Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C026206.23ON31131116600.0
NCAS0D021706.23ON31030913320.0
KAFR0A050806.23ON31130212321e-171
KNAG0M011906.23ON38030812141e-167
CAGL0F01815gsingletonON31429511161e-154
TDEL0G044606.23ON36931011101e-152
KNAG0D02240singletonON35930210931e-149
KNAG0K01400singletonON30930410791e-148
SAKL0E01342g6.23ON34130110661e-146
ZYRO0C07722g6.23ON37330210671e-145
Kpol_1061.27singletonON30630310281e-140
TPHA0M002806.23ON30329210221e-139
Kpol_385.5singletonON30630310191e-139
CAGL0I08151gsingletonON38229510261e-139
NCAS0H008406.23ON36029310171e-138
NDAI0D008306.23ON37430110111e-137
KLTH0C11154g6.23ON3053019851e-134
Kwal_56.224396.23ON3203069701e-131
KLLA0D01243g6.23ON3113059611e-130
KAFR0G026806.23ON3833029521e-128
KNAG0K017003.175ON135640676.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C02620
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      644   0.0  
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   517   0.0  
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   479   e-171
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   472   e-167
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   434   e-154
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              432   e-152
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   425   e-149
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   420   e-148
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   415   e-146
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   415   e-145
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   400   e-140
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   398   e-139
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   397   e-139
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   399   e-139
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   396   e-138
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   394   e-137
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   384   e-134
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   378   e-131
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   374   e-130
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     371   e-128
KNAG0K01700 Chr11 (352052..356122) [4071 bp, 1356 aa] {ON}             30   6.7  

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60
           MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP
Sbjct: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60

Query: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120
           HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ
Sbjct: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120

Query: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180
           LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI
Sbjct: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180

Query: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240
           FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE
Sbjct: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240

Query: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300
           TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK
Sbjct: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300

Query: 301 DVPAFEKSSKD 311
           DVPAFEKSSKD
Sbjct: 301 DVPAFEKSSKD 311

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/309 (79%), Positives = 272/309 (88%), Gaps = 1/309 (0%)

Query: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60
           M+K  Q RSV K+F+AIEQEEGVGAHVRRSIGSMKQRNFSPFLLMD+FTVSHPAGFPDHP
Sbjct: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60

Query: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120
           HHGQETITYVL GMIAHEDFTGS+GVLRPGDLQFMTAGKAIMHSEIPV+M NG  GIGIQ
Sbjct: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120

Query: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180
           LWV LP  LKN EPRYRNLR  +IPI+KPN++LTVRV+SGKSYG ESVKDLAYTPIDYY 
Sbjct: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180

Query: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240
            N  K G EF QE P +FN FLYI KG+V+IN  V+P+YST+FF TDGD+IKG SA+ E+
Sbjct: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSAS-ED 239

Query: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300
           TEF ++GG ILDQPI+QHGPFVE+DRESLL+VFKNYQYCINGFERARGWRS IADGI E 
Sbjct: 240 TEFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHED 299

Query: 301 DVPAFEKSS 309
           DV AFEKS+
Sbjct: 300 DVEAFEKSN 308

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  479 bits (1232), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 218/302 (72%), Positives = 266/302 (88%), Gaps = 1/302 (0%)

Query: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67
           R++ K+F+A+EQEEGVGA VRRS+GSM+QRNF+PFLL+DHFTVSHPAGFPDHPHHGQETI
Sbjct: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70

Query: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127
           TYV NGMIAHEDFTGSKG+LRPGDLQFMTAGK IMHSEIPV MENG  G+G+QLWV LP 
Sbjct: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130

Query: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187
           ++K+ EPRYRNLRG +IPI++PNE+L V+VISG+SYG ESVK+LAYTP+D+Y F  NKKG
Sbjct: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190

Query: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247
            +F Q+TP NFNFFLY+ KG+V+I    +P+YST+FF+ DG+ IKG   +D++TEFAIIG
Sbjct: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKG-VVSDDDTEFAIIG 249

Query: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDVPAFEK 307
           GLILDQP++QHGPF+E+ RE L++VF+N+QY INGFERA GW+SSI +GILEKDVP FE 
Sbjct: 250 GLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKFEG 309

Query: 308 SS 309
           S+
Sbjct: 310 SA 311

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  472 bits (1214), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 218/308 (70%), Positives = 266/308 (86%), Gaps = 1/308 (0%)

Query: 3   KVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHH 62
           ++P+ R++ K+FIA EQEEGVGA VRRS+GSM+QRNFSPFLL+DHFTVSHPAGFPDHPHH
Sbjct: 71  EMPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHH 130

Query: 63  GQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLW 122
           GQETITYV  GMIAHEDF GSKGVLRPGDLQFMTAGK IMHSEIPV MENG  G+G+QLW
Sbjct: 131 GQETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLW 190

Query: 123 VALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFN 182
           V LP D+K+  PRYRNLRG +IPI +PNE+L ++VISGKS+G +SVK+LAYTP+D+Y + 
Sbjct: 191 VDLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYI 250

Query: 183 MNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETE 242
            +KKG  F QE P NFN FLY+ KGAV+I+G V+P+YSTVF++ +GD+I+G    D++TE
Sbjct: 251 SDKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGM-VDDDDTE 309

Query: 243 FAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDV 302
           FAIIGGLILDQP++QHGPFVET RE +++VF+N+QY INGFERA GW+SSI +GILEKDV
Sbjct: 310 FAIIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369

Query: 303 PAFEKSSK 310
           PAFE + +
Sbjct: 370 PAFEAAGE 377

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  434 bits (1116), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 244/295 (82%), Gaps = 1/295 (0%)

Query: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67
           RS+ K+F+  EQEEGVGA VRRS+G+MKQR FSPFL++D F V HPAGFPDHPHHGQETI
Sbjct: 5   RSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHGQETI 64

Query: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127
           TYVLNGM+AHEDFTG+KGVL  GDLQFMTAGK I+HSEIPV+ME+G    G+Q WV LP 
Sbjct: 65  TYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWVDLPK 124

Query: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187
           DLK  EPRYRNLRGDKIP+++PNENLTV+VISGKSYG +SV+DLAYTPI  Y +  NK G
Sbjct: 125 DLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLTNKAG 184

Query: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247
            ++ QE P+NFN F+Y+ KG V +   V+P+++ VFF+TDGD++KG+ A D + +FAI+G
Sbjct: 185 TQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATD-DAQFAIMG 243

Query: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDV 302
           G ILDQ  +QHGPFVETDRESL++VF NYQY INGFERA+GW+SSI  GI EK V
Sbjct: 244 GQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQV 298

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  432 bits (1110), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 201/310 (64%), Positives = 249/310 (80%), Gaps = 1/310 (0%)

Query: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60
           MSK  Q+RS+ KNF+A +QEEGVGA VRRSIG+M+ R FSPFL++DHFTVS PAGFPDHP
Sbjct: 58  MSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHP 117

Query: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120
           HHGQETITY+L GM+AHEDF+ SKG+L PGDLQFMTAGKAI+HSEIPVKM++G P +G+Q
Sbjct: 118 HHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQ 177

Query: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180
           LWV LP  LKN EPRYR+L+   IP+IKP+E+L V VISG SYG +S +DLAYTP+ YY 
Sbjct: 178 LWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYH 237

Query: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240
           F  +KKG EF QE PR FN F+YI KG++ I   ++P++STVFFDTDGD+++G SA+D  
Sbjct: 238 FATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASD-N 296

Query: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300
            EF +IGG IL Q ++QHGPFVET+RE L++VF NYQ  INGF+R R WRS+IA GI E 
Sbjct: 297 AEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITES 356

Query: 301 DVPAFEKSSK 310
           +     ++SK
Sbjct: 357 EAKKDFRNSK 366

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  425 bits (1093), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 198/302 (65%), Positives = 244/302 (80%), Gaps = 1/302 (0%)

Query: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60
           M  + ++RS+A +FI  E  EGVGA V+RS+GSM+QR F+PFL++D FTV  P+GFPDHP
Sbjct: 54  MPSLFKLRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDFTVKSPSGFPDHP 113

Query: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120
           HHGQETITYV++G+IAHEDFTGSKGVLRPGDLQFMTAGK I+HSE+PV+ME+G P  G+Q
Sbjct: 114 HHGQETITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVEMEDGRPARGLQ 173

Query: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180
           LWV LP DLKN EPRYRNLR + IP++KP+ENL VRVISGKSYGTESVKDLAYTPID+Y 
Sbjct: 174 LWVDLPKDLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESVKDLAYTPIDFYY 233

Query: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240
              +K G EF QE P +FN FLY+ KG+V IN  V+ + + +FFDTDG+ + G++ +D +
Sbjct: 234 MLASKAGTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDGEGVAGQAGSD-D 292

Query: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300
           TEFAIIGG ILDQP++QHGPFVETD+E L + F NY+    GFERA+GWRS IA GI E 
Sbjct: 293 TEFAIIGGKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGWRSDIASGINES 352

Query: 301 DV 302
           + 
Sbjct: 353 EA 354

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  420 bits (1079), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 195/304 (64%), Positives = 245/304 (80%), Gaps = 1/304 (0%)

Query: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67
           RSV K F A+EQ EGVGA VRRSIG  +QRNFSPFLL+DHFTVSHP+GFPDHPHHGQETI
Sbjct: 6   RSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHGQETI 65

Query: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127
           TY+  GMIAHEDFTGSKG+LRPGDLQFMTAGK I+HSEIPV  ++    +G+QLWV LP 
Sbjct: 66  TYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLPK 125

Query: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187
           ++K+  PRYRNLR  +IPI +PNE+L V+VISGKSYG ESVK+LAYTP+D+Y +  +K+G
Sbjct: 126 NMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYISDKEG 185

Query: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247
           + F QE P N+N FLY+ +G+V ++G  YP+YST+F++ +G++IKG +  ++ TEFAII 
Sbjct: 186 INFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVT-GEKNTEFAIIA 244

Query: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDVPAFEK 307
           GLILDQ I+QHGPFVET  E + +VF+NYQ+ INGFE+A  W SSI +GI EKD+  FE 
Sbjct: 245 GLILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKDITNFES 304

Query: 308 SSKD 311
             K+
Sbjct: 305 QPKE 308

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  415 bits (1066), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 249/301 (82%), Gaps = 1/301 (0%)

Query: 2   SKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPH 61
           +++ ++R++ K+F+A+EQ EGVGA VRRSIG+ + RNF+PFL++DHF V+ PAGFPDHPH
Sbjct: 35  NRMSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPH 94

Query: 62  HGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQL 121
           HGQETITYVL GM+AHEDFTGSKGVLRPGDLQFMTAGK I+HSEIPVKME+G P +G+QL
Sbjct: 95  HGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQL 154

Query: 122 WVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIF 181
           WV LP  LKN EPRYR+LRG + PI +P++NL VRVISG+SYG +S  +LAYTP+ +Y F
Sbjct: 155 WVDLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHF 214

Query: 182 NMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEET 241
             +KKG  F Q+ P +FN F+Y+ KG++ +N   +P+YS +FF  DG+ ++G +A+D +T
Sbjct: 215 ISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASD-DT 273

Query: 242 EFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKD 301
           EFA++GG IL+QP++QHGPFVET +E ++QVF++YQ+ +NGFERA  W+SSI+DGI +++
Sbjct: 274 EFALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQN 333

Query: 302 V 302
            
Sbjct: 334 A 334

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  415 bits (1067), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 198/302 (65%), Positives = 237/302 (78%), Gaps = 1/302 (0%)

Query: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60
           MSK   +RSV KNFIAIEQEEGVGA VRRSIG+MK R F PFL++D F V  PAGFPDHP
Sbjct: 67  MSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHP 126

Query: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120
           HHGQETITY L GMIAHEDFTGSKGVL PGDLQFMTAGK I+HSEIPV +E+G+   G+Q
Sbjct: 127 HHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQ 186

Query: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180
           LWV LP +LKN EPRYR+LR  + P +K N+NLTVRVISGKSYG +SV++LAYTP+ +Y 
Sbjct: 187 LWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYH 246

Query: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240
           F  +KKG EF QE P++FN F YI KG++ +N  V+P++S VFFDTDG+ + G S +D +
Sbjct: 247 FITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSD-D 305

Query: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300
            EF +IGG ILDQ +LQHGPFVET RE ++ VF+NYQY +NGFE A  W S IA GI E 
Sbjct: 306 AEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEA 365

Query: 301 DV 302
           + 
Sbjct: 366 EA 367

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  400 bits (1028), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 233/303 (76%), Gaps = 1/303 (0%)

Query: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60
           MSK   +RS+ K+FI+ EQ EGVGA VRRSIG+M  R FSPFL++DHF V+  AGFPDHP
Sbjct: 1   MSKQQNLRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHP 60

Query: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120
           HHGQETITYV  GMIAHEDFTG KGVL  GDLQFMTAGKAI H+E+PV+  +G   +G+Q
Sbjct: 61  HHGQETITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQ 120

Query: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180
           LWV LP D+KN+EPRYR+LR   IP   P ++L + VISG SYG +SVKDLAYTPID+Y+
Sbjct: 121 LWVDLPTDMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYM 180

Query: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240
           +   K G EF Q+  R+FN F+Y+ KGAV I   V+P+YS++FF+TDGD++ G  AAD +
Sbjct: 181 YRGKKAGTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAAD-D 239

Query: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300
           TEFAIIGG ILDQ  +QHGPFVE  +E L++VF +YQ   NGFERAR WRSSI DGI E 
Sbjct: 240 TEFAIIGGKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKED 299

Query: 301 DVP 303
           D P
Sbjct: 300 DAP 302

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  398 bits (1022), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 190/292 (65%), Positives = 230/292 (78%), Gaps = 1/292 (0%)

Query: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67
           RS+ K+FIA EQ EGVGA VRRSIG+ K R FSPFL++DHF V  PAGFPDHPHHGQETI
Sbjct: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65

Query: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127
           TYV  GM+AHEDFTGSKG+LRPGDLQFMTAGKA+ HSE+PV MENG    G+QLWV LP 
Sbjct: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125

Query: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187
           +LKN+EPRYR+L  + IPI KP+ENL + VISGKSYG ESVKDLAYTP+D+Y++   KKG
Sbjct: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185

Query: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247
             F Q+  R++N FLYI KG+V I   V+P++S++FF+TDGD+++G   +D +TEFAIIG
Sbjct: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSD-DTEFAIIG 244

Query: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILE 299
           G IL Q  +QHGPFVE   E L++VF NY+    GFERA  WRSSI +GI E
Sbjct: 245 GQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDE 296

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  397 bits (1019), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 190/303 (62%), Positives = 232/303 (76%), Gaps = 1/303 (0%)

Query: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60
           MSK   +RS+ K+FIA EQ EGVGA VRRSIG+M  R FSPFL++DHF V+  AGFPDHP
Sbjct: 1   MSKQQNLRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHP 60

Query: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120
           HHGQETITYV  GMIAHEDFTG KGVL  GDLQFMTAGKAI H+E+PV+  +G   +G+Q
Sbjct: 61  HHGQETITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQ 120

Query: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180
           LWV LP D+KN+EPRYR+L+  +IP   P ++L V VISG SYG +SVKDLAYTPID+Y+
Sbjct: 121 LWVDLPTDMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYM 180

Query: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240
           +   K G EF Q   R+FN F+Y+ +GA+ I   V+P+YS++FF+TDGD++ G  AAD  
Sbjct: 181 YRGKKAGTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAAD-N 239

Query: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300
           TEFAIIGG ILDQ  +QHGPFVE  +E L++VF +YQ   NGFERAR W+SSI DGI E 
Sbjct: 240 TEFAIIGGKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKEN 299

Query: 301 DVP 303
           D P
Sbjct: 300 DAP 302

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  399 bits (1026), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 231/295 (78%), Gaps = 1/295 (0%)

Query: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67
           RS+  +FIA EQEEGVGA VRRS+G+ + R F+PFL++D FTV+ P GFPDHPHHGQETI
Sbjct: 83  RSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQETI 142

Query: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127
           TYV +GMIAHED TGSKGVL  GDLQFMTAGK I+HSEIPV  ++G P  G+QLWV LP 
Sbjct: 143 TYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLPS 202

Query: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187
           D+KN +PRYRNLRG++ P+  PNENL VRVISGKSYG ES++DLAYTP+  Y F  NK G
Sbjct: 203 DMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKTG 262

Query: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247
            EF Q+ P +FN F+Y+ KG++++N V    +S+ FFD DG++I+GK A  E+ +FAII 
Sbjct: 263 TEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGK-ALSEDAQFAIIA 321

Query: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDV 302
           G ILDQ ++QHGPFVET+RE L++VF+NYQ   NGFE A  WRSSI DGI E++ 
Sbjct: 322 GRILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEA 376

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  396 bits (1017), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/293 (64%), Positives = 229/293 (78%), Gaps = 1/293 (0%)

Query: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67
           RS+ K+FIA EQ EG GA VRRS+GS +   FSPFL++D F V+ P GFPDHPHHGQETI
Sbjct: 62  RSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETI 121

Query: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127
           TYV  G++AHEDFTGSKGVL PGDLQFMTAGK I+H E+PV M +     G+Q WV LP 
Sbjct: 122 TYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPA 181

Query: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187
           DLKN EPRYRNLR D IP+++ N+NL V+VISGKSY  ESVKDLAYTPID+Y F  NK G
Sbjct: 182 DLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAG 241

Query: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247
            EF QE P +FN F+Y+TKGA+ I   V+  +S+VFF TDG+ I+G +A+D  TEFA+IG
Sbjct: 242 TEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASD-NTEFAVIG 300

Query: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300
           G ILDQ ++QHGPFVET RE L++VF NY+  INGFE+A GW+SSI++GI E+
Sbjct: 301 GKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQ 353

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  394 bits (1011), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 193/301 (64%), Positives = 238/301 (79%), Gaps = 4/301 (1%)

Query: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHP-AGFPDHPHHGQET 66
           R++ K FI  EQ EGVGA VRR+IG+ +   F PFL++DHF V+ P  GFPDHPHHGQET
Sbjct: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132

Query: 67  ITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALP 126
           ITY+L+GMIAHEDFTGSKGVLRPGDLQFMTAGK I+HSE+PV M++G PGIG+QLWV LP
Sbjct: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192

Query: 127 IDLKNSEPRYRNLRGDKIPIIKPNE--NLTVRVISGKSYGTESVKDLAYTPIDYYIFNMN 184
            +LKN EPRYRNLR ++IPI+  ++  ++TV+VISG +YG +SV+DLAYTPI +Y +  +
Sbjct: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252

Query: 185 KKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFA 244
           K GVEF Q  P +FN FLY+ KGAV I+  ++ + + VFF+ DG SIKG+SA + +TEFA
Sbjct: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATN-DTEFA 311

Query: 245 IIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDVPA 304
           IIGG ILDQP++QHGPFVET RE L +VF+NYQ  INGFERA  WRSSIADGI E    A
Sbjct: 312 IIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANA 371

Query: 305 F 305
            
Sbjct: 372 L 372

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  384 bits (985), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 233/301 (77%), Gaps = 1/301 (0%)

Query: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67
           RS+ K F A+EQ EGVGA VRRSIGS + RNF+PFL++DHF VS PAGFPDHPHHGQETI
Sbjct: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64

Query: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127
           TYVL GMIAHEDFTGS+GVLRPGDLQFMTAGK I+HSEIPV++E+G P +G+QLWV LP+
Sbjct: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124

Query: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187
            LK+ EPRYR+L  ++IP ++P   L VRVISG+SYG  S+ +LAYTP+ +Y +   K G
Sbjct: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184

Query: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247
             F Q  P NFN F+Y+ KG+V +NG  + +YS+VFF+TDG  ++  S + EE+EF +IG
Sbjct: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVE-GSGSSEESEFILIG 243

Query: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDVPAFEK 307
           G +LDQPILQ+GPFVET ++++ +V  NYQ   NGFERA+GW SSIA G++  DV   E 
Sbjct: 244 GEVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIES 303

Query: 308 S 308
            
Sbjct: 304 C 304

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  378 bits (970), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 174/306 (56%), Positives = 232/306 (75%), Gaps = 1/306 (0%)

Query: 4   VPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHG 63
           + + RS+ K F A+EQ EGVGA VRRSIG+ K RNF+PFL++DHFT++ PAGFPDHPHHG
Sbjct: 15  MKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHG 74

Query: 64  QETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWV 123
           QET+T++L G +AHEDFTGSKGVLR GDLQFMTAGK  +HSEIPV++E+G P  GIQLWV
Sbjct: 75  QETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWV 134

Query: 124 ALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNM 183
            LP  LK+ +PRYR+L+ D+IP  +    L + VISG+SYG +S+++LAYT + YY +  
Sbjct: 135 DLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVF 194

Query: 184 NKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEF 243
           ++  + F Q  P +FN FLY+ KG + I G  + K+S++FF TDG  + G S ++ + EF
Sbjct: 195 SEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSN-DLEF 253

Query: 244 AIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDVP 303
            + GG ILDQPI+Q+GPFVET +E +++VF+NYQ   NGFE+A GW SSIA+GI+E D+ 
Sbjct: 254 ILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDIS 313

Query: 304 AFEKSS 309
            F KSS
Sbjct: 314 DFVKSS 319

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  374 bits (961), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 176/305 (57%), Positives = 234/305 (76%), Gaps = 1/305 (0%)

Query: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60
           ++ V ++RSV K+F+AIEQ EG GA V+RSIG+++ RNF PFL++D+F VS PAGFP+HP
Sbjct: 3   LNVVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHP 62

Query: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120
           HHGQETITYVL GM+AHEDFTGSKGVLR GDLQFMTAGKAI+HSEIPVKM+NG    G+Q
Sbjct: 63  HHGQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQ 122

Query: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180
           LWV LP D+KN EPRYR+LR ++IP+  P++NL V+VISG+SYG +S+ +LAYTP+++Y 
Sbjct: 123 LWVDLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYH 182

Query: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240
           F  NKK  EF Q    +F+ F+YI KG++ I+   YP+ S +FF  DGD I+G + +D  
Sbjct: 183 FIANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSD-N 241

Query: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300
            EFAII G   +Q ++Q+GPFVE+ RE+++ V +NYQ  +NGFE AR W   I +G+ E 
Sbjct: 242 AEFAIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEA 301

Query: 301 DVPAF 305
           +V  +
Sbjct: 302 EVQQY 306

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  371 bits (952), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 180/302 (59%), Positives = 223/302 (73%), Gaps = 1/302 (0%)

Query: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60
           MS++   RS+  +FI  E  EG GA V+RSIGS +QR F+PFL++D F V+ PAGFPDHP
Sbjct: 78  MSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHP 137

Query: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120
           HHGQETITYVL+GMIAHEDFTG  G+L PGDLQFMTAG+ I+HSEIPV MENG    G+Q
Sbjct: 138 HHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQ 197

Query: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180
           LWV LP DLK  EPRYRNLR   IPI  P ENL V VISGKSY  ES+ DLAYTP+  Y 
Sbjct: 198 LWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYH 257

Query: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240
           F   K G  F QE P++FN FLY+ KGAV IN  ++ + + +FFD DG+SI+G+ A D +
Sbjct: 258 FVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATD-D 316

Query: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300
           +EF ++GG IL+QP++Q GPFVETD++ L+QVF +++   NGFERA  W S+I  GI E 
Sbjct: 317 SEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEA 376

Query: 301 DV 302
           + 
Sbjct: 377 EA 378

>KNAG0K01700 Chr11 (352052..356122) [4071 bp, 1356 aa] {ON} 
          Length = 1356

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 255  ILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIA 294
            IL   P V+   E  +    N +YC+  F +ARGWRSS A
Sbjct: 1135 ILVGNPQVDNHGEVRIVNHTNGEYCVLNF-KARGWRSSSA 1173

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,915,456
Number of extensions: 1611020
Number of successful extensions: 3011
Number of sequences better than 10.0: 27
Number of HSP's gapped: 3053
Number of HSP's successfully gapped: 27
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)