKAVLLIIIPFSFLVT-TDRRLLTPFHLVASAGYVSLFPLLHE 447

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  111 bits (278), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 101/420 (24%), Positives = 178/420 (42%), Gaps = 77/420 (18%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTA-FHSYLCGKIGSFFQPNWFTLGD 161
           DF+  R+W+ IT  + +  WY+     W LDYPP  A F  ++   + SF + +      
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRRDGCLDIV 123

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G     F RLTV+ SESL ++   +Y      + R QS    FI  ++I+  P  
Sbjct: 124 EVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVLSPGF 179

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           +++DH HFQ+N  +  + V ++    ++ Y   A+ + +++CFK + LY +P +F +LL 
Sbjct: 180 LIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFVFLLR 239

Query: 282 KSLFHPRLFNIPRFAAISF------------ATICTFASMFGPIYFFGGENGGITNLLQS 329
             + +   F    +  + F              +  F+  FGP  F         ++ Q 
Sbjct: 240 VYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVFSLCFGPFIF---------DMPQL 290

Query: 330 IKRIFPFARGIFEDKVA-NFWCVTNVIFK----------YKANFTQ------------EQ 366
           + R+FPF+RG+     A NFW + + + K          Y  NF              E+
Sbjct: 291 LSRLFPFSRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIAPSLLPSSIEE 350

Query: 367 LQL---------------------------YSLILTIIAFLPAMLVILLYPRKYLLLYAL 399
           ++                             + +LT+   + A++ +L  P     + +L
Sbjct: 351 IRQRIAEHNNGTKGLVQDVFFVILPQISPKLTFLLTLFYQILAVIPLLFDPSFKRFMGSL 410

Query: 400 SACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDG 459
           + C M+ YLF + VHEK                DR +L   + +++ G  +L+PLL ++ 
Sbjct: 411 TLCGMASYLFGWHVHEKAIMLVIIPFSFL-VVFDRRLLISFTLVSSAGYVSLFPLLYENA 469

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  111 bits (277), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 126/267 (47%), Gaps = 23/267 (8%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKI--GSFFQPNWFTLG 160
           DFE  R+W+ +T  LP+ +WY      W +DYPPL A+  +   ++  G+  +     L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKL- 117

Query: 161 DSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPS 220
            + G  G     F RLTV+ASE L Y+   VY +    + R  +    F+   ++   P+
Sbjct: 118 VAEGRYGWPTVVFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVALSPA 173

Query: 221 LILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLL 280
            +L+DH HFQ+N  +  + V ++    +  Y      F +++C K + LY +P +F +LL
Sbjct: 174 FLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVFLL 233

Query: 281 SKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLL---------QSIK 331
                   + ++  F   S+  +  FA  +G +   GG    I  +          Q + 
Sbjct: 234 -----RAYVLDLGEFRFRSYRDL-VFAVRWGNLCRLGGVVLAIMAVTFAPFAGVMPQLMA 287

Query: 332 RIFPFARGIFEDKVA-NFWCVTNVIFK 357
           R+FPF+RG+     A NFW + + + K
Sbjct: 288 RLFPFSRGLTHAYWAPNFWAIYSFVDK 314

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 107/416 (25%), Positives = 174/416 (41%), Gaps = 73/416 (17%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDS 162
           DF+  R+W+ IT  LPIS+WY+     W LDYPP  A+  +   +    F P   ++ D 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQ----FVPK--SVRDD 119

Query: 163 R-------GYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAI 215
                   G  G     F RLTV+ SE L ++   +Y        R+QS    F+  ++I
Sbjct: 120 GCLDIVEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSI 175

Query: 216 LFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIF 275
           +  P  ++IDH HFQ+N  +  + + ++    ++ Y   AV +  +ICFK + LY +P +
Sbjct: 176 VLSPGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCY 235

Query: 276 FAYLLSKSLFHPRLFNIPRFAA----ISFATICTFASMFGPIYFFGGENGGITNLLQSIK 331
           F +LL   + +   F    +      I +A +   A++   I+           + Q + 
Sbjct: 236 FVFLLRAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPFA-HQMPQVLS 294

Query: 332 RIFPFARGIFEDKVA-NFWC--------VTNVIFK--YKANFT----------------Q 364
           R+FPF+RG+     A NFW         +T V+ K  Y   F                  
Sbjct: 295 RLFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIPQNIKEIN 354

Query: 365 EQLQL-----------------------YSLILTIIAFLPAMLVILLYPRKYLLLYALSA 401
           E+L                          + ILTI   + A+L +L  P     + +L+ 
Sbjct: 355 ERLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQVLAVLPLLFDPSFKRFVGSLTL 414

Query: 402 CSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKK 457
           C ++ +LF + VHEK                DR +L     + + G  +L+PLL K
Sbjct: 415 CGLASFLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLVPFMLVASAGYVSLYPLLYK 469

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 106/414 (25%), Positives = 172/414 (41%), Gaps = 70/414 (16%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTA-FHSYLCGKIGSFFQPNWFTLGD 161
           DF+  R+W+ IT  LP+S+WY+     W LDYPP  A F  +L   +    + +      
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G     F RLTV+ SE L +    +Y        R+QS    F+  ++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           ++IDH HFQ+N  +  + + ++    ++ Y + AV +  SICFK + LY +P +F +LL 
Sbjct: 182 LMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVFLLR 241

Query: 282 KSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLL---------QSIKR 332
             + +   F    +    F  +  + ++F      G    GI  +          Q + R
Sbjct: 242 AYVLNVNNFKFKSYK--DFLFLIRWTNLFK----LGSIVIGIFTICFLPFAHQMPQVLSR 295

Query: 333 IFPFARGIFEDKVA-NFWC--------VTNVIFK--YKANFTQEQLQ------------- 368
           +FPF+RG+     A NFW         +T ++ K  Y   F  + ++             
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDKILTTIMLKLPYVHMFATKLIKPPLIPKDIKEINE 355

Query: 369 -------------------------LYSLILTIIAFLPAMLVILLYPRKYLLLYALSACS 403
                                      + ILTI   + A+L IL  P     + +L+ C 
Sbjct: 356 RLLANNGSKGLVQDVFFVILPQIPPRLTFILTIFYQILAVLPILFDPSFKRFIGSLTLCG 415

Query: 404 MSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKK 457
           ++ YLF + VHEK                DR +L     + + G  +L+PLL K
Sbjct: 416 LASYLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLIPFMLVASAGYVSLYPLLFK 468

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 102/423 (24%), Positives = 169/423 (39%), Gaps = 82/423 (19%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDS 162
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  A+  +   +    F P    + D 
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQ----FVPK--VVRDD 107

Query: 163 R-------GYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAI 215
                   G  G     F R +V+ SE L ++    +  K     R QS    FI   +I
Sbjct: 108 GCLDIVPVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSI 163

Query: 216 LFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIF 275
           +  P  ++IDH HFQ+N  +  + + ++     E Y    + + +++CFK + LY +P +
Sbjct: 164 ILSPGFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCY 223

Query: 276 FAYLLSKSLFHPRLFNIPRFAAIS--------FATICTFASMFGPIYFFGGENGGITNLL 327
           F +LL   + + + F    +  +         F       S+FG  +        I +L 
Sbjct: 224 FVFLLRAYVLNVKNFKFKSYKDLILLIQWNNLFKLGGIVLSIFGICFL-----PFIYHLP 278

Query: 328 QSIKRIFPFARGI--------------FEDKVANFW-------------CVTNVIFKYKA 360
           Q   R+FPF RG+              F DK+A                C+ + +F    
Sbjct: 279 QVFTRLFPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTR 338

Query: 361 NFTQEQLQLY------------------------SLILTIIAFLPAMLVILLYPRKYLLL 396
              Q ++  Y                        S ILT    L A++ +L  P     +
Sbjct: 339 EEIQSRIMEYGNNGSKGLVEDVYFIILPQIIPKLSFILTGFYQLLAVVPLLFDPSFKRFI 398

Query: 397 YALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLK 456
            +L+ C M+ +LF + VHEK                DR +L+    +++ G  +L+PLL 
Sbjct: 399 GSLTLCGMASFLFGWHVHEKAILLVIIPFSFL-VVCDRRLLTSFMLVSSAGYVSLFPLLY 457

Query: 457 KDG 459
           K+ 
Sbjct: 458 KND 460

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 102/420 (24%), Positives = 174/420 (41%), Gaps = 79/420 (18%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTA-FHSYLCGKIGSFFQPNWFTLGD 161
           DF+  R+WM IT  LPIS+WY+ +   W LDYPP  A F  +L   +    + +      
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 168

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLG-KRRNQSPIGQFIAVAAILFQPS 220
             G  G     F RLTV+ SE +C    + Y+        R QS    F+  ++I+  P 
Sbjct: 169 EVGQFGWPTVVFQRLTVIISE-ICLFAVLQYYINTSNLNERTQS----FVVASSIVLSPG 223

Query: 221 LILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLL 280
            +++DH HFQ+N+ +  + + ++     + Y   AV + +++CFK + LY +P +F +LL
Sbjct: 224 FLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFVFLL 283

Query: 281 SKSLFHPRLFNIPRFAAISF------------ATICTFASMFGPIYFFGGENGGITNLLQ 328
              + + + F    +  + F              +  F   F P  F          + Q
Sbjct: 284 RAYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAPFIF---------QMPQ 334

Query: 329 SIKRIFPFARGIFEDKVA-NFWCVTNVI----------FKYKANFTQE------------ 365
            + R+FPF+RG+     A NFW + + +          F Y   F  +            
Sbjct: 335 VLSRLFPFSRGLTHAYWAPNFWAIYSFLDKILAVVMLKFPYVHRFISKFISSPLIPSSIA 394

Query: 366 --------------------------QLQ-LYSLILTIIAFLPAMLVILLYPRKYLLLYA 398
                                     Q+Q   + +LT+   + A++ +L  P     + +
Sbjct: 395 EIKLRMEENNNGSKGLVEDVFFVILPQIQPKLTFLLTLFYQILAVIPVLFNPSFKRFIGS 454

Query: 399 LSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKD 458
           L+ C ++ YLF + VHEK                DR +LS    + + G  +L+PLL ++
Sbjct: 455 LTLCGLASYLFGWHVHEKAILLVIIPFSFLVV-CDRRLLSSFMLVASAGYVSLFPLLYEN 513

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  107 bits (267), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 102/410 (24%), Positives = 171/410 (41%), Gaps = 65/410 (15%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGK-IGSFFQPNWFTLGD 161
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  A+  +L  + +    + +      
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFVPKIVKEDGALDIV 114

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G     F RLTV+ SE L ++   V+        + +S    F+  ++I+  P  
Sbjct: 115 EIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVLSPGF 170

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           ++IDH HFQ+N  +    + ++     + Y + A  + +++CFK + LY +P +F +LL 
Sbjct: 171 LMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVFLLR 230

Query: 282 KSLFHPRLFNIPRFAAISFAT----ICTFASMFGPIYF--FGGENGGITNLLQSIKRIFP 335
             + + + F    +  + F      +   AS+   I+F  FG     + +L Q + R+FP
Sbjct: 231 AYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFG---PFLYDLPQVMTRLFP 287

Query: 336 FARGIFEDKVA-NFWCV--------TNVIFK-----------------------YKANFT 363
           F+RG+     A NFW +        T V+ K                        K    
Sbjct: 288 FSRGLTHAYWAPNFWAIYSFLDKILTFVMLKLPYVHAFATKFISPPLIPESLDDLKERLV 347

Query: 364 QEQLQLYSLILTI-IAFLP-----------------AMLVILLYPRKYLLLYALSACSMS 405
           Q       L+  +  A LP                 A++ +L  P     + +L+ C +S
Sbjct: 348 QNNSGTKGLVQDVFFAILPQISPKLTFILTMFYQALAVIPLLFDPSFKRFIGSLTLCGLS 407

Query: 406 FYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 455
            YLF + VHEK                DR +LS    +   G  +L+PLL
Sbjct: 408 SYLFGWHVHEKAIMLVIVPFSFL-VVCDRRLLSSFMLVAAAGYVSLFPLL 456

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 121/260 (46%), Gaps = 21/260 (8%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTA-FHSYLCGKIGSFFQPNWFTLGD 161
           DF+  R+W+ IT  LPIS+WY+     W LDYPP  A F  +L   +    + +      
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G     F RLTV+ SE L Y    +Y        R+QS    F+  ++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           ++IDH HFQ+N  +  + + ++    ++ Y   A  +  +ICFK + LY +P +F +LL 
Sbjct: 182 LMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVFLLR 241

Query: 282 KSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLL---------QSIKR 332
             + +   F    +    F  +  +A++F      G    GI  +          Q + R
Sbjct: 242 AYVLNVNNFKFKSYK--DFLFLIRWANLFK----LGSIVIGIFTICFVPFAHQMPQVLSR 295

Query: 333 IFPFARGIFEDKVA-NFWCV 351
           +FPF+RG+     A NFW +
Sbjct: 296 LFPFSRGLTHAYWAPNFWAL 315

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 121/260 (46%), Gaps = 21/260 (8%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTA-FHSYLCGKIGSFFQPNWFTLGD 161
           DF+  R+W+ IT  LPIS+WY+     W LDYPP  A F  +L   +    + +      
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G     F RLTV+ S+ L ++   VY        R+QS    F+  ++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLSPGF 181

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
            +IDH HFQ+N  +  + + ++     + Y   A+ +  +ICFK + LY +P +F +LL 
Sbjct: 182 FMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVFLLR 241

Query: 282 KSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLL---------QSIKR 332
             + +   F    +    F  +  +A++F      G    GI  +          Q + R
Sbjct: 242 AYVLNVNNFKFKSYK--DFLFLIRWANLFK----LGSIVIGIFTICFLPFAHQMPQVLSR 295

Query: 333 IFPFARGIFEDKVA-NFWCV 351
           +FPF+RG+     A NFW +
Sbjct: 296 LFPFSRGLTHAYWAPNFWAL 315

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 1/87 (1%)

Query: 371 SLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYT 430
           + ILTI   + A+L +L  P     + +L+ C ++ +LF + VHEK              
Sbjct: 384 TFILTIFYQILAVLPLLFDPSFKRFVGSLTLCGLASFLFGWHVHEKAIMLVIVPFTFL-V 442

Query: 431 STDRNVLSRVSWMNNIGLFTLWPLLKK 457
             DR +L     + + G  +L+PLL K
Sbjct: 443 GFDRRLLVPFMLIASAGYVSLYPLLYK 469

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 98/423 (23%), Positives = 172/423 (40%), Gaps = 82/423 (19%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGK-IGSFFQPNWFTLGD 161
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  A+  ++  + + +  + +      
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQFVPAAVRADGCLDIV 112

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
            +G  G     F R TV+ASE L ++   VY        + QS    F+  ++I+  P L
Sbjct: 113 PQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVLSPML 168

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           +++DH HFQ+N  +  + + ++       +   A  +  ++CFK + LY +P +F +LL 
Sbjct: 169 LIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFMFLLR 228

Query: 282 --------------KSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLL 327
                         K LF  R+ +  R   +    +      F P            ++ 
Sbjct: 229 TYVLQFEGFRFKSYKDLF--RIIHWGRLFKLGGVVLGVAVVCFAPF---------ARDMP 277

Query: 328 QSIKRIFPFARGIFEDKVA-NFWCVTNV--------------------------IFKYKA 360
           Q + R+FPF+RG+     A NFW + ++                          IF    
Sbjct: 278 QLLSRLFPFSRGLTHAYWAPNFWALYSLCDKVLTVALLKVPLFHRLILKVLSPKIFPASL 337

Query: 361 NFTQEQLQ-------------LYSLILTIIAFLPAMLVILLYPRKYLL-----------L 396
           +  +++L+             +Y ++L  I      L+ LLY    +L           L
Sbjct: 338 DIIRQRLKKNANHGTKGLVEDVYFVVLPQITPATTFLLTLLYQVLAVLPLLFDASFKRFL 397

Query: 397 YALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLK 456
            +L+ C  + +LF + VHEK                DR +L+    +   G  +L+PLL 
Sbjct: 398 GSLTLCGFASFLFGWHVHEKAIMLVIIPFSFL-VVYDRRLLTSFKLVTTAGYVSLFPLLY 456

Query: 457 KDG 459
           K+ 
Sbjct: 457 KND 459

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 96/416 (23%), Positives = 163/416 (39%), Gaps = 77/416 (18%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTA-FHSYLCGKIGSFFQPNWFTLGD 161
           DF+  R+W+ IT  LP+ +WY      W LDYPP  A F  +L   +    + +      
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 107

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G     F R+TV+ SE L ++   ++    + K         FI  ++I+  P  
Sbjct: 108 EVGNFGMPTIIFQRITVIVSEVLLFVVLQIF----INKSATNEKSANFIVASSIVLSPGF 163

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLS 281
           +++DH HFQ+N  +  + +  +       Y      F  ++CFK + LY +P FF +LL 
Sbjct: 164 LIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVFLLR 223

Query: 282 KSLF---------HPRLFNI---PRFAAISFATICTFASMFGPIYFFGGENGGITNLLQS 329
             +          +  L +I    R   +    +  FA  F P          I+ + Q 
Sbjct: 224 AYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF---------ISEMPQL 274

Query: 330 IKRIFPFARGIFEDKVA-NFWCVTNVIFKY------------------------------ 358
           ++R+FPF+RG+     A NFW + +++ K                               
Sbjct: 275 LERLFPFSRGLTHAYWAPNFWALYSLLDKVLTFVMLRLPYVHRFIIKFVAPPLIPATIDE 334

Query: 359 -KANFTQEQLQLYSLI------------------LTIIAFLPAMLVILLYPRKYLLLYAL 399
            K   +Q  +    L+                  LT+   + A++ +L  P       +L
Sbjct: 335 IKQRLSQNNVGTRGLVQDVYFVILPQIQPKLTFLLTLFYQILAVIPVLFNPSFKRFAGSL 394

Query: 400 SACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 455
           + C  S +LF + VHEK             T  DR +++    + + G  +L+PLL
Sbjct: 395 TLCGFSSFLFGWHVHEKAIMLVIIPFSFLVT-LDRRLVTPFRLLVSAGYVSLFPLL 449

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 99/418 (23%), Positives = 166/418 (39%), Gaps = 83/418 (19%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGD- 161
           DF+  R+W+ IT  LP+++WY      W LDYPP  A+  +   +    F P        
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQ----FVPKSVAEDGC 107

Query: 162 ----SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQ----FIAVA 213
                 G  G     F R+TV+ SE + Y    V+         N S I +    F+  +
Sbjct: 108 LDIVKVGSFGLPTIIFQRITVILSELVLYAALQVFI--------NTSDISEKSANFVVAS 159

Query: 214 AILFQPSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSP 273
           +I+  P L+++DH HFQ+N  + G+ + ++    ++ Y   A  F +++CFK + LY +P
Sbjct: 160 SIVLSPGLLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAP 219

Query: 274 IFFAYLLSKSLFHPRLFNIPRF----AAISFATICTFASMFGPIYFFGGENGGITNLLQS 329
            +F +LL   +     F    +    + + ++ +   AS+   I+        IT   Q 
Sbjct: 220 AYFVFLLRAYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSLAFL-PFITTWQQL 278

Query: 330 IKRIFPFARGI--------------FEDKVANFWC------------------------- 350
           + R+FPF+RG+              F DKV                              
Sbjct: 279 LARLFPFSRGLTHAYWAPNVWAVYSFTDKVLTVLVLKLPYLQKILSIVLTSMPKTAADIH 338

Query: 351 -------------VTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLY 397
                        V +V F      T +   L +L   I+A +P    +L  P     + 
Sbjct: 339 VRIESNNSGTRGLVQDVFFVVLPQITPKLTFLLTLFYQILAVVP----VLFDPSFKRFVG 394

Query: 398 ALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 455
           +L+ C    +LF + VHEK                DR +L+  + + + G  +L+PLL
Sbjct: 395 SLTLCGFVSFLFGWHVHEKAIMLVIFPFSFL-VPFDRRLLTPFTLLASAGYVSLFPLL 451

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score = 98.6 bits (244), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 94/419 (22%), Positives = 161/419 (38%), Gaps = 83/419 (19%)

Query: 103 DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGK-IGSFFQPNWFTLGD 161
           D E  R+W+ +T  LP+  WY      W LDYPP  A+  ++  + + +  + +      
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 162 SRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSL 221
             G  G     F+RLTV+ +E L ++   V+        R  +    FI  ++I   P  
Sbjct: 153 KEGKFGWPTVVFLRLTVIGTEILLFVVLQVFINTSDESERTVN----FIIASSIALSPGF 208

Query: 222 ILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLL- 280
           +++DH HFQ+N  +  + + ++     E Y      F   +CFK + LY +P +F +LL 
Sbjct: 209 LIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTFLLR 268

Query: 281 --------------SKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNL 326
                            +F  R FN+ +   I  + +      F P+            L
Sbjct: 269 AYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV------------L 316

Query: 327 LQSIKRIFPFARGI--------------FEDKVANFW---------CVTNVIFKYKANFT 363
            Q I R+FPF+RG+              F D++  F          C T ++       +
Sbjct: 317 PQLISRLFPFSRGLTHAYWAPNFWAVYAFMDRILTFIMLKMPYVHKCATKIVLPPLIPNS 376

Query: 364 QEQLQ---------------------------LYSLILTIIAFLPAMLVILLYPRKYLLL 396
            E+++                             +  LT+   + A++ +L  P     +
Sbjct: 377 IEEIKNRIGASNYGTRGLVQDILFIILPQVQPRLTFALTLFYQILAIIPVLFNPSFKRFI 436

Query: 397 YALSACSMSFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 455
             L+ C  S +LF + VHEK              S DR +L+    +   G  +L+PLL
Sbjct: 437 GCLTLCGFSSFLFGWHVHEKAIMLVIVPFSFL-VSMDRRLLTPFMLLTASGYVSLFPLL 494

>Kpol_1014.41 s1014 (78673..80898) [2226 bp, 741 aa] {ON}
           (78673..80898) [2226 nt, 742 aa]
          Length = 741

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 340 IFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYAL 399
           I  D+  +FWC  N + + + NF ++Q  +   +LT+ +    ML     P+   L   L
Sbjct: 535 IIRDEALSFWCFVNFMERMERNFMRDQSGIRDQMLTLSSLCQIML-----PQ---LSSHL 586

Query: 400 SACSMSFYLFSFQV 413
           S C  S   F F++
Sbjct: 587 SKCDSSNLFFCFRM 600

>TDEL0A00730 Chr1 complement(121965..124229) [2265 bp, 754 aa] {ON}
           Anc_2.30 YDL234C
          Length = 754

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 340 IFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYAL 399
           I  D+  +FWC  N + + + NF ++Q  +   +LT+       L  LL P+   L   L
Sbjct: 534 IVRDEALSFWCFVNFMDRMERNFLRDQSGIRDQMLTLTE-----LCQLLLPQ---LTEHL 585

Query: 400 SACSMSFYLFSFQV 413
           + C  S   F F++
Sbjct: 586 NKCDSSNLFFCFRM 599

>CAGL0C05489g Chr3 (528599..530836) [2238 bp, 745 aa] {ON} similar
           to uniprot|P48365 Saccharomyces cerevisiae YDL234c GYP7
          Length = 745

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 8/74 (10%)

Query: 340 IFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYAL 399
           I  D+   FWC TN + + + NF ++Q  +   +L +      ML     PR   L   L
Sbjct: 533 IIRDEETTFWCFTNFMERMERNFLRDQSGIRDQMLALTDLCQLML-----PR---LSAHL 584

Query: 400 SACSMSFYLFSFQV 413
             C  S   F F++
Sbjct: 585 QKCDSSDLFFCFRM 598

>KLLA0D19272g Chr4 (1618994..1621222) [2229 bp, 742 aa] {ON} similar
           to uniprot|P48365 Saccharomyces cerevisiae YDL234C GYP7
           GTPase-activating protein for yeast Rab family members
           including: Ypt7p (most effective) Ypt1p Ypt31p and
           Ypt32p (in vitro) involved in vesicle mediated protein
           trafficking
          Length = 742

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 25/45 (55%)

Query: 340 IFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAML 384
           + +D+  +FWC  N + + + NF ++Q  +   +LT++     ML
Sbjct: 523 VLQDEALSFWCFVNFMNRMERNFLRDQSGIRDQMLTLVDLCQFML 567

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.144    0.476 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,858,224
Number of extensions: 2553122
Number of successful extensions: 6482
Number of sequences better than 10.0: 52
Number of HSP's gapped: 6490
Number of HSP's successfully gapped: 72
Length of query: 580
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 465
Effective length of database: 40,294,809
Effective search space: 18737086185
Effective search space used: 18737086185
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 69 (31.2 bits)