Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C015505.443ON1295129567920.0
NCAS0H021005.443ON1269126638790.0
TDEL0D025805.443ON1272123035420.0
Suva_8.1765.443ON1270124335410.0
YOR124C (UBP2)5.443ON1272124735380.0
Smik_15.3015.443ON1272124335010.0
ZYRO0G01606g5.443ON1305125634890.0
Skud_15.2865.443ON1278124034880.0
KNAG0B041905.443ON1262123633910.0
Kpol_1062.235.443ON1266127933450.0
SAKL0G02728g5.443ON1237124133370.0
TBLA0A064705.443ON1320133232480.0
KAFR0D050705.443ON1227123031770.0
Kwal_55.213935.443ON1233125331530.0
TPHA0E017105.443ON1283124231320.0
KLTH0F15862g5.443ON1241122830900.0
CAGL0K10252g5.443ON1267129130410.0
KLLA0E02377g5.443ON1220122429380.0
Ecym_45145.443ON1246123728660.0
Kpol_1016.15.443ON1251124018570.0
ACL164C5.443ON138978717390.0
TPHA0J026205.443ON1225128416460.0
TBLA0C012001.369ON503361238e-06
SAKL0D10120g1.369ON492531229e-06
KLLA0A10791g1.369ON484901192e-05
ZYRO0G01188g1.369ON500331193e-05
KLTH0H13354g1.369ON4951121183e-05
Kwal_34.162681.369ON4491121174e-05
Ecym_27171.369ON483331174e-05
AEL029W1.369ON446331131e-04
TDEL0D024001.369ON494351122e-04
KAFR0A075802.69ON802681103e-04
NCAS0A143707.390ON729781095e-04
Skud_6.941.369ON499721076e-04
Smik_7.3141.369ON499531076e-04
NCAS0D006001.369ON493551068e-04
KNAG0C019401.369ON499331050.001
KAFR0L017307.390ON701851050.001
Suva_5.2177.390ON754781050.001
YFR010W (UBP6)1.369ON499521030.002
KLLA0A00396g5.712ON1012511040.002
KAFR0C045201.369ON499541030.002
Smik_5.2447.390ON749781020.003
TPHA0A025101.369ON505521020.003
NCAS0G036802.307ON482511020.003
KAFR0I026005.18ON1213951020.003
TBLA0D010708.742ON483641010.003
KLTH0B09944g5.18ON1189951020.003
NDAI0H035501.369ON502861010.003
Skud_5.2237.390ON748781010.004
YMR304W (UBP15)5.18ON12301031010.004
Kwal_55.196455.712ON970431010.004
Suva_6.831.369ON500521000.004
Kpol_534.231.369ON496331000.005
Smik_2.497.390ON745311000.005
YER098W (UBP9)7.390ON754731000.005
NDAI0G007802.307ON48669980.008
NCAS0D023905.18ON121195980.009
Klac_YGOB_Anc_5.18b5.18ON116695980.010
NDAI0B034302.307ON85667980.010
Kwal_26.95985.18ON119195980.010
TBLA0C070205.18ON1247158980.010
CAGL0K10494g1.369ON49533970.010
ZYRO0C17908g1.137ON120456980.011
Suva_13.4955.18ON1230103970.012
Smik_14.1442.69ON76368970.012
Suva_6.2761.137ON125664970.012
KNAG0F012202.69ON78468960.014
TDEL0B020805.712ON102541960.014
TPHA0A025401.137ON128628960.015
KLLA0D08459g2.69ON75068960.016
Kpol_2001.541.137ON122356960.018
NDAI0A016707.390ON84678950.019
SAKL0E15136g5.712ON1037208950.020
Skud_13.4785.18ON1231103950.021
KNAG0A054502.307ON76449940.023
Ecym_46857.390ON77831940.025
TBLA0E017605.712ON121241940.026
SAKL0E07106g2.307ON79149940.026
Smik_13.5215.18ON1231103940.027
NCAS0B005808.742ON466173930.028
Ecym_56715.18ON117697940.028
TDEL0C056401.137ON117851940.029
Suva_14.1562.69ON78868940.029
NDAI0F034102.69ON87081940.029
YBL067C (UBP13)7.390ON74733930.031
Kwal_33.136281.137ON116060930.032
Skud_4.1332.307ON78777930.032
TBLA0B097602.69ON89868930.033
CAGL0J11352g2.69ON77168930.036
ABL145W2.69ON74968920.039
CAGL0M13783g5.18ON119658930.039
YJL197W (UBP12)1.137ON125462930.040
NDAI0E008108.742ON49348920.043
TDEL0A011002.69ON66168920.044
KLTH0E00814g5.712ON97443920.045
NCAS0I031401.137ON120136920.046
Kpol_1003.532.307ON78849920.046
TPHA0L022905.18ON119395920.047
YMR223W (UBP8)8.742ON47148910.049
Kpol_1045.417.390ON71234910.051
Skud_13.3928.742ON47348910.052
CAGL0H10582g2.307ON79049910.052
NCAS0E026107.390ON71772910.055
SAKL0H00418g5.18ON119094910.055
Kpol_513.255.18ON119093910.056
Smik_10.371.137ON124734910.056
KLTH0F03674g1.137ON119854910.056
TPHA0P006807.390ON72778910.056
Skud_10.221.137ON125534910.057
Kwal_27.114442.307ON75749910.058
Suva_13.4078.742ON47148900.058
Smik_4.1152.307ON79048910.058
KLLA0C03476g1.137ON125277910.062
Skud_14.1482.69ON77668910.062
Suva_4.1252.307ON79348910.062
AGL357W5.18ON116695910.063
YDL122W (UBP1)2.307ON80949910.063
Kwal_33.144302.69ON51168900.065
TBLA0B060802.307ON82463910.067
ZYRO0A05962g8.742ON46564900.072
KLTH0G10934g2.307ON75849900.076
Suva_2.507.390ON75031900.084
NCAS0B061302.307ON77049900.084
TPHA0D046605.712ON104543900.087
KAFR0A069102.307ON67848890.097
KAFR0F015601.137ON117129890.098
CAGL0I05522g7.390ON72492890.10
NCAS0G018002.69ON87568890.10
NDAI0E041807.390ON827140890.10
Skud_2.387.390ON74853890.11
AGR389C2.307ON77549890.11
KAFR0D021605.712ON846208890.11
SAKL0E13002g2.69ON73968880.12
NDAI0I025305.18ON119748890.12
Ecym_40095.712ON151731880.13
KLLA0C06974g8.742ON44671870.13
AFR627C1.137ON128735880.13
NCAS0G001705.712ON103044880.14
ZYRO0C09812g2.69ON70266870.15
SAKL0C04246g1.137ON129757880.15
TDEL0G023702.307ON74763870.17
Smik_13.4318.742ON47148860.17
YNL186W (UBP10)2.69ON79268870.19
Ecym_81401.137ON126456870.20
KLTH0B07150g2.69ON75668860.20
Kpol_1044.242.69ON72468860.22
NCAS0I016203.270ON795138860.22
CAGL0G02563gsingletonON63129860.23
TPHA0E008707.390ON71531860.23
KNAG0L022005.712ON116139860.23
ZYRO0A02420g2.307ON74549860.24
TPHA0G008502.307ON78249850.27
AGR370W7.390ON74036850.30
CAGL0H06721g5.712ON108174850.31
ZYRO0D07062g5.18ON119349850.31
TBLA0J006001.137ON146273850.31
Skud_9.125.712ON106490850.33
Kpol_1018.937.390ON75557840.34
KNAG0B023707.390ON753108840.34
TDEL0B036708.742ON46349830.40
Kwal_27.108427.390ON71139840.41
KAFR0H001505.712ON65648840.42
ZYRO0B16544g5.712ON104441840.44
CAGL0M11198g8.742ON46164830.44
CAGL0L01639g1.137ON114735840.45
NDAI0F002005.712ON110539830.48
Suva_9.305.712ON106247830.49
Skud_11.3385.712ON71250830.50
CAGL0A04477g7.390ON77090830.51
Smik_9.135.712ON106039830.52
AFR296C5.712ON116930830.55
TDEL0G004105.18ON118695830.57
YIL156W (UBP7)5.712ON107145830.60
KNAG0C021801.137ON123135820.63
NDAI0B004801.137ON125329820.67
YKR098C (UBP11)5.712ON71793820.70
ZYRO0B03300g7.390ON81368820.73
KLTH0C06732g7.390ON71451810.83
Suva_11.3355.712ON72450810.95
KLLA0E20351g7.390ON69731801.0
SAKL0F12430g7.390ON75431801.1
TDEL0C015707.390ON76579801.2
Smik_5.3188.202ON90970801.2
KAFR0A042108.742ON44059791.2
TBLA0D006207.390ON117131801.2
KAFR0C004103.270ON76927801.2
KLLA0E08801g2.307ON77149791.3
SAKL0D03322g3.270ON76521791.4
KNAG0E012905.18ON1196111791.5
KNAG0C035807.390ON77637791.6
TBLA0J002607.514ON70796782.1
TDEL0D035503.270ON78041782.2
Kwal_26.91518.742ON45464772.2
Ecym_62488.742ON46665772.3
KNAG0C045805.487ON50842772.6
Kwal_14.20088.188ON42466762.8
TPHA0G005608.742ON46363763.0
Ecym_55448.202ON83467763.2
TPHA0O016402.69ON746123763.4
KLTH0A02046g8.97ON47068753.8
KNAG0G029308.742ON45966754.0
NDAI0A036808.188ON111669754.2
KLLA0F18700g3.270ON77062754.6
YER151C (UBP3)8.202ON91270754.7
Skud_2.1773.270ON78224754.7
NCAS0A038408.202ON91768745.8
Skud_5.2898.202ON91071745.8
SAKL0G18062g4.351ON123894746.1
KAFR0K018107.390ON71433746.6
AGR139C8.202ON78970737.4
Kpol_1039.382.273ON82599738.2
KLLA0D06171g5.578ON80469738.5
NCAS0C021108.540ON494151729.1
ZYRO0B11044g8.202ON82667729.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C01550
         (1295 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  2620   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1498   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  1368   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  1368   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  1367   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  1353   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...  1348   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  1348   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1310   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...  1293   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1290   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1255   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  1228   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1219   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  1211   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...  1194   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1176   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...  1136   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1108   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   719   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...   674   0.0  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   638   0.0  
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    52   8e-06
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    52   9e-06
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    50   2e-05
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    50   3e-05
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    50   3e-05
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    50   4e-05
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    50   4e-05
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    48   1e-04
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    48   2e-04
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    47   3e-04
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    47   5e-04
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    46   6e-04
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    46   6e-04
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    45   8e-04
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    45   0.001
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    45   0.001
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    45   0.001
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    44   0.002
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    45   0.002
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    44   0.002
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    44   0.003
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    44   0.003
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    44   0.003
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    44   0.003
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    44   0.003
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    44   0.003
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    44   0.003
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    44   0.004
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    44   0.004
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    44   0.004
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    43   0.004
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    43   0.005
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    43   0.005
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    43   0.005
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               42   0.008
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    42   0.009
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    42   0.010
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     42   0.010
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    42   0.010
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    42   0.010
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    42   0.010
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    42   0.011
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    42   0.012
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    42   0.012
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    42   0.012
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    42   0.014
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    42   0.014
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    42   0.015
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    42   0.016
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    42   0.018
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    41   0.019
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    41   0.020
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    41   0.021
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    41   0.023
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    41   0.025
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    41   0.026
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    41   0.026
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    41   0.027
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       40   0.028
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    41   0.028
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    41   0.029
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    41   0.029
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    41   0.029
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    40   0.031
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    40   0.032
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    40   0.032
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    40   0.033
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    40   0.036
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    40   0.039
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    40   0.039
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    40   0.040
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    40   0.043
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    40   0.044
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    40   0.045
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    40   0.046
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    40   0.046
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    40   0.047
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    40   0.049
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    40   0.051
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    40   0.052
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    40   0.052
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    40   0.055
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    40   0.055
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    40   0.056
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    40   0.056
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    40   0.056
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    40   0.056
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    40   0.057
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    40   0.058
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    39   0.058
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    40   0.058
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    40   0.062
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    40   0.062
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    40   0.062
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    40   0.063
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    40   0.063
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    39   0.065
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    40   0.067
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    39   0.072
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    39   0.076
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    39   0.084
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    39   0.084
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    39   0.087
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    39   0.097
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    39   0.098
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    39   0.10 
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      39   0.10 
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    39   0.10 
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    39   0.11 
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    39   0.11 
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    39   0.11 
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    39   0.12 
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    39   0.12 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    39   0.13 
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    38   0.13 
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    39   0.13 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      39   0.14 
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    38   0.15 
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    39   0.15 
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    38   0.17 
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    38   0.17 
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    38   0.19 
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    38   0.20 
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    38   0.20 
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    38   0.22 
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    38   0.22 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    38   0.23 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    38   0.23 
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    38   0.23 
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    38   0.24 
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    37   0.27 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    37   0.30 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    37   0.31 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    37   0.31 
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    37   0.31 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    37   0.33 
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    37   0.34 
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    37   0.34 
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    37   0.40 
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    37   0.41 
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    37   0.42 
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    37   0.44 
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    37   0.44 
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    37   0.45 
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      37   0.48 
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    37   0.49 
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    37   0.50 
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    37   0.51 
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    37   0.52 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    37   0.55 
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    37   0.57 
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    37   0.60 
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    36   0.63 
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    36   0.67 
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    36   0.70 
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    36   0.73 
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    36   0.83 
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    36   0.95 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    35   1.0  
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    35   1.1  
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    35   1.2  
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    35   1.2  
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    35   1.2  
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    35   1.2  
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    35   1.2  
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    35   1.3  
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    35   1.4  
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    35   1.5  
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    35   1.6  
TBLA0J00260 Chr10 (45003..47126) [2124 bp, 707 aa] {ON} Anc_7.51...    35   2.1  
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    35   2.2  
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    34   2.2  
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    34   2.3  
KNAG0C04580 Chr3 (900175..901701) [1527 bp, 508 aa] {ON} Anc_5.4...    34   2.6  
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    34   2.8  
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    34   3.0  
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    34   3.2  
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    34   3.4  
KLTH0A02046g Chr1 (179012..180424) [1413 bp, 470 aa] {ON} simila...    33   3.8  
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    33   4.0  
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              33   4.2  
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    33   4.6  
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    33   4.7  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    33   4.7  
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    33   5.8  
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    33   5.8  
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    33   6.1  
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    33   6.6  
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    33   7.4  
Kpol_1039.38 s1039 (119085..121562) [2478 bp, 825 aa] {ON} (1190...    33   8.2  
KLLA0D06171g Chr4 complement(528904..531318) [2415 bp, 804 aa] {...    33   8.5  
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    32   9.1  
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    32   9.2  

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 2620 bits (6792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1273/1295 (98%), Positives = 1273/1295 (98%)

Query: 1    MTFLRPDEDSTKKESSNIDSLNSSFESVNMDQSSTNSDKPDLPSKTNDDETNKSNPNSTG 60
            MTFLRPDEDSTKKESSNIDSLNSSFESVNMDQSSTNSDKPDLPSKTNDDETNKSNPNSTG
Sbjct: 1    MTFLRPDEDSTKKESSNIDSLNSSFESVNMDQSSTNSDKPDLPSKTNDDETNKSNPNSTG 60

Query: 61   QGPTCDTPRVTTQDIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSFKNG 120
            QGPTCDTPRVTTQDIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSFKNG
Sbjct: 61   QGPTCDTPRVTTQDIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSFKNG 120

Query: 121  ILQESMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSN 180
            ILQESMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSN
Sbjct: 121  ILQESMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSN 180

Query: 181  ITNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPD 240
            ITNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPD
Sbjct: 181  ITNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPD 240

Query: 241  NPDLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEA 300
            NPDLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEA
Sbjct: 241  NPDLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEA 300

Query: 301  VPTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATD 360
            VPTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATD
Sbjct: 301  VPTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATD 360

Query: 361  ETTGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGS 420
            ETTGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGS
Sbjct: 361  ETTGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGS 420

Query: 421  KSYRAFXXXXXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDR 480
            KSYRAF            YQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDR
Sbjct: 421  KSYRAFNLLNTTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDR 480

Query: 481  DIIKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNI 540
            DIIKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNI
Sbjct: 481  DIIKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNI 540

Query: 541  DPNVVNLEXXXXXXXXXXYKNESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRN 600
            DPNVVNLE          YKNESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRN
Sbjct: 541  DPNVVNLESIDDSLLLSIYKNESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRN 600

Query: 601  VNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLEN 660
            VNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLEN
Sbjct: 601  VNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLEN 660

Query: 661  CSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALM 720
            CSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALM
Sbjct: 661  CSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALM 720

Query: 721  KLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYV 780
            KLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYV
Sbjct: 721  KLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYV 780

Query: 781  LGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTP 840
            LGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTP
Sbjct: 781  LGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTP 840

Query: 841  RRELAYLAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEAS 900
            RRELAYLAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEAS
Sbjct: 841  RRELAYLAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEAS 900

Query: 901  PTEDIYMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQD 960
            PTEDIYMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQD
Sbjct: 901  PTEDIYMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQD 960

Query: 961  VTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERF 1020
            VTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERF
Sbjct: 961  VTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERF 1020

Query: 1021 LSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRE 1080
            LSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRE
Sbjct: 1021 LSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRE 1080

Query: 1081 RFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEV 1140
            RFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEV
Sbjct: 1081 RFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEV 1140

Query: 1141 GLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEE 1200
            GLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEE
Sbjct: 1141 GLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEE 1200

Query: 1201 TISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEV 1260
            TISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEV
Sbjct: 1201 TISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEV 1260

Query: 1261 FNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIEES 1295
            FNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIEES
Sbjct: 1261 FNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIEES 1295

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1498 bits (3879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 756/1266 (59%), Positives = 943/1266 (74%), Gaps = 64/1266 (5%)

Query: 66   DTPRVTTQDIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLS--------- 116
            DT R+  +  D G  LLYP++   +FPMKT+ R+IDDI+ DLSF+ G  +          
Sbjct: 26   DTQRIEVRVADDGKQLLYPNVEN-HFPMKTAERLIDDIIADLSFLTGIAVDNGSRGDIDT 84

Query: 117  -FKNGILQESMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILM 175
               NGIL++SM+ YSK +    ++  GS++DQV LQTKYEY S+TCP  NKL+V FG+L 
Sbjct: 85   MLGNGILKQSMLNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSVTCPELNKLQVFFGVLF 144

Query: 176  NLPSNITNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLM 235
            N  + ITN+DE+ ++ PIYHLK+TVKTR  LE++KK AG+TQ+HL+D   LH +DK+D+ 
Sbjct: 145  NNSTQITNLDEV-TQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVD--QLHVYDKQDIP 201

Query: 236  TFDPDNPDLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDT 295
            TF+P++P+LLDYAIYVS+DTN+LILIE+F  EF S +E ESF++  I  RYQ+AC++FDT
Sbjct: 202  TFNPEDPNLLDYAIYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFDT 261

Query: 296  LDPEAVPTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTK 355
            L+P   PT +DCLNT+ K+ K PL+RK++++  +T+ S N  L+SH NPEWL  KY F  
Sbjct: 262  LNPNEPPTQLDCLNTLFKVFKGPLSRKSSDEPSKTIDSTNKTLNSHINPEWLTSKYGFNI 321

Query: 356  HYATDETTGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDP 415
                D    Q+ +EYEPP+L++YV+ ++VR LRE YIRRCLQLIFWGK  + LR++  DP
Sbjct: 322  VVDEDLPNAQQSVEYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRIN--DP 379

Query: 416  ALRGSKSYRAFXXXXXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSS 475
             L+ SKSY++              QL   S  NFL    + S    LD NFHFINLS   
Sbjct: 380  TLKNSKSYKSINALQTNFTITPLLQLFKGSGQNFLMGPESRS---PLDFNFHFINLSACY 436

Query: 476  YYTDRDIIKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMAL 535
            +YTDRD+I+NYERL  LDP N+G YFDAL+YIAN KGSYQLIAYCGKQD+VGQE ++ AL
Sbjct: 437  HYTDRDVIRNYERLCHLDPQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQAL 496

Query: 536  KCFNIDPNVVNLEXXXXXXXXXXYKNESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDH 595
            K FN+DP  V++           YKNE     +D  NLKNAMRLFAK+++S +LKFY+DH
Sbjct: 497  KSFNLDPMEVDITKINDSVLLTLYKNELKISTSDIPNLKNAMRLFAKVKHSSKLKFYIDH 556

Query: 596  EPYRNVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFN 655
            EPYR V QAYETL+ID SVDDDI+QTAY IK VD+PGL +DCDRALYTIAI +RS++LF 
Sbjct: 557  EPYRRVAQAYETLDIDESVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLLFT 616

Query: 656  FLLENCSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNY 715
            FL+E C +FQ YY   R+ Y  AL + QVNENA DE+I+KNFQ +WFNE + E + F+  
Sbjct: 617  FLIERCPDFQEYYCPDRFTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFVIC 676

Query: 716  KCALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISP 775
              AL+++GL+RNS LI+NFL  G IDP+CLP+++WP GINNIGNTCYLNSLLQYYFSI+P
Sbjct: 677  VHALVEIGLQRNSSLISNFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAP 736

Query: 776  LREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNK 835
            LR YVL YSKT EDF   + NA T+RRIGGREV +NEVERSIQFIYQLRDLF+AM+Y+N+
Sbjct: 737  LRNYVLQYSKTIEDFKTLENNASTVRRIGGREVSNNEVERSIQFIYQLRDLFHAMVYSNE 796

Query: 836  RCVTPRRELAYLAFAPSNVEVEFENG------------VT--------DAKEDVSHYNDD 875
            RCVTPRRELAYLAFAPSN+EVEFE              VT        D KE      D 
Sbjct: 797  RCVTPRRELAYLAFAPSNIEVEFETNENQPATQQDNPEVTTAELGQDKDEKERSVDSGDI 856

Query: 876  KTSDTLI-KIGEGDED-LGEAERTE------ASPTEDIYMTDDDMLGAAKATDGINKEDE 927
              SD +  K  E +ED + E+ + +      +SPT+DI MTD+        TD +   +E
Sbjct: 857  SMSDNITPKDAEEEEDQVAESNKNQDVSAIVSSPTKDIIMTDN--------TDTV-VSNE 907

Query: 928  STENGIDILPSTKVAKISSDQLENALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNE 987
             T        STKVAKISSDQLENALEMGRQQDVTECIGNVL+QLESGSEPL ++  DNE
Sbjct: 908  GT--------STKVAKISSDQLENALEMGRQQDVTECIGNVLFQLESGSEPLDLHENDNE 959

Query: 988  QDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFL 1047
            QDDLVKQLFYGE++Q I+PL+   + RPKLERFLSLLVN+GDHPRDIYDALD+YFKDE+L
Sbjct: 960  QDDLVKQLFYGELEQTIVPLANPDQRRPKLERFLSLLVNIGDHPRDIYDALDLYFKDEYL 1019

Query: 1048 TMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTAD 1107
             M+EYG+VKRTVA+TKFPTILQ+QIQRVYYDRE+FMPFKSIEPLPF  KIYMDRY  T +
Sbjct: 1020 KMEEYGDVKRTVAVTKFPTILQIQIQRVYYDREKFMPFKSIEPLPFEEKIYMDRYSVTDN 1079

Query: 1108 PEILETRERTAKMKAELVQLKKRQQELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVF 1167
            PE++  +  T  MK +LV+LKK+Q++LLSRN VGLS+K++Y E    L S++L+ QGI+ 
Sbjct: 1080 PELIARKNETLLMKEKLVELKKKQRDLLSRNSVGLSKKDSYIELGKLLSSDSLESQGIIL 1139

Query: 1168 EGQDELSTILKKAGTDIDDELSTIYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEAS 1227
              +DE+ + LK     IDDEL+ +Y +I+QLEETI+ QF +FK +GYS+FAVFIHRGEAS
Sbjct: 1140 PEKDEMVSSLKTLTAGIDDELNQLYAEISQLEETINGQFNEFKGIGYSIFAVFIHRGEAS 1199

Query: 1228 YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEP 1287
            YGHYW+YIKD +QNGIWRKYNDETVSEVP+EEV+NFTEGNTATPYFLVYVKEG E++IEP
Sbjct: 1200 YGHYWIYIKDRSQNGIWRKYNDETVSEVPEEEVYNFTEGNTATPYFLVYVKEGEEQEIEP 1259

Query: 1288 LKRIIE 1293
            LKRIIE
Sbjct: 1260 LKRIIE 1265

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 1368 bits (3542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 683/1230 (55%), Positives = 888/1230 (72%), Gaps = 30/1230 (2%)

Query: 76   DPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLS-----FKNGILQESMIMYS 130
            D G  +LY ++ T  FP KTS+R++DD++ DL+FIN  +         NGIL+  ++ YS
Sbjct: 59   DSGKEVLYREVST-KFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAYS 117

Query: 131  KERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIISK 190
            +       Y FG++VDQ+ LQT +EY S++CP +NKL V  G+L+++P +       +S+
Sbjct: 118  RRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSSTLSE 177

Query: 191  VPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIY 250
              +YHLK+TVKTR +LE +KK+AG+T YH +   DLH FD++DL  FDP +P L+D+AIY
Sbjct: 178  NTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTDPRLVDHAIY 236

Query: 251  VSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNT 310
            VSSDTN+L+LIE+F  EFD  E+ E +    IK+RY EAC++FDTLDP  +PT  DC+NT
Sbjct: 237  VSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCINT 296

Query: 311  VLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEY 370
            +LK+ + PL R+N+ + ++T++S+N +L+S  NP WL  KY F  H   DE+TG+   E+
Sbjct: 297  LLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYFEF 356

Query: 371  EPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFXXXX 430
            EPP+L +Y++  KVR LRE +IR+C++LIF GK  ++L       A   SK YR F    
Sbjct: 357  EPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELL---GKDAKTTSKVYRTFNAIQ 413

Query: 431  XXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLI 490
                    +++L + +S F   +     +  LD N++FINLS   YY DRDIIKNYE   
Sbjct: 414  IAFSKTTWFKMLGEHRSIFSFES-----ASPLDANYNFINLSACFYYIDRDIIKNYEAQC 468

Query: 491  ALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLEXX 550
            ALDP N G YFDAL+YIANRKG+YQL+AYCGKQDVVGQE ++ ALK F ID   V++   
Sbjct: 469  ALDPENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATI 528

Query: 551  XXXXXXXXYKNESVKEGAD--FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETL 608
                    YK+E++    +    +LKNA+RL AK + S +LKF+ D+EPY+NV++AYE L
Sbjct: 529  DDSLLVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYEIL 588

Query: 609  EIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYY 668
            E+D SVDDDII+TAYSI   D+PGLKIDCDRALYTI +++RS+ L N+LL+ C +FQ YY
Sbjct: 589  EVDESVDDDIIETAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYY 648

Query: 669  NIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNS 728
              G   Y +AL +LQ+NENA DE +L+ FQ KW  E   E+D  L  K AL K+G+ERNS
Sbjct: 649  GPGTLLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNS 708

Query: 729  KLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYE 788
            KLI +F+  G ID SCLP +NWPTG+NNIGNTCYLNSLLQYYFS++PLR YVL Y +T E
Sbjct: 709  KLILHFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETME 768

Query: 789  DFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLA 848
             F     N   +RRIGGREV + EVERS+QF+YQLRDLF AMIY+ +RCVTPR+ELAYLA
Sbjct: 769  HFRHHTGNE--LRRIGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCVTPRKELAYLA 826

Query: 849  FAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLI--KIGEGDED-LGEAERTEASPTEDI 905
            FAPSN EVEFE    +A+ +VS   +   +D L+       D D  G  E    S  EDI
Sbjct: 827  FAPSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDI 886

Query: 906  --YMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQDVTE 963
               MT +    + +  + I   D   +N I    ST+VAKISSDQLENALEMGRQQDVTE
Sbjct: 887  DVSMTKE---PSEEYKEDIPMSDAEKDNIIST--STRVAKISSDQLENALEMGRQQDVTE 941

Query: 964  CIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSL 1023
            CIGNVL+QLES S+P+ ++ EDNEQ+DLVKQLFYG+IKQ IIPL+   E + K+ER+LSL
Sbjct: 942  CIGNVLFQLESASDPINLD-EDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSL 1000

Query: 1024 LVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFM 1083
            LVN+GDHP+DIYDALD YF DE LTM EYG+VKRTVA+T+FPTILQ+QIQRVYYDRERFM
Sbjct: 1001 LVNIGDHPKDIYDALDSYFSDERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFM 1060

Query: 1084 PFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLS 1143
            PFKSIEPLPF+  +YMDRY D+ DP+++E ++ + ++KA+L +LK RQ+ELLS NE+GLS
Sbjct: 1061 PFKSIEPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLS 1120

Query: 1144 RKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETIS 1203
            RK AY ET+N+L+S+ ++ Q +     D L   LK++  DID EL+++Y+ I +LE TI 
Sbjct: 1121 RKAAYMETINYLKSDLIKSQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTID 1180

Query: 1204 HQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNF 1263
             QFE+FKK+GYSLFAVFIHRGEASYGHYWVYIKD ++NG WRKYNDET++EVP+ EVFNF
Sbjct: 1181 KQFEEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNF 1240

Query: 1264 TEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293
            TEGNTATPYFLVYV++G E DIEPLKRII+
Sbjct: 1241 TEGNTATPYFLVYVRQGHEHDIEPLKRIID 1270

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 1368 bits (3541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/1243 (55%), Positives = 879/1243 (70%), Gaps = 41/1243 (3%)

Query: 71   TTQDIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSF------KNGILQE 124
            T  D+D G  LLYPD+ T   P+KTS+R++DDILCD +F N  + S        +GIL++
Sbjct: 49   TRADVDDGKHLLYPDIATY-LPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKK 107

Query: 125  SMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMN--LP-SNI 181
            SM+ YS  R   +    GS+ DQV LQTK EY+S++CP  NK++V   ++ N  LP   I
Sbjct: 108  SMLSYSNFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQI 167

Query: 182  TNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDN 241
               D+I+ K+PIYHLK+TVK RQ LE  KK  G+TQ+H LD   LH +D  DL TFD  +
Sbjct: 168  AAFDDIV-KIPIYHLKVTVKIRQELERLKKHVGVTQFHALDH--LHEYDLADLSTFDSSD 224

Query: 242  PDLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAV 301
            P+L DY IYVS DTN+LILIEIF+ EFDS EER+SF TA I+ RY + C K ++L+    
Sbjct: 225  PNLKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENET 284

Query: 302  PTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDE 361
            P+  DC  T+ K+ K PL RK+  D I+T+ S N +L++H NPEWL  KY F      DE
Sbjct: 285  PSQPDCFYTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDE 344

Query: 362  TTGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSK 421
             T +   EY PPD++ YV  +K+R +RE Y+R+CLQLIFWG+    L    S   L+ +K
Sbjct: 345  ETNESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQLSASLLAPNS--LLKNTK 402

Query: 422  SYRAFXXXXXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRD 481
            S +              +QLL +S++  L +  N+     LD   HFINLS S YYTDRD
Sbjct: 403  SVKGLSSIQTSFSILPWFQLLGESRARILLNF-NEQAHSPLDAEPHFINLSVSHYYTDRD 461

Query: 482  IIKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNID 541
            II+NYE L +LDP NIG YFDAL+YIANRKG+YQ+IAYCGKQD++GQE +  AL  F ID
Sbjct: 462  IIRNYEALSSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKID 521

Query: 542  PNVVNLEXXXXXXXXXXYK----NESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEP 597
            P   ++           YK    N++        NLKNA+RL AK   S +LKFYVDHEP
Sbjct: 522  PKDYDIAELNEATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEP 581

Query: 598  YRNVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFL 657
            YR ++QAY+TL ID SVD+DII+TAYSIK  D+PGLK+DCDRALYTIAI +RS+ LFNFL
Sbjct: 582  YRALSQAYDTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFL 641

Query: 658  LENCSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKC 717
             + C +FQ YY   + DY++AL +LQVNENA+DE ILK F+ KWF+E ++E DQFL  K 
Sbjct: 642  TDECPQFQNYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKA 701

Query: 718  ALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLR 777
            AL K+ +ERNS LI NFL+ G IDP+ LP ENWPTGINNIGNTCYLNSLLQYYFSI+PLR
Sbjct: 702  ALTKISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLR 761

Query: 778  EYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRC 837
             Y+L Y KT  +F D   N++ +RR+GGRE+ + EVERSIQFI+QLR+LFYAM+++ +RC
Sbjct: 762  SYILNYQKTLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERC 821

Query: 838  VTPRRELAYLAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERT 897
            VTP +ELAYLAFAPSNVEVEFE  V   KE     ++D T      I + +E  G     
Sbjct: 822  VTPSKELAYLAFAPSNVEVEFE--VEGNKE-----SNDAT------ILKEEETGGANAIN 868

Query: 898  EASPTEDIYMTDDDMLGAAKATDGINKEDES-------TENGIDILPSTKVAKISSDQLE 950
            E  P    +  D++  G  +  +  +++ ES       T++  D+   T+VAKISSDQLE
Sbjct: 869  EQDPILIDFEVDENTNGDVEKDENNHEKTESNDVEIIMTDDATDLASPTRVAKISSDQLE 928

Query: 951  NALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGV 1010
            NALEMGRQQDVTECIGNVL+Q+ESGSEP++ + EDNEQ DL+KQLFYG  KQ I+PLS  
Sbjct: 929  NALEMGRQQDVTECIGNVLFQIESGSEPIRYD-EDNEQYDLIKQLFYGTTKQCIVPLSAT 987

Query: 1011 GETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQV 1070
             + R K+ERFLSLLVN+GDHP+DIYDA D YF+DE+LTM EYG+VKRTVA+T FPTILQV
Sbjct: 988  DKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQV 1047

Query: 1071 QIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKR 1130
            QIQRVYYDRERFMPFKSIEPLPF   IYMDRY DT +  +L  +E T ++K +   +K R
Sbjct: 1048 QIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNR 1107

Query: 1131 QQELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELST 1190
            Q+ELL+R+  GL+RK+A+ ET+  L+S+ ++   +  E +  L   LK   TDID+EL +
Sbjct: 1108 QRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMS 1167

Query: 1191 IYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDE 1250
            +Y+ I  LE+ ISHQF+ FK+ GYSLF+VFIHRGEASYGHYW+YIKD NQNG+WRKYNDE
Sbjct: 1168 LYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDE 1227

Query: 1251 TVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293
            T+SEVP+EEVFNF EGNTATPYFLVYVK+G E DIEPLKRI+E
Sbjct: 1228 TISEVPEEEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRILE 1270

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 1367 bits (3538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1247 (55%), Positives = 869/1247 (69%), Gaps = 47/1247 (3%)

Query: 71   TTQDIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFING--PNLSFKN----GILQE 124
            T  D+D G  LLYPD+ T N P+KTS+R++DDILCD  F+N   P +  K     GIL+E
Sbjct: 49   TPGDVDDGKHLLYPDIAT-NLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKE 107

Query: 125  SMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPS----N 180
            SM+ YS  R + +    GS+ DQV  QTK EY+S++CP  NK+ V   ++ N PS     
Sbjct: 108  SMLSYSTFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFN-PSLAEQQ 166

Query: 181  ITNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPD 240
            I+  D+I+ K+PIYHLK++VK RQ LE  KK  G+TQ+H LD   LH +D+ DL TFD  
Sbjct: 167  ISTFDDIV-KIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSS 223

Query: 241  NPDLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEA 300
            +P+LLDY IYVS DTN+LILIEIF  EF+S EE ESF    IK RY   C K ++LD   
Sbjct: 224  DPNLLDYGIYVSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSE 283

Query: 301  VPTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATD 360
             P+ +DC  T+ K+ K PLTRK+  +  +T+ S N  L++H NPEWL  KY F      D
Sbjct: 284  TPSQVDCFYTLFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEID 343

Query: 361  ETTGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGS 420
            E T +   EY PPD++ YV   + R +RE ++R+CLQLIFWG+    L    S   L+ +
Sbjct: 344  EETNEIFTEYVPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNS--PLKNT 401

Query: 421  KSYRAFXXXXXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDR 480
            KS +              + LL +S++  L ++ N+     LD   HFINLS S YYTDR
Sbjct: 402  KSVKGMSSLQTSFSTLPWFHLLGESRARILLNS-NEQTHSPLDAEPHFINLSVSHYYTDR 460

Query: 481  DIIKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNI 540
            DII+NYE L +LDP NIG YFDAL+YIANRKG+YQLIAYCGKQD++GQE +  AL  F I
Sbjct: 461  DIIRNYESLSSLDPENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKI 520

Query: 541  DPNVVNLEXXXXXXXXXXYK----NESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHE 596
            +P   N+           YK    N+S        NLKNA+RL AK   S +LKFYVDHE
Sbjct: 521  NPKECNISELNEATLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHE 580

Query: 597  PYRNVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNF 656
            PYR ++QAY+TL ID SVD+DII+TAYS+K  D+PGLK+DCDRALYTIAI +RS+ LFNF
Sbjct: 581  PYRALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNF 640

Query: 657  LLENCSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYK 716
            L E C +F  YY   + DY++AL +LQVNENA+DE ILK F+ KWF+E ++E DQFL  +
Sbjct: 641  LTEECPQFSNYYGPEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILR 700

Query: 717  CALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPL 776
             AL K+ +ERNS LI NFL+ G IDP+ LP ENWPTGINNIGNTCYLNSLLQYYFSI+PL
Sbjct: 701  AALTKISIERNSTLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPL 760

Query: 777  REYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKR 836
            R YVL Y KT E+F D   N+  IRRIGGRE+   EVERSIQFIYQLR+LFYAM++T +R
Sbjct: 761  RRYVLEYQKTVENFNDHLSNSGHIRRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRER 820

Query: 837  CVTPRRELAYLAFAPSNVEVEFE---NGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGE 893
            CVTP +ELAYLAFAPSNVEVEFE   N V D    +S    + T D              
Sbjct: 821  CVTPSKELAYLAFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDD-------------- 866

Query: 894  AERTEASPTEDIYMTDDDMLGAAKATDGINKEDEST-------ENGIDILPSTKVAKISS 946
            A  T+   T  I +  +D L     TD   K++ES        E+   +   T+VAKISS
Sbjct: 867  AFTTKIKDTSLIDLEMEDGLNGDVGTDANRKKNESNDAEVSENEDTTGLTSPTRVAKISS 926

Query: 947  DQLENALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIP 1006
            DQLENALEMGRQQDVTECIGNVL+Q+ESGSEP++ + EDNEQ DLVKQLFYG  KQ I+P
Sbjct: 927  DQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYD-EDNEQYDLVKQLFYGTTKQSIVP 985

Query: 1007 LSGVGETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPT 1066
            LS   + R K+ERFLSLL+N+GDHP+DIYDA D YFKDE+LTM+EYG+V RTVA+T FPT
Sbjct: 986  LSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVIRTVAVTTFPT 1045

Query: 1067 ILQVQIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQ 1126
            ILQVQIQRVYYDRER MPFKSIEPLPF   IYMDRY DT +P +L  ++ T +MK +L  
Sbjct: 1046 ILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKV 1105

Query: 1127 LKKRQQELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDD 1186
            +K RQ+ELLSR++ GL+RK+A+ E++  L+S+ ++   +  E  +++   L+    +ID+
Sbjct: 1106 MKNRQRELLSRDDSGLTRKDAFLESIKLLESDTIKKTPLKIEAANDVIKTLRNNVQNIDN 1165

Query: 1187 ELSTIYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRK 1246
            EL  +YN I  LEE ISHQF+ FK+ GYSLF+VFIHRGEASYGHYW+YIKD N+NGIWRK
Sbjct: 1166 ELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRK 1225

Query: 1247 YNDETVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293
            YNDET+SEV +EEVFNF EGNTATPYFLVYVK+G E DIEPLKRI++
Sbjct: 1226 YNDETISEVQEEEVFNFNEGNTATPYFLVYVKQGQEGDIEPLKRILK 1272

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 1353 bits (3501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/1243 (55%), Positives = 869/1243 (69%), Gaps = 45/1243 (3%)

Query: 74   DIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSF------KNGILQESMI 127
            D D G  LLYPD+ T+  P+KTS+R++DDILCD  F+N  + S         GIL+ESM+
Sbjct: 52   DFDDGKHLLYPDIATS-LPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESML 110

Query: 128  MYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPS----NITN 183
             YS  R + +    GS+ DQV +QTK EY+S +CP  NK+ V   +++N PS    ++++
Sbjct: 111  SYSSFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILN-PSLTEQHVSS 169

Query: 184  VDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPD 243
             D+I+ K+PIYHLK+TVK RQ LE  KK  G+TQ+H +DF  LH +D+ D  TFD  +P+
Sbjct: 170  FDDIV-KIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDF--LHEYDRVDFSTFDSSDPN 226

Query: 244  LLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPT 303
            L+DY IYVS DTN+LILIEIF  EFDS EE ESF    IK RY + C   ++LD    P+
Sbjct: 227  LMDYGIYVSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPS 286

Query: 304  GIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETT 363
              DC  T+ K+ K PLTRK+  + ++T+ S N  L++H NPEWL  KY F      DE T
Sbjct: 287  QADCFYTLFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEET 346

Query: 364  GQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSY 423
             +   EY PPD++ YV   KVR +RE ++R+CLQL+FWG+    L    S   L+ +KS 
Sbjct: 347  NERFTEYLPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNS--PLKNTKSV 404

Query: 424  RAFXXXXXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDII 483
            +              + LL +S+S  L ++ N+S S  LD   HF+NLS S YYTDRDII
Sbjct: 405  KGLSCLQTSFSSLPWFHLLGESRSRILLNS-NESHS-PLDAEPHFVNLSVSHYYTDRDII 462

Query: 484  KNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPN 543
            +NYE L +LDP NIG YFDAL+YIANRKG+YQLIAYCGKQD++GQE +  AL  F I+P 
Sbjct: 463  RNYESLSSLDPKNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPK 522

Query: 544  VVNLEXXXXXXXXXXYK----NESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYR 599
              N+           YK    N+S        NLKNA+RL AK   S +LKFYVDHEPYR
Sbjct: 523  ECNIAELNEATLLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYR 582

Query: 600  NVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLE 659
             ++QAY+TL ID SVD+DII+TAYS+K  D+PGLK+DCDRALYTIAI ++S+ LFNFL +
Sbjct: 583  ALSQAYDTLSIDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTD 642

Query: 660  NCSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCAL 719
             C +F  YY   + DY++AL +LQVNENA+DE ILK F+ KWF+E ++E DQFL  K AL
Sbjct: 643  ECPQFLTYYGAEQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAAL 702

Query: 720  MKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREY 779
             K+ +ERNS LI+NFL+ G IDP+ LP ENWPTGINNIGNTCYLNSLLQYYFSI+PLR Y
Sbjct: 703  TKISIERNSNLISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRY 762

Query: 780  VLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVT 839
            +L Y KT E+F D   N+  +RRIGGR++   EVERS+QFIYQLR+LFYAM+++ +RCVT
Sbjct: 763  ILDYQKTVENFNDHLSNSGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVT 822

Query: 840  PRRELAYLAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSD-TLIKIGEGDEDLGEAERTE 898
            P +ELAYLAFAPSN+EVEFE               +K +D   I IG  +E   E+  T+
Sbjct: 823  PSKELAYLAFAPSNIEVEFE------------VEGNKPADGAAIPIGLKEEATQESCTTK 870

Query: 899  ASPTEDIYMTDDDMLGAAKATDGINKEDESTEN--------GIDILPSTKVAKISSDQLE 950
             +  + I    +D        +  N E     N          D+   T+VAKISSDQLE
Sbjct: 871  ENDPKSIGSKMEDNTNRDTHRNPSNTEKNEPNNVQIVGGDDTTDLNSLTRVAKISSDQLE 930

Query: 951  NALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGV 1010
            NALEMGRQQDVTECIGNVL+Q+ESGSEP++ + EDNEQ DLVKQLFYG  KQ I+PLS  
Sbjct: 931  NALEMGRQQDVTECIGNVLFQIESGSEPIKYD-EDNEQYDLVKQLFYGTTKQSIVPLSAT 989

Query: 1011 GETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQV 1070
             + R K+ERFLSLL+N+GDHP+DIYDA D YFKDE+LTM+EYG+V RTVA+T FPTILQV
Sbjct: 990  NKVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTMEEYGDVTRTVAVTTFPTILQV 1049

Query: 1071 QIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKR 1130
            QIQRVYYDRERFMPFKSIEPLPF   IYMDRY DT +P +L  +  T +MK +L  +K R
Sbjct: 1050 QIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKNETEEMKQKLRVMKNR 1109

Query: 1131 QQELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELST 1190
            Q+ELLSR+  GL+RK+A+ E++  L+S+ ++   +  E + ++   L+    +ID+EL +
Sbjct: 1110 QRELLSRDNSGLTRKDAFLESIKLLESSVVEKTTLKTEVKIDVINTLRTNVNNIDNELMS 1169

Query: 1191 IYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDE 1250
            +YN I  LEE ISHQF+ FK+ GYSLF+VFIHRGEASYGHYW+YIKD N NG+WRKYNDE
Sbjct: 1170 LYNNINNLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDE 1229

Query: 1251 TVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293
            TVSEV ++EVFNF EGNTATPYFLVYVK+G E DIEPLKRI++
Sbjct: 1230 TVSEVQEDEVFNFNEGNTATPYFLVYVKQGQEADIEPLKRILQ 1272

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 1348 bits (3489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/1256 (54%), Positives = 873/1256 (69%), Gaps = 49/1256 (3%)

Query: 76   DPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLS-----FKNGILQESMIMYS 130
            D G   LYP+   A FP KT++R++DDIL DLSFIN  + S       NGIL+  ++ YS
Sbjct: 58   DSGKVPLYPE-AAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILKSPVLSYS 116

Query: 131  KERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIISK 190
            ++    +AY  GS+VDQV LQTK+EY+S++CP +N L+V  G+L+++          ++ 
Sbjct: 117  RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVATFNNLAT 176

Query: 191  VPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIY 250
            +PI+HLK+TVKTR +LE +KK+AGIT YH LD  ++H +DK+DL+TFD  +P LLDYAIY
Sbjct: 177  LPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYAIY 236

Query: 251  VSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNT 310
            VSSD+N+LILIEIF  EFDS EER++F+  +I +RY+ AC +FD+LDP  +PT  DC+NT
Sbjct: 237  VSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCINT 296

Query: 311  VLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEY 370
            + K+ K PL RK++ +  +T++ NN  L+SH +P WL  KY F  H   DE TG+++LEY
Sbjct: 297  LFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDILEY 356

Query: 371  EPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFXXXX 430
             PPDL +Y + +KVR LRE + RRCL+LIF G+  V +R+   +   R  K YR F    
Sbjct: 357  APPDLTNYHRDWKVRRLRESFTRRCLELIFLGR--VSIRLLSQEAVNRNPKVYRIFSMMQ 414

Query: 431  XXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLI 490
                    +QLL + ++ F   +     S  LD + HFI+LS    Y DRDII+NYE   
Sbjct: 415  TNFSTMFWFQLLGEYRAIFSTES-----SSPLDSDHHFIDLSACYNYIDRDIIRNYEAQC 469

Query: 491  ALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLEXX 550
             LDP N+G Y DAL++IANRKG+YQLIAYCGKQD VGQE ++ AL  F ID    +    
Sbjct: 470  TLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNL 529

Query: 551  XXXXXXXXYKNESV--KEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETL 608
                    YKNES   +       LKN++RL AK + SP+LKFY D+EPYRNV QAYE L
Sbjct: 530  NDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEIL 589

Query: 609  EIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYY 668
            E+D SVDDDIIQTAY++K  D+PGLKIDCDRALYTIA+  RS+ LFNFL++   EFQ Y+
Sbjct: 590  EVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYF 649

Query: 669  NIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNS 728
               ++ Y+ AL +LQVNENA D+ IL+ FQ KW+ E + +ADQFL  K AL K+G ERNS
Sbjct: 650  GPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNS 709

Query: 729  KLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYE 788
            KLI++F+  G +D SCLP ENWPTG+NNIGNTCYLNSLLQYYFSIS LR+YVL Y  T +
Sbjct: 710  KLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQ 769

Query: 789  DFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLA 848
             F + +  A   RRIGGRE+ + EVERS+QF+YQLRDLF +MI+   RCVTPR+ELAYLA
Sbjct: 770  HFLNNQEYAS--RRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAYLA 827

Query: 849  FAPSNVEVEFE---NGVTDAKEDVSHYN----DDKTS---------------------DT 880
            F PS + VEFE       +A   V   N    D + S                       
Sbjct: 828  FVPSGLGVEFELPNASQANANAPVEKENYVNIDSEPSPPPNDEPLLIDLDDDSDPNNHSK 887

Query: 881  LIKIGEGDEDLGEAERTEASPTE---DIYMTDDDMLGAAKATDGINKEDESTENGIDILP 937
            L K    D  + E + ++A   +   DI MTD                  ++   + +  
Sbjct: 888  LNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAMNT 947

Query: 938  STKVAKISSDQLENALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFY 997
            ST+VAKISSDQLENALEMGRQQDVTECIGNVL+QLES S+P+ +  +DNEQ+DLVKQLFY
Sbjct: 948  STRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLG-DDNEQNDLVKQLFY 1006

Query: 998  GEIKQDIIPLSGVGETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKR 1057
            G IKQ+IIPL    + R K ERFLSLLVN+GDHP+DIYDALD+YF+DE+L ++EYG+VKR
Sbjct: 1007 GNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVKR 1066

Query: 1058 TVAITKFPTILQVQIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERT 1117
            TVA+T FPTILQ+QIQRVYYDRERFMPFKS+ PLPF+  IYMDRY DT +P ++  +  T
Sbjct: 1067 TVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRET 1126

Query: 1118 AKMKAELVQLKKRQQELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTIL 1177
             K+  EL  LK RQ+ELLS+NE+GLSRK A  ET NFL+S+ L+ QGI  + +  L+  L
Sbjct: 1127 EKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQEL 1186

Query: 1178 KKAGTDIDDELSTIYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKD 1237
                  I+DELS +Y+ ITQLE  ISHQF+ FK +GYSLFAVFIHRGEASYGHYW+YIKD
Sbjct: 1187 DNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKD 1246

Query: 1238 YNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293
              ++GIWRKYNDET++EVP+ EVFNF+EGNTATPYFLVYVK+G E++IEPLKR++E
Sbjct: 1247 RYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 1348 bits (3488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 683/1240 (55%), Positives = 871/1240 (70%), Gaps = 35/1240 (2%)

Query: 75   IDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFING--PNLSFK----NGILQESMIM 128
            +D G  LLYPD+ T+  P+KTS+R++DD+LCD  F+N   PN+  K    +GIL+ESM+ 
Sbjct: 53   VDDGKHLLYPDIATS-LPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLS 111

Query: 129  YSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPS----NITNV 184
            YS  R + +    GS+ DQV +QTK EY+S++CP  NK+ V   +++N PS     I++ 
Sbjct: 112  YSSFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILN-PSLSEQQISSF 170

Query: 185  DEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDL 244
            D+I+ ++PIYHLK+TVK RQ LE  KK  G+TQ+H LD   LH +D+ DL TFD  +P L
Sbjct: 171  DDIV-RIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDH--LHEYDRVDLSTFDSSDPKL 227

Query: 245  LDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTG 304
            +DY IYVS DTN+LILIEIF  EF+S EE ESF T  IK RY + C K ++L+ +  P+ 
Sbjct: 228  MDYGIYVSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQ 287

Query: 305  IDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTG 364
             DC  T+ K+ K PLTRK+  + I+T+ S N +L++H N EWL  KY F      DE T 
Sbjct: 288  PDCFYTLFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETN 347

Query: 365  QEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYR 424
                EY PPD++ YV  +  R +RE ++++CLQLIFWG+    L    S  +L+ +KS +
Sbjct: 348  DPFTEYVPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNS--SLKNTKSVK 405

Query: 425  AFXXXXXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIK 484
                          + LL +S++  L ++ N+     LD   HFINLS S YYTDRDII+
Sbjct: 406  GLSSLQTSFSTSPWFHLLGESRARILLNS-NEQAHSPLDAEQHFINLSVSHYYTDRDIIR 464

Query: 485  NYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNV 544
            NYE L +LDP NIG YFDAL+YIANRKG+YQLIAYCGKQ+++GQE +  AL  F IDP  
Sbjct: 465  NYEALSSLDPDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKE 524

Query: 545  VNLEXXXXXXXXXXYK----NESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRN 600
             N+           YK    N+S        N KNA+RL AK   S +LKFYVDHEPYR 
Sbjct: 525  FNIAELNEATLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRA 584

Query: 601  VNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLEN 660
            ++QAY+TL ID SVD+DII+TAYSIK  D+PGLK+DCDRALYTIAI +RS+ LFNFL + 
Sbjct: 585  LSQAYDTLSIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDE 644

Query: 661  CSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALM 720
            C +F  YY   +  Y++AL +LQVNENA+DE +LK F+ KW++E + E DQFL  + AL 
Sbjct: 645  CPQFLKYYGPEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALT 704

Query: 721  KLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYV 780
            ++ +ERNS LI NFL+ G IDP+ LP ENWPTGINNIGNTCYLNSLLQYYFSI+PLR Y+
Sbjct: 705  RISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYI 764

Query: 781  LGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTP 840
            L Y KT ++F D   N+  +RRIGGRE+   EVERSIQFIYQLR+LFYAM+++ +RCVTP
Sbjct: 765  LEYQKTLDNFNDHLSNSGHVRRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVTP 824

Query: 841  RRELAYLAFAPSNVEVEFE---NGVTDAKEDVSHYNDDKTSDTLIKIGEGDE----DLGE 893
             +ELAYLAFAPSNVEVEFE   N V      +S  +  + +       E  +    DL  
Sbjct: 825  SKELAYLAFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEM 884

Query: 894  AERTEASPTEDIYMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENAL 953
             ++T +   +DI     + + A +A +  + E    EN  D+   T+VAKI SDQLENAL
Sbjct: 885  EDKTNSDVDKDI-----ENVKANEANEANDIEITVGENITDLASPTRVAKIGSDQLENAL 939

Query: 954  EMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGET 1013
            EMGRQQDVTECIGNVL+Q+ESGSEP++ + EDNEQ DL+KQLFYG  KQ I+PLS   + 
Sbjct: 940  EMGRQQDVTECIGNVLFQIESGSEPIRYD-EDNEQYDLIKQLFYGTTKQSIVPLSATDKV 998

Query: 1014 RPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQ 1073
            R K+ERFLSLLVN+GDHP+DIYDA D YFKDE+LTM+EYG+VKRTVA+T FPTILQVQIQ
Sbjct: 999  RTKVERFLSLLVNIGDHPKDIYDAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQ 1058

Query: 1074 RVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQE 1133
            RVYYDRERFMPFKSIEPLPF   IYMDRY DT +P +L  +E T +MK  L  +K RQ+E
Sbjct: 1059 RVYYDRERFMPFKSIEPLPFKEVIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRE 1118

Query: 1134 LLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYN 1193
            LL R+E GL+RK+A+ E++  L+SN +  +    E   ++  ILK    DID+EL ++YN
Sbjct: 1119 LLDRDESGLTRKDAFLESIKLLESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYN 1178

Query: 1194 QITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVS 1253
             I  LE+ ISHQF+ F++ GYSLF+VFIHRGEASYGHYW+YIKD N  G+WRKYNDET+S
Sbjct: 1179 DINSLEDKISHQFDDFEEYGYSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETIS 1238

Query: 1254 EVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293
            EV +EEVFNF EGNTATPYFLVYVK+G E DIEPLKRI+E
Sbjct: 1239 EVQEEEVFNFNEGNTATPYFLVYVKQGQESDIEPLKRILE 1278

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1310 bits (3391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/1236 (54%), Positives = 881/1236 (71%), Gaps = 33/1236 (2%)

Query: 71   TTQDIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSF----KNGILQESM 126
            T Q  D G  LLY DL   + PMKTS+R+IDDILCDLS +NG +         GIL+   
Sbjct: 47   TDQLPDDGKHLLYTDLKNGS-PMKTSDRLIDDILCDLS-LNGQSQCLLSEQSQGILKLLP 104

Query: 127  IMYSKERINNQ-AYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVD 185
            I+YSK+R   Q   + GS++DQV  QTK+EY+S++CP +NKL+V  G+L+N+ S+  + D
Sbjct: 105  IIYSKQRQQLQNVSILGSLLDQVLFQTKFEYSSVSCPQHNKLQVFLGVLLNVSSSFESTD 164

Query: 186  EIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLL 245
            +++ + P++HLK+TVKTR  LE+ KK AG++Q+  +D   LH +DK DL TFDP++  L+
Sbjct: 165  DVV-RSPLFHLKVTVKTRSQLELYKKHAGVSQFFSVD--SLHSYDKEDLGTFDPEDTRLI 221

Query: 246  DYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGI 305
            DYAIYVSSDTN+L+LIEIF  EF++ EE ESF    I+ RY + C + D+L+PE +P   
Sbjct: 222  DYAIYVSSDTNKLVLIEIFHPEFNTSEEIESFTVDGIRKRYVDTCSRLDSLNPEDIPNQF 281

Query: 306  DCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQ 365
            DCLNT+ K  K P+ + + +  ++T+ ++NPIL+SH N  WL E+Y FT           
Sbjct: 282  DCLNTLYKTFKNPINKTDPSAPLQTIKASNPILNSHMNANWLTERYGFT---LLPGENED 338

Query: 366  EVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVD--QSDPALRGSKSY 423
            +  EYEPP+  +Y+   KVR ++E YIR+CLQLIFW K ++++ VD  Q       SKS+
Sbjct: 339  DEDEYEPPNFTTYIMDPKVRKMKECYIRKCLQLIFWAKLMIEV-VDNTQRSKLAASSKSF 397

Query: 424  RAFXXXXXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDII 483
            ++             YQL  +SK+ FL S  ND + M  D N+HFI LS S +Y DRDII
Sbjct: 398  KSLSGIAVQNTSKPLYQLFGESKNAFLNS--NDQNYM-WDTNYHFIALSASYHYNDRDII 454

Query: 484  KNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPN 543
             NYE    +D  NIG YFDA+ +IANRKGSYQL+AYCGKQ++VG E +  A++ F +DP 
Sbjct: 455  MNYETYSVIDKGNIGIYFDAIQFIANRKGSYQLLAYCGKQNIVGHEALEAAMRAFKLDPA 514

Query: 544  VVNLEXXXXXXXXXXYKNESV--KEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNV 601
             +++           YK+E +  +  +   +LKNA+R+ AK +++  +KFYVDHEPY+ V
Sbjct: 515  AIDINKLDISLLLSMYKHEQISNQNTSHLSDLKNALRVLAKFKDNRFVKFYVDHEPYKTV 574

Query: 602  NQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENC 661
            +QAY  LE+D SVDDDIIQTAYSIK  D+PGLKI+C RALYTIAI +RSM LFN+L+E C
Sbjct: 575  SQAYNELEVDESVDDDIIQTAYSIKVNDSPGLKIECIRALYTIAINKRSMALFNYLIEEC 634

Query: 662  SEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMK 721
             EFQ +Y   +Y Y QAL I+QVNENA+DE+IL+ FQ KW +E + E DQFL+ K AL+K
Sbjct: 635  PEFQDFYGPEKYSYEQALAIIQVNENASDEMILQIFQKKWNDEPLVEYDQFLSLKAALLK 694

Query: 722  LGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVL 781
            L +E+NSKLI++FL  G+IDPSCLPVENWP G+NNIGNTCYLNSLLQYYF+I+PLR Y+ 
Sbjct: 695  LCIEKNSKLISHFLTTGLIDPSCLPVENWPIGLNNIGNTCYLNSLLQYYFAIAPLRNYIC 754

Query: 782  GYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPR 841
             Y  T E F     +AK  RRIGGR+V  +EVERSIQF YQLRDLF  MI++N RCV+P 
Sbjct: 755  SYQSTTESFEATDTDAKINRRIGGRQVCASEVERSIQFTYQLRDLFNGMIFSNSRCVSPT 814

Query: 842  RELAYLAFAPSNVEVEFENGVTDAKEDVSHYN-DDKTSDTLIKIGEGDEDLGEAERTEAS 900
            +ELAYLAF+PSN+EVEF+ G   A E    ++ + K +D  +     +ED+   E  E  
Sbjct: 815  QELAYLAFSPSNIEVEFDAGSGIASESGGTFSLNGKDTDAPLTDMPLNEDVTMTEAGEPQ 874

Query: 901  PTEDIYMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQD 960
                  + D  +L   +A   +++   + E    I  STKVAKI SDQLENALE+GRQQD
Sbjct: 875  ------LDDTGLLAPVEADVPVDQMKLAKEV---INSSTKVAKIGSDQLENALELGRQQD 925

Query: 961  VTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERF 1020
            VTECIGNVLYQLES S+P++++ EDNEQ DL+K LFYG+ +QDI+PLS   + R K ERF
Sbjct: 926  VTECIGNVLYQLESASDPIKLD-EDNEQYDLIKHLFYGKTRQDIVPLSNSTDVRSKYERF 984

Query: 1021 LSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRE 1080
            LSLLVNV DHP+DIYDALD YF +E+LT++EYG+V+RTVAIT+FPTILQ+QIQRVYYDRE
Sbjct: 985  LSLLVNVSDHPKDIYDALDSYFMEEYLTLEEYGDVRRTVAITEFPTILQIQIQRVYYDRE 1044

Query: 1081 RFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEV 1140
            RFMPFKSIEP+PF++ +YMDRY  T DP +L  R  T+++K  L + K RQQELLSRN++
Sbjct: 1045 RFMPFKSIEPIPFNSTLYMDRYAATDDPVMLTKRRETSELKTRLRECKVRQQELLSRNDM 1104

Query: 1141 GLSRKEAYSETVNFLQSNAL-QLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLE 1199
            GLSRKEAY+ET+  LQS+ L Q+  +  E Q  + + L      ID+EL  +Y +I QLE
Sbjct: 1105 GLSRKEAYTETMKMLQSDFLEQVPSVRGEDQTAVVSGLSDMVASIDEELVQLYTEIGQLE 1164

Query: 1200 ETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEE 1259
              I HQF+ F+KVGYSLFAVFIHRGEASYGHYWVY+KD+  +GIWRKYNDETVSEVP+EE
Sbjct: 1165 TQIDHQFDSFQKVGYSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVPEEE 1224

Query: 1260 VFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIEES 1295
            VFNFTEGN ATPYFLV VK+  E+DIEPL RII+ +
Sbjct: 1225 VFNFTEGNNATPYFLVLVKQTHEQDIEPLHRIIDNT 1260

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 1293 bits (3345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/1279 (52%), Positives = 882/1279 (68%), Gaps = 54/1279 (4%)

Query: 36   NSDKPDLPSKTNDDETNKSNPNSTGQGPTCDTPRVTTQDIDPGNTLLYPDLGTANFPMKT 95
            NS+  DL    ND E N S+ +    G   D   V+ +D   G  LLYPD      P KT
Sbjct: 20   NSNAVDL---ENDSEVNSSSMDLDSCG---DATSVSWKD--DGKQLLYPDARDLT-PFKT 70

Query: 96   SNRIIDDILCDLSFI-----NGPNLSFKNGILQESMIMYSKERINNQAYLFGSMVDQVAL 150
            S R++D+I+C + +I     +     F NG+L++ ++ YSK R N Q +  G++VDQ+ L
Sbjct: 71   SERLLDEIMCSVPYILLSEKDESFNEFSNGLLKKQLLSYSKSRHNVQPFSVGTIVDQIIL 130

Query: 151  QTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIISKVPIYHLKITVKTRQLLEVSK 210
            QTK+EY S TCP  N + V+ G+L++      +  + ++ + IYHLKITVK R  LE +K
Sbjct: 131  QTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFDDVADLKIYHLKITVKVRSFLERTK 190

Query: 211  KQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIYVSSDTNRLILIEIFSTEFDS 270
            +  G+ +YHLLD   LH FD++DL+ FDP +P L+D+AIYVS DTN+L+L+EIF  EFDS
Sbjct: 191  RHVGVPRYHLLD--SLHPFDQQDLLNFDPKDPKLVDHAIYVSDDTNKLVLLEIFRPEFDS 248

Query: 271  REERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNTVLKLLKQPLTRKNNNDKIRT 330
             EER S     IK R+ +A KK+DTLD + +PT IDC+NT+ K+ K PLTRK+N++ ++T
Sbjct: 249  EEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCINTMFKIFKGPLTRKSNDEPVKT 308

Query: 331  VSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEYEPPDLISYVQGYKVRSLREK 390
            +SS+N +L+S  NP+WL+ KY F +   T+E T +++++Y PP+L+ +     VR  RE 
Sbjct: 309  LSSDNVVLNSQMNPKWLVTKYGFQELIETEEETEEQLIDYLPPNLVDFETDQDVRKSREA 368

Query: 391  YIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFXXXXXXXXXXXXYQLLNDSKSNFL 450
              R+CL+LI+ GK  + L   +   +   SKS R F             Q+L+++K+   
Sbjct: 369  VTRKCLELIWLGKISISLMTPEQKES--ASKSLRTFNLLQTSFSTLFWSQILDENKN--- 423

Query: 451  ASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLIALDPPNIGTYFDALSYIANR 510
             +T  ++  M LD  +H I+LS S +YTDRDII+NYE    LDP NIG YFD+L +IAN 
Sbjct: 424  IATMKENPQMNLD--YHLIDLSASYHYTDRDIIQNYELQCKLDPANIGIYFDSLHFIANN 481

Query: 511  KGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLEXXXXXXXXXXYKNESVKEGAD- 569
            +GSY LI YC KQD+VGQE +  ALK F++DP+ ++L           YKNE    G D 
Sbjct: 482  RGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAIFMTIYKNEVKLHGNDP 541

Query: 570  --FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETLEIDSSVDDDIIQTAYSIKT 627
                NL+NA+R+ AK +NS +LKFYVD+EPY ++ +A+  LE+D SVDDDIIQTAYSIK 
Sbjct: 542  TRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDESVDDDIIQTAYSIKV 601

Query: 628  VDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYYNIGRYDYRQALGILQVNEN 687
             D PGLKIDCDRALYT+A+ +RSMIL NFL + C  FQ +Y   +Y Y +AL  LQVNEN
Sbjct: 602  NDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQYTYSEALQKLQVNEN 661

Query: 688  ANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNSKLINNFLMNGVIDPSCLPV 747
            A D+ IL+ FQ +W ++ + +AD+ L+ K  L K+  ERNSKLI+++L  GV++P CLP 
Sbjct: 662  AADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISSYLETGVVNPGCLPA 721

Query: 748  ENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGRE 807
            +NWP G+NNIGNTCYLNSLLQYYF ISPLR YV  Y KT E   +   +    RRIGGRE
Sbjct: 722  DNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGRE 781

Query: 808  VGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFAPSNVEVEFENGVTDAKE 867
            +   EVERS+QF+YQLRDLF  MI+++ RCVTP +ELAYLAFAPSNVEVEF     D   
Sbjct: 782  INKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPSNVEVEF-----DQPN 836

Query: 868  DVSHYNDDKTSDTLIKIGEGDEDLGEAE-----------RTEASPTEDIYMTDDDMLGAA 916
            ++   N +     ++ I   DED+ E +           + E SP   +   DD     +
Sbjct: 837  ELQSGNGEDVDGDIVFI---DEDISEPKGKSLVLDEENSKVENSPENQLIEIDD-----S 888

Query: 917  KATDGINKEDESTEN---GIDILPSTKVAKISSDQLENALEMGRQQDVTECIGNVLYQLE 973
              + G  K +E ++N   G     ST+VAKIS DQLENALE+GRQQDVTECIGNVL+QLE
Sbjct: 889  SDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNVLFQLE 948

Query: 974  SGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVNVGDHPRD 1033
            S S P+ +  ED+EQ DL+K+LFYG+ KQ IIPL    E R K+ERF+SLLVNV DHP+D
Sbjct: 949  SASNPISLE-EDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKD 1007

Query: 1034 IYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMPFKSIEPLPF 1093
            +YDALD+YF DE+LTMDEYGEVK+++A+T+FPTILQ+QIQRVYYDRERFMPFKSIEPLPF
Sbjct: 1008 VYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPF 1067

Query: 1094 SAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLSRKEAYSETVN 1153
            S  IYMDRY +T D ++L+ ++ T ++K +L +++KRQ+ELLSRNE+GLSRKEA+ ET  
Sbjct: 1068 SETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFMETRK 1127

Query: 1154 FLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETISHQFEQFKKVG 1213
            FL S+AL+ QGI  E +  L   L  A  DIDDEL+ +YN I  +E  I  QF++F+ +G
Sbjct: 1128 FLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIG 1187

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            YSLFAVFIHRGEASYGHYWVYIKD+ +NGIWRKYNDET++EVP+ EVFNFTEGNTATPYF
Sbjct: 1188 YSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYF 1247

Query: 1274 LVYVKEGSEKDIEPLKRII 1292
            LVYVK+ +  +IEPLKRI+
Sbjct: 1248 LVYVKQENLNEIEPLKRIV 1266

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1290 bits (3337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/1241 (54%), Positives = 856/1241 (68%), Gaps = 57/1241 (4%)

Query: 75   IDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNL-----SFKNGILQESMIMY 129
            ID G TLLYP +   NFP KTS+R++DDI  D+ F+N            NG+L+  M+ Y
Sbjct: 33   IDDGKTLLYPGVH-LNFPFKTSDRLLDDIRSDMFFLNSEEHDILYSQLHNGVLRLPMLEY 91

Query: 130  SKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIIS 189
            S+++   Q    G ++DQV L+TKYEY S TCP  NK+ V  G+L++      ++D++I+
Sbjct: 92   SRKK-TTQPCSVGYLLDQVTLKTKYEYESKTCPELNKINVFMGVLVDQHIRPESLDDVIN 150

Query: 190  KVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAI 249
             VPIYHLKITVKTR  LE  KK  G+T YHL+D   LH FDK+D+     ++  L+D A 
Sbjct: 151  -VPIYHLKITVKTRLHLERVKKHVGVTHYHLID--QLHSFDKQDIF-MTTESEQLVDSAT 206

Query: 250  YVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLN 309
            YVSSDTNRL+ IEIF  EF ++E+   F    +K RY  AC+KF  LDP +VPT ++CLN
Sbjct: 207  YVSSDTNRLLRIEIFKPEF-TKEDLAIFSQEKVKERYASACEKFQDLDPTSVPTQVECLN 265

Query: 310  TVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLE 369
            T+ K+ K PL R+++ D ++T+S++N  L+S  +P WL EKY+F     TDE TG+ + E
Sbjct: 266  TLFKIFKGPLNRRSSEDILKTISADNKFLNSQIDPSWLTEKYDFKLVETTDEETGELIRE 325

Query: 370  YEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFXXX 429
            +EPPDL  YVQ + VRS RE Y R+CL+LIF GK   QL     D   + SKS R+F   
Sbjct: 326  FEPPDLTDYVQDWSVRSKRESYTRKCLELIFLGKTSAQLL--PKDILSKDSKS-RSFNLY 382

Query: 430  XXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERL 489
                     + LL D + NF    ++ +     D ++HFINLS SSYY+D+DIIKNYE  
Sbjct: 383  QTNFSTSFWFHLLGDGR-NF----QDHNLQQPFDNDYHFINLSASSYYSDKDIIKNYETQ 437

Query: 490  IALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLEX 549
            I+LDP N+G YFDAL+YIAN KG YQLIAYCGKQ++VG+E ++ AL  F ID    +++ 
Sbjct: 438  ISLDPENVGIYFDALNYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSKDTDVKS 497

Query: 550  XXXXXXXXXYKNE----SVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAY 605
                     YKNE    SV++  D   LKNA+RL AK + S +LKF+VD+EPY + ++AY
Sbjct: 498  ITDELLLSIYKNELKAASVQKRTD---LKNALRLLAKFKESKKLKFHVDYEPYTSTSKAY 554

Query: 606  ETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQ 665
            + LEI  SVD DIIQTAY+I+  DAPGLKIDCDRALYT+A+ +RS++LFNFL + C  FQ
Sbjct: 555  QLLEIGESVDLDIIQTAYTIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQECPIFQ 614

Query: 666  AYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLE 725
             +YNI  + Y++AL +LQVNENA D+VIL+ FQ KW  E +   DQFL  K AL KLG+E
Sbjct: 615  EFYNIDNWSYKEALSLLQVNENATDDVILEIFQRKWSQEPMTSPDQFLILKTALTKLGIE 674

Query: 726  RNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSK 785
            RNSKLINNF+  G++D SCLP  NWPTG+NNIGNTCYLNSLLQYYFSISPLR+YVL Y K
Sbjct: 675  RNSKLINNFIDTGIVDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYVLNYQK 734

Query: 786  ---TYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRR 842
                + D  DA     + RRIG REV   EVERS+QF+YQLRDLF  M++T +R VTP +
Sbjct: 735  MLNCFRDIEDATGGEISKRRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKERFVTPTK 794

Query: 843  ELAYLAFAPSNVEVEFENGV--TDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEAS 900
            ELAYLAFAPSN+EVEFE     T A ED+    D++T+   I     D    E E+   S
Sbjct: 795  ELAYLAFAPSNIEVEFEAPTITTVAPEDL----DERTNKLDIIDLAADGIDNETEKGSKS 850

Query: 901  PTEDIY-------MTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENAL 953
               D++        T+D ++G  +  + +N              S +VAKISSDQLEN L
Sbjct: 851  SLLDVHNQQKPEEQTEDIIMGGTQEEEAVN-------------ASMRVAKISSDQLENTL 897

Query: 954  EMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGET 1013
            E+GRQQDVTECIGNVL+QLES S+P  +  EDNEQ DL+K+LFYG+IKQ +IP+    + 
Sbjct: 898  ELGRQQDVTECIGNVLFQLESASDPWSLE-EDNEQHDLIKELFYGKIKQHLIPVKNPSKI 956

Query: 1014 RPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQ 1073
            R K+ERF+SLLVN+GDHP+DIYDALD+YFKD+ L +DE GEVKRTVA+T  P ILQ+QIQ
Sbjct: 957  RTKIERFVSLLVNIGDHPKDIYDALDLYFKDDLLQLDEDGEVKRTVAVTNLPKILQIQIQ 1016

Query: 1074 RVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQE 1133
            RVYYDRERFMPFKSIEPLPFS  IYMDRY+DT DP +L  R+ T K+K EL  LK RQ +
Sbjct: 1017 RVYYDRERFMPFKSIEPLPFSETIYMDRYMDTDDPVMLAKRDDTKKLKEELRALKDRQHQ 1076

Query: 1134 LLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYN 1193
            LLS+N+ GLS K +  +T  FLQS  L    I  E +  L   +    T ID ELS++Y 
Sbjct: 1077 LLSKNDTGLSFKGSLLQTKKFLQSEVLDKHEIAVENKGALVCHIDSMITKIDGELSSLYQ 1136

Query: 1194 QITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVS 1253
            +IT LE  I++QF +F K+GYSLFA FIHRGEASYGHYW+YIKD  +NGIWRKYNDE+V+
Sbjct: 1137 KITALEVQIANQFNEFTKIGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVT 1196

Query: 1254 EVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIEE 1294
            EVP  EVFNFTEGNTATPYFLVY+KEG E +IEPLKR+I+E
Sbjct: 1197 EVPQSEVFNFTEGNTATPYFLVYIKEGHEDEIEPLKRVIKE 1237

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1255 bits (3248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/1332 (49%), Positives = 878/1332 (65%), Gaps = 80/1332 (6%)

Query: 27   SVNMDQSSTNSDKPDLPSKTNDD---ETNKSNPNSTGQGPTCDTPRVTTQD------IDP 77
            +++  Q+S      DL S TN D     N +   ST      +     +QD      +D 
Sbjct: 4    AISTHQTSDIGVPSDLESTTNIDIQLSDNSTEQTSTSSMYNEELANQLSQDSNIIPEVDD 63

Query: 78   GNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLS--------------------- 116
            G  +LY      +F  KT++R++DD++ DLS++   N S                     
Sbjct: 64   GKHILYDSFSNHSF-FKTADRLLDDLMIDLSYMLFNNSSEHINDNNNNNDNNHNNNNNTS 122

Query: 117  -----------FKNGILQESMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANN 165
                       + NGIL+     YSK+R +   +  G++VDQ+ LQT++E+ S+TCP  N
Sbjct: 123  NSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIVDQINLQTRFEFKSVTCPEFN 182

Query: 166  KLEVQFGILMNLPSNITNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFED 225
             + V  G+LM+  S       + + +P+YH KITVKTR  LE +KK  GI+ +HL+DF+D
Sbjct: 183  DVHVLLGVLMDNRSQAP----LGTFLPVYHFKITVKTRSYLEKTKKHVGISHFHLIDFDD 238

Query: 226  LHHFDKRDL--MTFDPDNPDLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIK 283
            LH FDK+DL     D +   LLD AI++S DTN+L+++EIF  EF+  EE ESF   +I 
Sbjct: 239  LHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEIFKPEFNELEEIESFSQESIA 298

Query: 284  SRYQEACKKFDTLDPEAVPTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFN 343
             RY  AC +F  LD + +PT ++CLNTV K+ K PL  KN N+ ++ ++++NP+L+SH+N
Sbjct: 299  ERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKNINEPLKAINADNPLLNSHWN 358

Query: 344  PEWLLEKYNFTKHYATDETTGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGK 403
            P WLL KY F +    +  T +E  EY PP+L  Y+     R+LRE YIR+CL+LIF  K
Sbjct: 359  PNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDINTRALRESYIRKCLELIFISK 418

Query: 404  CLVQLRVDQSDPALRGSKSYRAFXXXXXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALD 463
              + L     +     SK+ R+F            +Q L + K      T N      LD
Sbjct: 419  RNISLM--GPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYEHKPQL--DTYN-----KLD 469

Query: 464  QNFHFINLSTSSYYTDRDIIKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQ 523
              +H+INL TS YYT+RDII+NY  L ALDP NIG Y+DAL+YIA  K SYQLI++  KQ
Sbjct: 470  YEYHYINLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQSKNSYQLISFVSKQ 529

Query: 524  DVVGQENINMALKCFNIDPN----VVNLEXXXXXXXXXXYKNESVKEGADFVNLKNAMRL 579
            DV+GQE +N AL  FNID N    +  L            + ++    A    +KNA+RL
Sbjct: 530  DVIGQEALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERKQANISSARLAEMKNALRL 589

Query: 580  FAKIRNSPQLKFYVDHEPYRNVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDR 639
             AK ++S +LKFY D+EPY + +Q Y TLE+D SVDDDIIQTAY+IK  DAPGLKIDCDR
Sbjct: 590  LAKYKHSDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIKVNDAPGLKIDCDR 649

Query: 640  ALYTIAIQRRSMILFNFLLENCSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQT 699
            AL T+A +R+S+ LF FLL+ C +F  +Y + R+DY QAL  LQVNENA DE IL+ FQ 
Sbjct: 650  ALLTVATRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNENATDETILEIFQQ 709

Query: 700  KWFNEQIHEADQFLNYKCALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGN 759
            +W N++  + D  LN + AL K+  E+NSKLI+NF+  G++DP+CLPVENWP G+NNIGN
Sbjct: 710  RWSNDKSLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLPVENWPAGLNNIGN 769

Query: 760  TCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDA---KRNAKTIRRIGGREVGDNEVERS 816
            TCYLNSLLQYYFSI PLR+++L Y  T + F +     +  +  RRIGGREV + EVERS
Sbjct: 770  TCYLNSLLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEKRRRIGGREVNELEVERS 829

Query: 817  IQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFAPSNVEVEFENGVTD-------AKEDV 869
            +QFIYQ+RDLF  MI++  RCV+PR+ELAYLAF PSN+EVEFE+  T+         +D 
Sbjct: 830  VQFIYQVRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESASTEDDMGDKSNAQDA 889

Query: 870  SHYNDDKTSDTLIKIGEGDE-DLGEAERTEAS---PTEDI--YMTDDDMLGAAKATDGIN 923
                D+  +DT I + E +  DL  A +   S   PT D    +T+ D    +K     N
Sbjct: 890  VVLQDEAKNDTDINLTEVNLIDLEPATKVSTSNDQPTMDAIEILTNSD--NKSKELSKTN 947

Query: 924  KEDESTENGIDILPSTKVAKISSDQLENALEMGRQQDVTECIGNVLYQLESGSEPLQINP 983
               E + N  DI  ST+VAKISSDQLENA EMGRQQDVTECIGNVL+QLE+G +P+ ++ 
Sbjct: 948  PFREVSPNE-DITISTRVAKISSDQLENAFEMGRQQDVTECIGNVLFQLETGFDPISLDN 1006

Query: 984  EDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVNVGDHPRDIYDALDMYFK 1043
            EDNEQ DLVK+LFYG+ KQ IIPL+     R K+ERFLSLLVN+ DHP+DIYDAL+ YF 
Sbjct: 1007 EDNEQYDLVKELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDHPKDIYDALNQYFA 1066

Query: 1044 DEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYV 1103
            DEFLTM+EYG+VK+T+++T++P ILQ+QIQRVYYDRERFMPFKSIEPLPF   IYMDRY 
Sbjct: 1067 DEFLTMEEYGDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIEPLPFEQVIYMDRYA 1126

Query: 1104 DTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLSRKEAYSETVNFLQSNALQLQ 1163
            +++DPE++  +E TA++K +L + + RQ+ELLS+NE+GLSRKEA  ET+ FL+S  +   
Sbjct: 1127 ESSDPELISKKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMMETIKFLKSPVILEN 1186

Query: 1164 GIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETISHQFEQFKKVGYSLFAVFIHR 1223
            GI    +D L   L++    I++ELS +YN+I QL+  I HQF+ FKK+ YSLFAVFIHR
Sbjct: 1187 GIDTTNKDVLVRELQQYVDGINNELSNLYNKINQLQNRIDHQFDDFKKLAYSLFAVFIHR 1246

Query: 1224 GEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEK 1283
            GEASYGHYWVYIKD+++NGIWRKYNDE+V+EVP++EVFNFTEGNTATPYFLVYVK+ S  
Sbjct: 1247 GEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATPYFLVYVKQDSLS 1306

Query: 1284 DIEPLKRIIEES 1295
            DIEPLKRII+ +
Sbjct: 1307 DIEPLKRIIQNT 1318

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 1228 bits (3177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/1230 (53%), Positives = 864/1230 (70%), Gaps = 50/1230 (4%)

Query: 76   DPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLS--FKNGILQESMIMYSKER 133
            D G  LLYP +G  N P KT +R+IDDI+ DL+FIN  +LS  FK GIL+ S + YSK R
Sbjct: 36   DDGKQLLYPAVG-LNLPFKTPDRLIDDIVYDLAFINDSDLSSEFK-GILKSSPLTYSKRR 93

Query: 134  IN-NQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVD--EIISK 190
                 +Y  G+ +DQ+ LQTKYEY S++CP +N++ V FG+L++  SN+ N    + +++
Sbjct: 94   QELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLID--SNMENPTSFDAVAE 151

Query: 191  VPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIY 250
             PIYHLK+TVKTR  LE  KK  GI+ YHL+   +LH FDK+DL+TFD  + +L+D+A Y
Sbjct: 152  TPIYHLKVTVKTRTKLEHLKKHVGISHYHLI--TELHPFDKQDLLTFDESDENLIDFAAY 209

Query: 251  VSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNT 310
            VSSDTN+LILIEIF  EF S EE ESF+T  I SRYQ  C+++D+L+ + +P+ +DC  T
Sbjct: 210  VSSDTNKLILIEIFKPEFSSEEEIESFKTEHITSRYQLVCEQYDSLNSDTIPSQVDCFRT 269

Query: 311  VLKLLKQPLTRKNNN-DKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLE 369
            + ++ K PL RK+ + D I+T+++ N  L+SH + +WL+ KY F ++   +     + LE
Sbjct: 270  LFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGLE 329

Query: 370  YEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFXXX 429
            YEPPDLI +   +K+R LR+ Y R+CLQL FWGK   +L    +    +  KSYR F   
Sbjct: 330  YEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKAN--IQKYEKSYRFFNKM 387

Query: 430  XXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERL 489
                     +Q+ NDS        ++D+ +  LD N+HFINLS+S YYTDRDII+NYE L
Sbjct: 388  HTHTSTTALFQIFNDSARRL---QQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETL 444

Query: 490  IALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLEX 549
              +D  N G YFDAL+YIAN KGSYQLI+YCGKQDVVGQE +  +L+   +D   V+++ 
Sbjct: 445  CNIDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKS 504

Query: 550  XXXXXXXXXYKNESVKEGAD---FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYE 606
                     YK E      D      LK+AMR+  K+  S +L+F++DHEPY NV  AY 
Sbjct: 505  LNDSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYN 564

Query: 607  TLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQA 666
             L+ID SVDDDI+QTAY+I+  D+PGLK+DCD+ALYTIAI+ RS+ LFNFL+E C +F  
Sbjct: 565  LLDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFIT 624

Query: 667  YYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLER 726
            YY      ++QAL +LQVNENA DE+++K FQ +W  + ++E DQ L  K AL K+  E+
Sbjct: 625  YYGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQLLILKAALTKIASEK 684

Query: 727  NSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKT 786
            NSKLI+ FL  GVID + L  ENWP G+NNIGNTCYLNSLLQYYFSI+PLREY+L Y  +
Sbjct: 685  NSKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGS 744

Query: 787  YEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAY 846
              ++   + + K  RRIGGREV +NEVERSIQF+YQLRDLF  MIY+  RC+TP+ ELAY
Sbjct: 745  ISNYEIDETSNK--RRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAY 802

Query: 847  LAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEASPTEDIY 906
            LAFAPSN+EVEF      A  +V     ++T+  L    EGD DL             + 
Sbjct: 803  LAFAPSNIEVEF------AASEV-----ERTTVDLPFDKEGDIDL-------------VD 838

Query: 907  MTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQDVTECIG 966
            +++D++     A +  +    +TE+ +    STK AKISSDQLENALEMGRQQDVTECIG
Sbjct: 839  LSNDNLNTTNNAQEVTSDISVATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIG 898

Query: 967  NVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVN 1026
            NVLYQ+ES S+P++++ ED EQ DL+K+LFYG+ KQ+I+PLS + +TR K E F SLLVN
Sbjct: 899  NVLYQMESASKPIKLD-EDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVN 957

Query: 1027 VGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMPFK 1086
            + DHPRDIYDAL+  F  EFL MDEYG+V+RTV+IT FP ILQ+QIQRVYYDRERFMPFK
Sbjct: 958  ISDHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFK 1017

Query: 1087 SIEPLPFSAKIYMDRYVDTADPEILETRE-RTAKMKAELVQLKKRQQELLSRNEVGLSRK 1145
            SIEPLPFS  IYMDRY    D E+L+T++  T +++ +L  LK RQ ELL+RNE+GLSRK
Sbjct: 1018 SIEPLPFSNTIYMDRYA-ALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRK 1076

Query: 1146 EAYSETVNFLQSNA-LQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETISH 1204
            E+Y ET+NFL   A +  QG+    + ++   L+KA ++ID ELS IY++I  +E  I H
Sbjct: 1077 ESYLETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDH 1136

Query: 1205 QFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT 1264
            QF++F+ +GYSLFAVFIHRGEASYGHYWVYIKD  ++GIWRKYNDETV+EV +EEVFNFT
Sbjct: 1137 QFDEFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDETVTEVNEEEVFNFT 1196

Query: 1265 EGNTATPYFLVYVKEGSEKDIEPLKRIIEE 1294
            EGNTATPYFLV+VK+  + DIEPLKRII +
Sbjct: 1197 EGNTATPYFLVFVKDYYKGDIEPLKRIIAD 1226

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1219 bits (3153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/1253 (50%), Positives = 842/1253 (67%), Gaps = 39/1253 (3%)

Query: 48   DDETNKSNPNSTGQGPTCDTPRVTTQDI-DPGNTLLYPDLGTANFPMKTSNRIIDDILCD 106
            D E  +    + G  P  ++     Q I D G TLLY D G   FP KTS R++DDI  +
Sbjct: 7    DSEHTEYEVGNEGSAPGLESNLNDGQPIKDTGKTLLYADAGNL-FPFKTSERLLDDIKLE 65

Query: 107  LSFINGPNL-----SFKNGILQESMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTC 161
            L++ N             G+L+  ++ YS++  ++  Y  G +VDQV L+T+YEY+S TC
Sbjct: 66   LAYKNSIEHDILYSELHKGVLRLPILEYSRKPTDD-VYNIGHLVDQVVLKTRYEYDSKTC 124

Query: 162  PANNKLEVQFGILMNLPSNITNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLL 221
            P  NK+ V  G+L+N  S +  + + +++  +YHLK+TVKTR  LE ++KQAG+ QYHLL
Sbjct: 125  PGLNKITVFMGVLLN-SSQMPKIYDDVTQASVYHLKVTVKTRLHLERTRKQAGVPQYHLL 183

Query: 222  DFEDLHHFDKRDLMTFDPDNPDLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTAT 281
               +LH FDK DL+  D ++P L+D  +YVSSDTN+LI IEIF  EF S+ +   F    
Sbjct: 184  --PELHPFDKEDLLLTDAEDPHLIDSVMYVSSDTNKLICIEIFKPEF-SQADLTEFCPDA 240

Query: 282  IKSRYQEACKKFDTLDPEAVPTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSH 341
            IK RY  AC K+  LDP+ +P+  +C +T+LK+ K PL R+   D ++T+S++N  L+S 
Sbjct: 241  IKKRYSSACDKYPDLDPDMIPSQAECFSTLLKIFKGPLNRRGPEDVLKTISADNKFLNSQ 300

Query: 342  FNPEWLLEKYNFTKHYATDETTGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFW 401
             +P+WL EK+ F    A D       +E++PPDL +YV    VR LRE Y R+CL+LIF 
Sbjct: 301  LDPKWLTEKFAFKLCQANDTDEAGSAMEFQPPDLTNYVDDVSVRELRESYTRKCLELIFL 360

Query: 402  GKCLVQLRVDQSDPALRGSKSYRAFXXXXXXXXXXXXYQLLNDSKSNFLASTRNDSDSMA 461
            GK    L + + D A + S++ R+F            + LLN+++         D  S  
Sbjct: 361  GKMSSSL-MTKEDIA-KDSRA-RSFQLYQTSNSLSFFFHLLNETRGVM------DYGSQE 411

Query: 462  LDQNFHFINLSTSSYYTDRDIIKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCG 521
            +D+N++F+NLS+  YYTD+DIIKNYE    LD  NIG YFDAL+YIAN KGSY LIAYC 
Sbjct: 412  IDRNYNFMNLSSCYYYTDKDIIKNYETQALLDRENIGIYFDALTYIANLKGSYALIAYCR 471

Query: 522  KQDVVGQENINMALKCFNIDPNVVNLEXXXXXXXXXXYKNE-SVKEGADFVNLKNAMRLF 580
            KQDVVG+E ++ AL  F IDP+  +L           Y+ E S         LKNA+RL 
Sbjct: 472  KQDVVGKEALDSALSLFGIDPSDTSLMTIPDELLLGVYRKECSQGSTQKHATLKNALRLL 531

Query: 581  AKIRNSPQLKFYVDHEPYRNVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRA 640
            AK +NS  L+FY  +EPY NV+QAY  LE+D SVD D+IQTAY+IK  D+PGLKIDCDRA
Sbjct: 532  AKAKNSSTLQFYAAYEPYDNVHQAYSLLEVDESVDVDVIQTAYTIKVADSPGLKIDCDRA 591

Query: 641  LYTIAIQRRSMILFNFLLENCSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTK 700
            +YT+A+ +RSM LFNFL+E C  F+ +Y+  +  Y  AL +LQVNENA+D++IL+ FQ K
Sbjct: 592  IYTLAVTKRSMPLFNFLVEQCPVFEEFYSADKLTYHDALSLLQVNENASDDIILEVFQRK 651

Query: 701  WFNEQIHEADQFLNYKCALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNT 760
            W +E +   DQFL    AL K+G  RNS LIN +L  G ID  CLP  NWPTG+NNIGNT
Sbjct: 652  WNHETVLSPDQFLKSSSALTKIGQVRNSLLINRYLETGTIDVRCLPARNWPTGLNNIGNT 711

Query: 761  CYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFI 820
            CYLNSLLQYYF ISPLR++++ Y KT  +F+D+  N  + RRIGGREV ++EVERS+QF+
Sbjct: 712  CYLNSLLQYYFCISPLRQFIVDYQKTLAEFHDSIGNLGSKRRIGGREVSESEVERSVQFV 771

Query: 821  YQLRDLFYAMIYTNKRCVTPRRELAYLAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSDT 880
            YQLRDLF  MI+T  R VTPR+ELAYLAFAPSN+EVEFE   T      +  ND +  D 
Sbjct: 772  YQLRDLFTDMIHTESRFVTPRKELAYLAFAPSNIEVEFEGTPTVEPAKENSENDVEVID- 830

Query: 881  LIKIGEGDEDLGEAERTEA-SPTEDIYMTDDDMLGAAKATDGINKEDESTENGIDILPST 939
            L   GE  ED+   +  E+ +      + +D ++    AT+              ++ ST
Sbjct: 831  LTAEGEASEDVDMLKPAESETQVVTTQLNEDTVMNDVIATEP-------------MVSST 877

Query: 940  KVAKISSDQLENALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGE 999
            +VAKIS+DQLENALEMGRQQDVTECIGNVL+QLES S+P+ ++  D EQ DL+K+LF+G+
Sbjct: 878  RVAKISTDQLENALEMGRQQDVTECIGNVLFQLESASDPINLD-SDGEQRDLIKELFFGK 936

Query: 1000 IKQDIIPLSGVGETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTV 1059
            +KQD+ PL    + R K+ERF+SLLVNVGDHP+++YDALD YFKD+ L +++ G+VKRT+
Sbjct: 937  LKQDLAPLKDPSKIRTKIERFVSLLVNVGDHPKNVYDALDQYFKDDVLQLED-GDVKRTL 995

Query: 1060 AITKFPTILQVQIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAK 1119
            AI + P +LQ+QIQRVYYDRE+FMPFKSIEPLPF   IYMDRY+DT D E+ + R+  AK
Sbjct: 996  AIKELPVVLQIQIQRVYYDREKFMPFKSIEPLPFRDTIYMDRYMDTQDAEMQQKRQEAAK 1055

Query: 1120 MKAELVQLKKRQQELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKK 1179
             K EL  LK RQ+ LL +N  G+S K +  ET  FL+S  L+   I  + +D     ++ 
Sbjct: 1056 YKNELESLKLRQKALLEKNGNGMSFKTSLLETERFLESGVLEQNAIEIQKKDSALKAIES 1115

Query: 1180 AGTDIDDELSTIYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYN 1239
                ID+ELS IY++IT L++ +S  F+ FK++GYSLFAVFIHRGEASYGHYW+YIKD+N
Sbjct: 1116 MLLKIDNELSEIYSRITALDQKLSSHFDNFKELGYSLFAVFIHRGEASYGHYWLYIKDHN 1175

Query: 1240 QNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRII 1292
            +NGIWRKYNDETV+E P+ EVFNFTEGNTATPYFLVYVK G E +I+PL R+I
Sbjct: 1176 RNGIWRKYNDETVTEAPENEVFNFTEGNTATPYFLVYVKNGHESEIQPLHRVI 1228

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 1211 bits (3132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/1242 (51%), Positives = 849/1242 (68%), Gaps = 47/1242 (3%)

Query: 74   DIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSF---INGP--------NLSFKNGIL 122
            ++D G+ LLY +L   + P+KTS RI+DDIL ++     IN          N  F N IL
Sbjct: 66   ELDDGSKLLYQNLMNMS-PLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSIL 124

Query: 123  QESMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNIT 182
            ++ MI YSK R        GS+VDQ+ +Q+K+EY S+TCP +NK+EV  G+L++      
Sbjct: 125  KQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDSTQKAN 184

Query: 183  NVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNP 242
             +D++ S + I H+KITVKTR +LE +++  G++++HL+  ++LH FD++DL+TFD +  
Sbjct: 185  TLDDL-SNIIINHVKITVKTRTVLERTRRLMGLSKFHLV--KELHPFDQKDLLTFDKNAA 241

Query: 243  DLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVP 302
            +L+D+AIYVS DTN+LILIEIF+ EFDS+EER  F    I  RY  +  + +    E +P
Sbjct: 242  NLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIP 301

Query: 303  TGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDET 362
            TGI+C+NT+ K+ K PLTRK++ND I+ ++S+NPIL  H NPEWL+ KY F      D  
Sbjct: 302  TGIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVE 361

Query: 363  TGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKS 422
            TG E  EYEPPDL  YV   + R +RE   R+CL+LIF+GK ++ L     +   + SKS
Sbjct: 362  TGDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINLL--SKEELEKSSKS 419

Query: 423  YRAFXXXXXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDI 482
             R F            ++LL   +   L    N S+    + ++HFINLS S +Y++RDI
Sbjct: 420  LRTFNLLQTSFSTSF-FKLLIQERGVGLP-IENQSN---YNIDYHFINLSVSYHYSERDI 474

Query: 483  IKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDP 542
            I+ +E +  +DP NIG Y+D+L +IAN KGSYQLIAYC K D+VGQE++  A+K FN+D 
Sbjct: 475  IQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDL 534

Query: 543  NVVNLEXXXXXXXXXXY----KNESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPY 598
            +V  L           Y    KN+S+ +    VNL+NA+++ A  + S +LKF+VD+EPY
Sbjct: 535  SVTALSSLEDSVIMSIYQAELKNKSLSQER-HVNLRNALQVLASYKKSKKLKFFVDYEPY 593

Query: 599  RNVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLL 658
             N   AY  LEID S+DDDIIQTAYSIK  DAPGLK+DCDRALYTIAI RRS+ LFNFLL
Sbjct: 594  LNTRTAYNMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISLFNFLL 653

Query: 659  ENCSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCA 718
            EN   FQ YY    + Y  AL +LQVNENA+DE IL+ FQ KWF E +   D  L  K A
Sbjct: 654  ENNLIFQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHLLKLKAA 713

Query: 719  LMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLRE 778
            L K+  +RNSKLI+NFL  GVIDPSCLP ENWPTG+NNIGNTCYLNSLLQYYF+ISPLR+
Sbjct: 714  LTKIAFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRD 773

Query: 779  YVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCV 838
             ++ Y+KT +D  +  +     RR+GGR     EVERS+QF+YQLRDLF  MIY++ RCV
Sbjct: 774  EIINYTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCV 833

Query: 839  TPRRELAYLAFAPSNVEVEF--ENGVTD----AKEDVSHYNDDKTSDTLIKIGEGDEDLG 892
            TP++ELAYLAFAPSNVEVEF  E+G +     + E V    D K  + L+   + D ++G
Sbjct: 834  TPKKELAYLAFAPSNVEVEFDSEDGKSQRDNISTETVDVGADGKNDNLLV---DFDSNIG 890

Query: 893  EAERTEASPTEDIYMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENA 952
               R E        + D D    +  +D I +E+    N +  + ST+VAKIS DQLENA
Sbjct: 891  ANGRDEK------LLVDLD----SNISDKIKEEEVKKINTLKPVTSTRVAKISPDQLENA 940

Query: 953  LEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGE 1012
            LEMGRQQDVTECIGNVL QLES S PL ++ +D EQ+DL+K  F  + KQ IIPL     
Sbjct: 941  LEMGRQQDVTECIGNVLNQLESASIPLSLD-DDEEQNDLLKNCFLVKTKQSIIPLEKSKP 999

Query: 1013 TRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQI 1072
             R K+ERFLSLLVN+GDHP++IYDALD+YF DE L M+EYGEV++T++IT+FP+ILQ+QI
Sbjct: 1000 PRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQI 1059

Query: 1073 QRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQ 1132
            QRVYYDRE+F+PFKSIEPLPF   +YMDRY +  + E+++T+ +   MK EL  +KKRQ+
Sbjct: 1060 QRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQK 1119

Query: 1133 ELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIY 1192
            ELLSRNE+GLSRKE+  ET   L S+ L   GI    +  L + ++    +ID EL+T++
Sbjct: 1120 ELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLF 1179

Query: 1193 NQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETV 1252
            N I  +E  IS+ F++F+ + Y+LFAVFIHRGEASYGHYW YIKD+ QN IWRKYNDET+
Sbjct: 1180 NNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETI 1239

Query: 1253 SEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIEE 1294
            +EVPD EVFNF EGNTATPYFLVYVK  +  DIEPLKRI+ +
Sbjct: 1240 TEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIVSD 1281

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 1194 bits (3090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1228 (50%), Positives = 830/1228 (67%), Gaps = 40/1228 (3%)

Query: 76   DPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSF--INGPNL---SFKNGILQESMIMYS 130
            D G  LLYPD G+  FP KTS R++D+I  +L++   NG ++   +  +G+L+  ++ YS
Sbjct: 36   DNGKALLYPDAGSL-FPFKTSERLLDEIKAELAYRNSNGHDILYSALHSGVLKLPVLEYS 94

Query: 131  KERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIISK 190
            ++ + +  +  G ++DQV L+T+YEY S TCP  NK+ V  G+L++ PS +    E ++ 
Sbjct: 95   RKPVPD-PFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVS-PSIVPREPEDLAA 152

Query: 191  VPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIY 250
             PIYHLK+TVKTR  LE ++KQAG+ QYH+L   +LH  DK+DL   +  +P LLD A+Y
Sbjct: 153  APIYHLKLTVKTRMHLEHTRKQAGVCQYHMLS--ELHPSDKQDLFLAEESDPSLLDSAMY 210

Query: 251  VSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNT 310
            VSSDTN+L+ IEIF  EF S E+  +F   +I+ R+ EAC KF  LDPE VP+  +C +T
Sbjct: 211  VSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEACGKFPDLDPEKVPSQAECFST 269

Query: 311  VLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEY 370
            +LK+ K PL R++ +D ++T+S++N  L+S   P WL E++ F           +  LEY
Sbjct: 270  LLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEY 329

Query: 371  EPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFXXXX 430
            +PPDL  YV    VR LRE+Y R+CL+L+F GK  V L     D   + S++ R+F    
Sbjct: 330  QPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALM--SKDDVAQDSRA-RSFHLYQ 386

Query: 431  XXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLI 490
                    + LL +++         D  +  +D+N+HFINLS   YY+D+DIIKNYE   
Sbjct: 387  ISYSPSFFFHLLGETRGVM------DYGTQEIDKNYHFINLSACHYYSDKDIIKNYETQA 440

Query: 491  ALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLEXX 550
             LDP NIG YFDAL++IAN KGSYQLI YC KQDVVG+E ++ AL  F ID +  +L   
Sbjct: 441  RLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTV 500

Query: 551  XXXXXXXXYKNESVKEGAD-FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETLE 609
                    Y+ ES +       +LKN++RL AK + S  L+FY  +EPY N  QAY  LE
Sbjct: 501  PDDLLLGIYRKESSQASQQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLE 560

Query: 610  IDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYYN 669
            ++ SVD DIIQTAY++K  D+PGLKIDCDRA+YTIA+ RRSM LFNFL E C  F  +Y+
Sbjct: 561  VNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYS 620

Query: 670  IGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNSK 729
              +  Y++AL +LQVNENA+D+VIL+ FQ KW  E +   DQFL    AL K+G  RNS 
Sbjct: 621  ADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSL 680

Query: 730  LINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYED 789
            LIN +L  G+ID SCLP  NWPTG+NNIGNTCYLNSLLQYYF ISPLR+ ++ Y KT  +
Sbjct: 681  LINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSE 740

Query: 790  FYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAF 849
            F+ +  + ++ RRIGGREV + EVERSIQF+YQLRDLF  M++T  R VTP +ELAYLAF
Sbjct: 741  FHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAF 800

Query: 850  APSNVEVEFE----NGVTDAKEDVSHYNDDKTSDT--LIKIGEGDEDLGEAERTEASPTE 903
            APSN+EVEFE    +G     ED       +T++   L  +   ++D+   E  +  P+E
Sbjct: 801  APSNIEVEFEGTPSSGSVGEAEDEEEGAIKETTEVIDLTSVPNAEQDI---EMLDPVPSE 857

Query: 904  DIYMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQDVTE 963
               + +       +  D   K+D+  +    I  ST+VAKISSDQLENALEMGRQQDVTE
Sbjct: 858  SEMIVE-------QFVDS-PKDDKKQDAAEAIGTSTRVAKISSDQLENALEMGRQQDVTE 909

Query: 964  CIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSL 1023
            CIGNVL+QLES SEP  ++  D EQ DL+KQLF+G+++Q + PL+   + R K+ERF+SL
Sbjct: 910  CIGNVLFQLESASEPTCLD-TDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSL 968

Query: 1024 LVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFM 1083
            LVNVGDHP+D+YDALD YFK++ L +++ G+V R+VAI + P +LQ+QIQRVYYDRERFM
Sbjct: 969  LVNVGDHPKDVYDALDQYFKNDVLQLED-GDVNRSVAIKELPAVLQIQIQRVYYDRERFM 1027

Query: 1084 PFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLS 1143
            PFKSIEPLPF   IYMDRY+DT DP +L+ RE  A +K ELV LK++Q+ LL +N  G+S
Sbjct: 1028 PFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAATLKKELVTLKEKQRSLLDKNGSGMS 1087

Query: 1144 RKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETIS 1203
             K +  ET  FLQS+ L+   I    +++    +      ID+EL+++Y++I  LE+ +S
Sbjct: 1088 FKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIAFLEQKLS 1147

Query: 1204 HQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNF 1263
              F+ FK+ GYSLFAVFIHRGEASYGHYW+YIKD  +NGIWRKYNDE+V+E P+ EVFNF
Sbjct: 1148 SHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNF 1207

Query: 1264 TEGNTATPYFLVYVKEGSEKDIEPLKRI 1291
            +EGNTATPYFLVYVK G E  IEPL R+
Sbjct: 1208 SEGNTATPYFLVYVKNGQESQIEPLHRV 1235

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1176 bits (3041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/1291 (50%), Positives = 855/1291 (66%), Gaps = 65/1291 (5%)

Query: 45   KTNDDETNKSNPNSTGQGPTCD-----TPRVTTQDI-DPGNTLLYPDLGTANFPMKTSNR 98
            + NDD       +  G  P  D      P     +I D G  LLYP++GT + P+KTS+R
Sbjct: 2    RMNDDAVTGMGVHFGGDPPEADLQGEPIPSADVTNIEDDGRQLLYPNIGT-HLPLKTSDR 60

Query: 99   IIDDILCDLSFI-NGPNLSFKNGILQESMIMYSKERINNQAYLFGSMVDQVALQTKYEYN 157
            ++DDILC + F+ +G N S    IL  + + YSK+R + +    G   DQV +QTKYEY 
Sbjct: 61   LLDDILCSVGFLTSGDNKS----ILNSNTLEYSKQRPHIKGSAVGFFQDQVIIQTKYEYP 116

Query: 158  SLTCPANNKLEVQFGILMNL----PSNITNVDEIISKVPIYHLKITVKTRQLLEVSKKQA 213
            S +CP +NK+ V  GIL+       +    + E+ +++PIYH+KI+VK R +LE SKK  
Sbjct: 117  SKSCPEHNKIFVIMGILIGTDYLEKAEKKQISEV-TEIPIYHVKISVKVRSILENSKKLV 175

Query: 214  GITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIYVSSDTNRLILIEIFSTEFDSREE 273
            G+++Y+ LD   LH +D+ D  ++DP +  LLD A+Y + DTN+++LIEI+  EFD  ++
Sbjct: 176  GVSRYYKLD--QLHDYDRVDFPSYDPTDSKLLDSALYATDDTNKIVLIEIYKPEFDPEDK 233

Query: 274  RESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSS 333
              S  +  IK+R+ +A +KF  L  E  PT +D +NT+ KL K PL RK+++   +++ +
Sbjct: 234  DLSVSSVQIKNRFAQAKEKFPQLAKEESPTQLDSINTLFKLFKGPLKRKSDDAPQKSIEA 293

Query: 334  NNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEYEPPDLISYVQGYKVRSLREKYIR 393
             +P+L S+ NP  L+  + FT  Y  +   G E   Y  PDL++Y+    ++ LR+ + R
Sbjct: 294  EHPLLISNMNPSALVTHFGFT--YTNENIPGGE---YMAPDLVNYLGDPNIQKLRDTFTR 348

Query: 394  RCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFXXXXXXXXXXXXYQLLNDSKS-NFLAS 452
            +CL+LI +G  ++             SK YR               QLL D KS N    
Sbjct: 349  KCLELIAYGNIIISSLPQNITSTAEFSKKYRILRTIQPEFSLFSWLQLLGDFKSRNIELL 408

Query: 453  TRNDSDSMAL------------DQNFHFINLSTSSYYTDRDIIKNYERLIALDPPNIGTY 500
              N+     L            D + +F NLS   +Y +RDII+NYERLI LD PNIG Y
Sbjct: 409  NVNEHKGYHLQEAQKRVYYSPFDIDSNFTNLSVCLHYAERDIIQNYERLITLDEPNIGIY 468

Query: 501  FDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLEXXXXXXXXXXYK 560
            FD+LS +ANRKGSYQL++YCGKQDV+GQE +  +L  F ID   V LE          YK
Sbjct: 469  FDSLSVVANRKGSYQLLSYCGKQDVIGQEALQNSLAVFGIDYTKVTLESLDENLLLSVYK 528

Query: 561  NESVKEGAD---FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETLEIDSSVDDD 617
            +E  KE  D     +LKNA+RL AK   S  LKFYVD+EPYR + +AY+ LEID SVD+D
Sbjct: 529  HE-WKENPDNNRISDLKNALRLLAKYFTSDYLKFYVDYEPYRIIQKAYDLLEIDESVDED 587

Query: 618  IIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYYNIGRYDYRQ 677
            IIQTAY+IK  DAPGLKIDCDRALYTIA  RRS++LFNFL + C EFQ YY      Y Q
Sbjct: 588  IIQTAYTIKINDAPGLKIDCDRALYTIAYSRRSLMLFNFLFDQCPEFQRYYGAQSLGYHQ 647

Query: 678  ALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNSKLINNFLMN 737
            +  ILQ+NEN  +  +L  FQ KW N  + E DQ L Y+ AL K+ LERNS L+ NFL  
Sbjct: 648  SFEILQINENITEPNLLHVFQQKWKNTLLEEPDQLLKYRAALTKIALERNSNLLLNFLET 707

Query: 738  GVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNA 797
            G I+P+ LP ENWPTGINNIGNTCYLNSLLQ+YF+ISPLREY++ Y KT  D      + 
Sbjct: 708  GNINPNSLPAENWPTGINNIGNTCYLNSLLQFYFAISPLREYIVQYQKTIADLSSNPDSI 767

Query: 798  KTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFAPSNVEVE 857
             + RRIGGR+VG NE+ERS+QF+YQLRDL+  MI++++RCVTP+RELAYLAFAPS+++VE
Sbjct: 768  ISKRRIGGRQVGKNEIERSVQFLYQLRDLYNDMIFSSQRCVTPKRELAYLAFAPSSIDVE 827

Query: 858  FENGVTDAK-EDVSHYNDDKTSDTLIKIGEG---DEDLGEAERT--EASPTEDIYMT--- 908
            FEN  T +   ++   N    S  +   GE    + D+ + ER   E + T +I      
Sbjct: 828  FENAKTKSPISNIEGSNSTTDSQPMPSTGENIDHNMDIEQEERNNEEINSTNNIESNDLV 887

Query: 909  ----DDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQDVTEC 964
                D +ML   K  +G N E E T        + KVAKI  +QLENALE+GRQQDVTEC
Sbjct: 888  SNNHDIEMLDTDKENEG-NMEIEDT--------AIKVAKIDPEQLENALELGRQQDVTEC 938

Query: 965  IGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLL 1024
            IGNVL+QLES S       ED+EQ+DL+K+LF+GE  Q I PL     TR K+ERF+SLL
Sbjct: 939  IGNVLFQLESSSS-PTSLSEDHEQNDLIKELFFGETNQHIKPLKADSVTRTKVERFVSLL 997

Query: 1025 VNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMP 1084
            VN+ DHP+D+YDALD+YFK+E+LTM+EYGEVKR +AI KFPTILQ+QIQRVYYDRERFMP
Sbjct: 998  VNIADHPKDVYDALDLYFKEEYLTMEEYGEVKRELAIKKFPTILQIQIQRVYYDRERFMP 1057

Query: 1085 FKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLSR 1144
            +KSIEPLPF + IY+DRY DT D ++L+ RE TA++K +L   K+RQ+ELLSRNE+GLSR
Sbjct: 1058 YKSIEPLPFESDIYLDRYADTDDVKLLQKREETAELKRQLRSFKERQKELLSRNELGLSR 1117

Query: 1145 KEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETISH 1204
            ++AY ET NFL+S  LQ   I     D L+T L+++ + + DELS +Y +IT LEE I+H
Sbjct: 1118 RDAYKETANFLRSEVLQNTNISISDPDLLATKLEESASKVADELSDLYVKITNLEEKINH 1177

Query: 1205 QFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT 1264
            QF+ F + GY+LFAVFIHRGEASYGHYWVYIKD+  N IWRKYNDETV+EVP+EEV NFT
Sbjct: 1178 QFDDFTEHGYTLFAVFIHRGEASYGHYWVYIKDF-VNSIWRKYNDETVTEVPEEEVMNFT 1236

Query: 1265 EGNTATPYFLVYVKEGSEKDIEPLKRIIEES 1295
            EGNTATPYF+V+VK+G EKDIEPLKR+IE++
Sbjct: 1237 EGNTATPYFIVFVKKGHEKDIEPLKRMIEKN 1267

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 1136 bits (2938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/1224 (48%), Positives = 804/1224 (65%), Gaps = 47/1224 (3%)

Query: 75   IDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSFKNGILQESMIMYSKERI 134
            +D G TLLY D+ + +FP KT +RI+DDI     F+      F + ++++ M+ YS+ER 
Sbjct: 38   VDDGKTLLYGDI-SKSFPFKTCDRILDDIRISPWFLK----KFGSSVMKQPMLQYSRERQ 92

Query: 135  NNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIISKVP-- 192
              Q +    ++DQV L+++Y+Y+S+TCP  N + V F +L++ P+   N  + I K P  
Sbjct: 93   QLQPWNLVHLIDQVNLRSRYDYDSMTCPGKNTISVMFALLVD-PNFTPNDFDDIDKFPEY 151

Query: 193  IYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIYVS 252
             +HLKITVK R  LE   +  GIT YH+L+ E LH FDKRD+   +  +  L+D +I+VS
Sbjct: 152  FFHLKITVKRRSYLENFNRHVGITHYHVLEPESLHPFDKRDIFIMEEKDCRLVDQSIFVS 211

Query: 253  SDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNTVL 312
            +DTN+LIL+EI   EF+S E    ++TA I+ RY+ AC++FD L+P+ +P+  +CL T+ 
Sbjct: 212  ADTNKLILVEIIKPEFNS-ENLAEYRTAKIEERYKNACQEFDLLNPDDIPSQAECLKTLF 270

Query: 313  KLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEYEP 372
             + K PL RK+ N + + +S ++  L+S  N +WL   ++F+      E   Q   EY+P
Sbjct: 271  MIFKNPLQRKSANSEFKIISRDSVALNSQINTDWLTTMFDFSLQKTAVEDNVQSGEEYKP 330

Query: 373  PDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFXXXXXX 432
            PDL+ Y+  +KVR +RE Y R+ ++++  GK   Q  + +++         + F      
Sbjct: 331  PDLVDYITDFKVRGIREAYTRKSMEVVLIGK---QSMLLENELGTEKKTVAKCFSNQHFS 387

Query: 433  XXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLIAL 492
                  + +LN              +    D N+HFINLS +  Y D+DIIKNYE  IAL
Sbjct: 388  ASHTWWFNILN----------HQHIEPFPYDINYHFINLSVAFKYIDKDIIKNYETQIAL 437

Query: 493  DPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLEXXXX 552
            D  NI  YFDAL Y+ N KGSYQLIAYCGKQDVVG E++N AL+ F +DP  ++      
Sbjct: 438  DQENISHYFDALQYVTNAKGSYQLIAYCGKQDVVGYEDLNNALQVFGLDPTDIDASLLDA 497

Query: 553  XXXXXXYKNESVKEGAD-FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETLEID 611
                  Y +  ++   +   +L+NA+R+  K   S ++ F V++EPY NV QAY  L++D
Sbjct: 498  NTMIEYYNSHLLRSSDNQRKDLRNALRVLGKYLGSQKMLFLVEYEPYYNVQQAYTLLKVD 557

Query: 612  SSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYYNIG 671
             +VDDDIIQTAY+I   DAPGLK D DRA++TIA+ RRS+ L N L + C EF  YYN  
Sbjct: 558  ETVDDDIIQTAYTINIADAPGLKKDYDRAIFTIALDRRSIFLLNVLTDECPEFAQYYNCT 617

Query: 672  RYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNSKLI 731
               Y +AL I++++ NA+D+VIL+ FQ KW +  +   D  L  K AL  +G  RNSKLI
Sbjct: 618  DISYDEALNIIEIDMNASDDVILEVFQKKWSHGIMTGPDYLLKLKMALQNIGFTRNSKLI 677

Query: 732  NNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFY 791
            N+FL  G++D SCLPV  WP GINN+GNTCYLNSLLQ++F+I PLR+++L Y        
Sbjct: 678  NHFLDTGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILNYDDDSAKLL 737

Query: 792  DAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFAP 851
            DA     + RRIGGREV   E  RS+QF+Y LRDLF  MI+TN RCVTP +EL YLAFAP
Sbjct: 738  DASE-YHSRRRIGGREVSKQEELRSVQFVYHLRDLFNDMIHTNSRCVTPTKELVYLAFAP 796

Query: 852  SNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEASPTEDIYMTDDD 911
            SNVEVEF +     KE +     D T+D +       ED  +  R  AS  +DI M    
Sbjct: 797  SNVEVEFGDDTVAQKELI-----DLTTDVV-------EDPTDTTRHLASCDDDIIM---- 840

Query: 912  MLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQDVTECIGNVLYQ 971
                 ++   + +   S+E G     S +VAKIS+DQLEN LE+GRQQDVTECIGNVL Q
Sbjct: 841  ----CQSPVALPEHKTSSEAGTQQY-SVQVAKISADQLENTLEIGRQQDVTECIGNVLAQ 895

Query: 972  LESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVNVGDHP 1031
            LE  SEPL +  +D EQ+DLVKQLFYG IKQD+IP++     R K ERFLSLLVN GDHP
Sbjct: 896  LEIASEPLSLE-DDLEQNDLVKQLFYGRIKQDLIPVNDEASVRTKYERFLSLLVNTGDHP 954

Query: 1032 RDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMPFKSIEPL 1091
            +DIYDALD YF++++L ++EYG+VKRTV+I++ P +LQ+QIQRVYYDRE+FMPFKSIEPL
Sbjct: 955  KDIYDALDFYFQNDYLNLEEYGDVKRTVSISELPAVLQIQIQRVYYDREKFMPFKSIEPL 1014

Query: 1092 PFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLSRKEAYSET 1151
            PF   +YMDRY+ T DP++L   ++ A++K +L  LK+RQ++LLS+NE+GL+ K +  ET
Sbjct: 1015 PFGETLYMDRYMATEDPKLLAEIQQNAELKQKLQDLKQRQRKLLSQNEIGLTLKSSLIET 1074

Query: 1152 VNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETISHQFEQFKK 1211
              FLQS  L+   I  +        +     +ID+EL +++N+IT LE TIS QF +FK 
Sbjct: 1075 KKFLQSGTLKAHDIDADNIPSSIAYIDILINNIDEELKSLFNKITDLETTISQQFSEFKH 1134

Query: 1212 VGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATP 1271
            +GYSLFAVFIHRGEASYGHYWVYIKD+ +NGIWRKYND++V+EVP  EVFNFTEGNTATP
Sbjct: 1135 IGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNTATP 1194

Query: 1272 YFLVYVKEGSEKD-IEPLKRIIEE 1294
            YFLVYV+EG E++ IEPLKRI+++
Sbjct: 1195 YFLVYVREGQEQETIEPLKRILQQ 1218

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1108 bits (2866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/1237 (48%), Positives = 817/1237 (66%), Gaps = 48/1237 (3%)

Query: 78   GNTLLYPDLGTANFPMKTSNRIIDDILCDLSFI-NGPNLSFKNGILQESMIMYSKERINN 136
            G T+LYP L + N+P KTS+R++DDI   LSF+  G      NG+L+  M+ YSKER   
Sbjct: 30   GKTVLYP-LVSGNYPFKTSDRLLDDIRSTLSFVLEGVR---GNGVLKSPMLDYSKERGEL 85

Query: 137  QAYLFGSMVDQVALQTKYEYNSLTCPA------NNKLEVQFGILMNLPSNITNVDEIISK 190
            +A+  G ++DQV LQT YEY SL          ++K+ V  G+L +    + + D+I++ 
Sbjct: 86   RAWSIGYLLDQVLLQTSYEYASLGGSGGGGGDKHSKINVFMGLLCDPMVKLCSEDDIVN- 144

Query: 191  VPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIY 250
               YHL++TVKTR  LE +K+Q GI QYHL++  DLH  DK+DL  F+ D+  ++D A Y
Sbjct: 145  YSGYHLRVTVKTRLHLERAKRQFGIAQYHLVN--DLHPADKQDLCFFEDDDECVIDSATY 202

Query: 251  VSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNT 310
            VSS TNRL+ IEI   EF + EE   F   +I+ RY   C+K+  L+ E VP   +CLNT
Sbjct: 203  VSSGTNRLVRIEILKPEF-TAEEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAECLNT 261

Query: 311  VLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEY 370
            + K+ K PL+R++++D+++T+S+ N +L+S  +P WL++K+ F +     E  G++  EY
Sbjct: 262  LFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGF-ELCEVQEEDGRKEYEY 320

Query: 371  EPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFXXXX 430
            +PPD  +YV  + VR LRE+YIR+ L+L+F GK  ++L   +    +  S   R+F    
Sbjct: 321  KPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLPKE---VVAASSKLRSFQLYQ 377

Query: 431  XXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLI 490
                    +QLL +   N      N       D N HFINLS + YY DRDII+NYE  I
Sbjct: 378  THFSHTFWFQLLGEFDRNDF----NQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQI 433

Query: 491  ALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLEXX 550
             LDP N G Y+D L++IAN KGS+QL+ +  KQ++VGQE +N AL+ F+IDP+  + +  
Sbjct: 434  LLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQI 493

Query: 551  XXXXXXXXYKNE----SVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYE 606
                    YK E    + ++ AD   L+NA+RL AK + S +LKFYV+ EP++  +QAY 
Sbjct: 494  PDEMLLSCYKEECKYGNTRQHAD---LRNALRLLAKYKQSEKLKFYVELEPFQQESQAYS 550

Query: 607  TLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQA 666
             LEID SVD DII+TAY+IK  DAPGLK+DCDRALYT+AI +RSM LFN+LL+ C  FQ 
Sbjct: 551  ILEIDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQ 610

Query: 667  YYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLER 726
            +Y+I  + Y  AL  LQVN NA D++IL+ F+ KW  E +   DQFLN K ALMK+  ER
Sbjct: 611  FYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHER 670

Query: 727  NSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKT 786
            NSKLIN+FL  G+ID + L   NWPTG+NNIGNTCYLNSLLQYYF+ISPLR+Y+  Y  T
Sbjct: 671  NSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDT 730

Query: 787  YEDFY--DAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRREL 844
              D      +  A T RRIGGR V   EVERS+QF+YQLRDLF  M ++ +RCVTP REL
Sbjct: 731  ASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSREL 790

Query: 845  AYLAFAPSNVEVEFENGVTDAKEDVSHY-------NDDKTSDTLIKIGEGDEDLGEAERT 897
            AYL+F+PS   VEFE+       D +          D +  D  I   EG     EA   
Sbjct: 791  AYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPNEDTEVFDISI---EGSNVETEAAAE 847

Query: 898  EASPTEDIYMTDDDMLGAAKATDGINKEDESTENGI---DILPSTKVAKISSDQLENALE 954
            +    ++I   D+    +   +   +++  S  N +   + + ST VAKIS DQLEN LE
Sbjct: 848  DIIADDNIDTKDESSSLSPSTSTSSSQKGNSMSNIVEENEPITSTCVAKISPDQLENTLE 907

Query: 955  MGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETR 1014
            +GRQQDVTECIGNVLYQ+ES S PL  + E +EQ DLVKQLFYG++KQD+IP+    + R
Sbjct: 908  IGRQQDVTECIGNVLYQIESASVPLNFD-EGHEQYDLVKQLFYGKLKQDLIPIENPEKRR 966

Query: 1015 PKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTM-DEYGEVKRTVAITKFPTILQVQIQ 1073
             K ERF+SLLVNVGDHP+DIYDALD+YF+D+ L + D+   V+R+VA+ + PTILQ+QIQ
Sbjct: 967  TKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTILQIQIQ 1026

Query: 1074 RVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQE 1133
            RVYYDRE+ MPFKS EPLPF  K+YMDRY+ + + E+L  ++ + ++   L  +K+R+++
Sbjct: 1027 RVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIKQRRKK 1086

Query: 1134 LLSRNEVGLSRKEAYSETVNFLQSNAL-QLQGIVFEGQDELSTILKKAGTDIDDELSTIY 1192
            +LS+N+ GL+ K++  ET  FL+S+ L + +G +   +  L   L     +ID ELS + 
Sbjct: 1087 ILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKELSNLD 1146

Query: 1193 NQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETV 1252
            ++I  +E +ISH+F+QF   GY+LFAVFIHRGEASYGHYWVYIKD   +GIWRKYNDE+V
Sbjct: 1147 DKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESV 1206

Query: 1253 SEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLK 1289
            +EVP+ EVF+FTE NTATPYFLVY+K+G E +IEPLK
Sbjct: 1207 TEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1240 (38%), Positives = 692/1240 (55%), Gaps = 140/1240 (11%)

Query: 90   NFPMKTSNRIIDDILCDLSFINGP-----NLSFKNGILQESMIMYSKERINNQAYLFGSM 144
            N   KTS+RIIDDIL DLSFIN        L    GIL+     YSK R +   Y   ++
Sbjct: 103  NAVFKTSDRIIDDILIDLSFINSSADEIKELGLNKGILRLPTTDYSKFRSSFSEYKIINL 162

Query: 145  VDQVAL-QTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVD-----EIISKVPIYHLKI 198
             ++  L   ++EY S T   +NK+ ++F  +++ P + +N+D     +  S+   YHLK+
Sbjct: 163  SNKNNLINYRFEYESKTNHQDNKI-LEFFSILHKPKDASNLDYESMAKFWSQNEFYHLKV 221

Query: 199  TVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIYVSSDTNRL 258
            ++KTR  LE+SKK   I  ++++D  + +  DK D + F+PDNP+LLDYAI++SS+TN++
Sbjct: 222  SIKTRNQLELSKKHTPIQHFYVID--EFNEEDKLDFINFNPDNPNLLDYAIFISSNTNKV 279

Query: 259  ILIEIFSTEFDSREER---ESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNTVLKLL 315
            +L+EIF +EF+  ++    +  Q      +Y+ +  K        +PT  D    VL +L
Sbjct: 280  VLVEIFKSEFNLNDKLIILDDLQVLNNYEKYKNSNHKL------KLPTQTD----VLLVL 329

Query: 316  KQPLTRKNNNDKIRTVS-----SNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEY 370
                 ++ N D I +        ++  +    NP WL E+++               L++
Sbjct: 330  MYCFNKQQNFDNIHSSEDEIKLKDSKAIKISLNPSWLTERFS---------------LKF 374

Query: 371  EPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRV-DQSDPAL------RGSKSY 423
            +  + + ++      +L +K  RR      + +CL++L V  +S P        + +   
Sbjct: 375  QEDESLIFMNLRNNLNLIKKEKRR---FDVFTRCLLELFVLIKSAPQKLVKCNSKDTNII 431

Query: 424  RAFXXXXXXXXXXXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDII 483
            +               Q+L + KS    +  N     A      FINLS    YT+ +I+
Sbjct: 432  KVVDTISINSSLSFWSQILGEYKSILSQNNFNQYSKHA-----EFINLSILPTYTESEIV 486

Query: 484  KNYERLIALDPPNIGTYFDALSYIANRKGSYQLIA-YCGKQDVVGQENINMALKCFNIDP 542
            KNYE L  L+P  IG YFD+L +++     Y+ +A Y  K +++G E  N +LK F +D 
Sbjct: 487  KNYEILTILNPDKIGVYFDSLKFVSQCLTQYENLADYVNKNEIIGNEEFNQSLKIFKMDK 546

Query: 543  NVVNLEXXXXXXXXXXYKNESVKEGADF----VNLKNAMRLFAKIRNSPQLKFYVDHEPY 598
                LE           K  +  E  +F      L+N+++  + ++NSP LKF   +EPY
Sbjct: 547  ----LEFTNCSDSVLWEKYLTYYEDKNFDYNHAILRNSIKSLSIVKNSPILKFLCKYEPY 602

Query: 599  RNVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLL 658
            +N + A+ TL I  SVD D I  +Y+ K  D    K   D+AL TIAI R+ + LF+ L 
Sbjct: 603  KNPDNAFVTLNIHESVDSDTIIVSYTTKINDMKDKKQHLDKALLTIAIDRKDLSLFHTLY 662

Query: 659  ENCSEFQAYYNIGRYDYRQALGILQVNE-NANDEVILKNFQTKWFNEQIH------EADQ 711
            ENC +F   Y+    +Y+ AL  +  +E N+++E+IL +F+ +W+   ++      +   
Sbjct: 663  ENCKDFVNLYHSMNIEYKTALQAIDSSELNSDNELIL-SFKKRWYRIDVNNDTFGDDTVN 721

Query: 712  FLNYKCALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYF 771
             L  +  +M +   RNS L+NN++  G+++P  LP ++WP G+NNIGNTCYLNSLLQYYF
Sbjct: 722  LLTLRKVMMVISSNRNSLLLNNYIEYGIVNPKFLPSKSWPVGLNNIGNTCYLNSLLQYYF 781

Query: 772  SISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMI 831
            +ISPLREY++ ++    D  + K   K  RR+GGR +   E  RSIQF+YQLRDL+  M+
Sbjct: 782  AISPLREYLINFNDIELDGREMKNLEK--RRVGGRNLSIAEFHRSIQFVYQLRDLYGEMV 839

Query: 832  YTNKRCVTPRRELAYLAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDL 891
            +++ R V+PR +LAYLAFAPS+  +EF +G+ +A     +Y+D          G     +
Sbjct: 840  HSSSRKVSPRLQLAYLAFAPSDTPIEFRDGIQNAIGKNDYYSDKTNG------GSESSSI 893

Query: 892  GEAERTEASPTEDIYMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLEN 951
                    S ++     D D   +    D +     ST N    LP T + KISS QLE 
Sbjct: 894  KGLNSNLNSDSDADSSLDSDSESSLLTFDNLPIIKTSTTN----LP-TLIPKISSSQLET 948

Query: 952  ALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVG 1011
             LEMG QQDVTECI NVL+Q+E+ S P+ I+ EDNEQ DLVKQLF+G+ +Q I P + V 
Sbjct: 949  TLEMGSQQDVTECIENVLFQIEAASNPISID-EDNEQVDLVKQLFFGKTEQKIKPFNEVS 1007

Query: 1012 ETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQ 1071
            +  PK ERFLSLLV+V D PRDIYDALD YFKDE   M+EYG+VK+++ I+ FPTILQVQ
Sbjct: 1008 KVHPKRERFLSLLVSVSDKPRDIYDALDTYFKDEVFDMEEYGKVKKSLTISSFPTILQVQ 1067

Query: 1072 IQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQ 1131
            IQRVYYD E+ +PFK +EPL FS  +Y+DRY +  D       E+ A+ K E+  LKKR 
Sbjct: 1068 IQRVYYDIEKGVPFKDLEPLRFSESLYLDRYANDID-------EKLAEKKIEVASLKKR- 1119

Query: 1132 QELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDD-ELST 1190
                                          L+G++        TI K+     D+ E+ T
Sbjct: 1120 ------------------------------LKGLI--------TIKKELEKKNDNVEIRT 1141

Query: 1191 IYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDE 1250
            I  +I  +E  I   F +F K GYSLFAVFIHRG+A++GHYW+YIKD+  +G WRKYND 
Sbjct: 1142 ISKEINDVETKIDTAFSEFHKHGYSLFAVFIHRGQATFGHYWIYIKDFKNHGTWRKYNDH 1201

Query: 1251 TVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKR 1290
             V+E+   EVFNF+EGN++TPYFLVY+K GSE D+EPLKR
Sbjct: 1202 EVTEILPIEVFNFSEGNSSTPYFLVYIKNGSEFDVEPLKR 1241

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/787 (44%), Positives = 498/787 (63%), Gaps = 24/787 (3%)

Query: 76  DPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSFKNGILQESMIMYSKERIN 135
           D G T+LY +L     P+KTS+R++DD+   +S            +L+  M+ Y+++R N
Sbjct: 21  DDGRTVLYGNLARQG-PVKTSDRLLDDVRVTVSLSEE-----GREVLRAPMLEYARQRAN 74

Query: 136 NQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIISKVPIYH 195
            + +  G ++DQV LQT +EY S TC A N++ V  G+L +      + DE+++   IYH
Sbjct: 75  ARTWSVGYLLDQVVLQTSFEYTSRTC-AQNRVHVFMGVLCDPGQRFASQDELVN-YRIYH 132

Query: 196 LKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIYVSSDT 255
           L++TVK R  LE +++  G+ QYHL+D  +LH +DK D   F+  +P ++D A YV+S T
Sbjct: 133 LRVTVKIRPQLERARQHYGVAQYHLVD--ELHPWDKPDFCLFEDGDPAVVDSATYVASGT 190

Query: 256 NRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNTVLKLL 315
           NRL+ IE+   EF   E +E F    I++RY E CK+   LDP  +P+  +CLNT+ K+ 
Sbjct: 191 NRLVRIEVLRPEFGPDELQE-FTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFKVF 249

Query: 316 KQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEYEPPDL 375
           K PL+R+   D+++T+S++N +L+S     WL+ K+ F       E  GQ++ EY+PPD 
Sbjct: 250 KNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGF--ELCEIEEDGQKIYEYKPPDF 307

Query: 376 ISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFXXXXXXXXX 435
             +V+ ++VR  RE YIR+ L+LIF GK    LR+   D  +  SK  R+F         
Sbjct: 308 TEHVENWEVRRFRESYIRKSLELIFLGK--QSLRLVPKDVVVSNSK-LRSFQLYQTHFSH 364

Query: 436 XXXYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLIALDPP 495
              Y L+ +   N       +      D N+HF++LS++ YY+DRDIIKNYE  IALDP 
Sbjct: 365 SFWYHLMGEYDHNDF-----NQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPA 419

Query: 496 NIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLEXXXXXXX 555
           N   Y+D LS++AN KGS QL+ Y  KQ+VVG E +  AL+ F++DP+  +         
Sbjct: 420 NASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFL 479

Query: 556 XXXYKNESVKEGAD-FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETLEIDSSV 614
              YK      G     +L+NA+RL A+ + S +LKFYV+ EP+ N  QAY+ LEID SV
Sbjct: 480 LESYKEVCKDSGPQKHADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLLEIDESV 539

Query: 615 DDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYYNIGRYD 674
           D DII+TAYSIK  DAPGLK+DC RALYT+A+ +RS+ILFN L + C +F  +Y++    
Sbjct: 540 DIDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLS 599

Query: 675 YRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNSKLINNF 734
           Y+ AL  L VN NA D++IL+ FQ KW  + +   +Q LN K AL K+G ERNSKLIN+F
Sbjct: 600 YQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHF 659

Query: 735 LMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAK 794
           L  G++D + LP  NWPTGINNIGNTCYLNSLLQYYF+ISPLREY+L Y  T  +  +  
Sbjct: 660 LETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTASNLLNNA 719

Query: 795 RNAKTI--RRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFAPS 852
            ++  +  RRIGGR +   EVERS+QF+YQLR LF+ M+++ +R VTP REL YL+F+PS
Sbjct: 720 VSSSDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPS 779

Query: 853 NVEVEFE 859
           + EVEFE
Sbjct: 780 STEVEFE 786

 Score =  398 bits (1022), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 227/451 (50%), Positives = 303/451 (67%), Gaps = 23/451 (5%)

Query: 848  AFAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEASPTEDIYM 907
            A +P +  V ++     A    +  N   T ++ +      +    AE T A P ED   
Sbjct: 955  AASPDDFSVRYQASSDTANTGSTRPNPSSTPESGLS-----DSAANAEYTSAGPLEDRQA 1009

Query: 908  TDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQDVTECIGN 967
             ++D  G      G + E E  E       ST VAKISSDQLEN LE+GRQQDVTECIGN
Sbjct: 1010 VENDDSGKDITMVG-SPEAEGPET------STYVAKISSDQLENTLEIGRQQDVTECIGN 1062

Query: 968  VLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVNV 1027
            VLYQ+ES S PL ++ E+ EQ DLVKQLFYG++KQ++IPL      R K+ERF+SLLVN+
Sbjct: 1063 VLYQIESASVPLSLD-EEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNI 1121

Query: 1028 GDHPRDIYDALDMYFKDEFLTMDEY-GEVKRTVAITKFPTILQVQIQRVYYDRERFMPFK 1086
            GDHP+DIYDALD YFKD+ LT+DE  G+V+R+VA+ + P +LQ+QIQRVYYDRE+FMPFK
Sbjct: 1122 GDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFK 1181

Query: 1087 SIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLSRKE 1146
            S EPLPF  K+YMDRY+ T + E+   +++   ++ EL +L++R++ LL++N+ G++   
Sbjct: 1182 STEPLPFGEKLYMDRYLATDNAELNAKKQQAIGLREELERLRERRRRLLAKNDHGVTLSA 1241

Query: 1147 AYSETVNFLQSNAL-----QLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEET 1201
            A ++T  FL +  L     QLQ    E     ++ L      +D+EL+ +   I  +++ 
Sbjct: 1242 ALADTRRFLDAAELTSGSRQLQ----EQYHATTSHLDALRVALDEELAALDAHIASVQDA 1297

Query: 1202 ISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            I+H+F+ F   GYSL AVFIHRGEASYGHYWVYIKD    GIWRKYNDE+V+EVP+ EVF
Sbjct: 1298 IAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357

Query: 1262 NFTEGNTATPYFLVYVKEGSEKDIEPLKRII 1292
            +F+E NTATPYFLVYVKE  E DIEPLKR++
Sbjct: 1358 DFSEENTATPYFLVYVKEAHELDIEPLKRLL 1388

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1284 (33%), Positives = 665/1284 (51%), Gaps = 142/1284 (11%)

Query: 45   KTNDDETNKSNPNSTGQGPTCDTPRVTTQDIDPGNTLLYPDLGTANFPMKTSNRIIDDIL 104
            K +  + +K NPN+            T+  ID G  LLY ++       KTS RI+DDIL
Sbjct: 40   KKHHHDADKINPNTANSSAQNVEKNDTS--IDDGMHLLYQNIEKEGV-FKTSQRILDDIL 96

Query: 105  CDLSFIN-----GPNLSFKNGILQESMIMYSKERINNQAY---LFGSMVDQVALQTKYEY 156
             D++F++       ++ FK+G+L    I YS  R   + +   LF +  +   +  K ++
Sbjct: 97   TDIAFMSLDSEKSDDIDFKDGVLNLPTIKYSLWRKYIKPFKIILFNT--NNPVVDVKLQH 154

Query: 157  NSLTCPANNKLEVQFGILM-NLP--SNITNVDEIISKVPIYHLKITVKTRQLLEVSKKQA 213
             S+T P NN +   +G+L+  +P  S +   DE I   P+Y ++ITVKTR  LE  KK  
Sbjct: 155  KSVTSPKNNTITELYGLLVPKIPRRSELNTFDEYIRSKPLYSIRITVKTRHRLEHKKKHI 214

Query: 214  GITQYHLLD-FEDLHHFDKRDLMTFDPDNPDLLDYAIYVSSDTNRLILIEIFSTEFDSRE 272
             +T Y LLD F+ LH  DK D   F+ D+ DLLD++IY+SSDTN++ILIEIF   F+  E
Sbjct: 215  ALTPYFLLDDFDKLHEVDKSDFPKFNKDSKDLLDFSIYISSDTNKIILIEIFKPAFNQTE 274

Query: 273  ERESFQTATIKSRYQEACKKFDTLDPE----AVPTGIDCLNTVLKLLKQPLT----RKNN 324
                  +A++ +R  E     + L P+     V   ID +  +L  + Q L     R+  
Sbjct: 275  LDYLLSSASVLNRSNELDNLHEELQPDYNDAIVEEQIDTIEILLHCIMQNLKGSPERELE 334

Query: 325  NDKIRTVSSNNPILHSHFNPEWLLEKYNFT------KHYATDETTGQEVLEYEPPDLISY 378
              K   + S++  L ++ + +WL E ++        K + +        L ++ P+    
Sbjct: 335  KQKTSFLLSDDVKLGTYVDIKWLEENFDIKVKEQKRKDHVSITLDEALKLSFDDPNP--- 391

Query: 379  VQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFXXXXXXXXXXXX 438
                K ++  +K  R  ++L++ GK L     ++ +       +   F            
Sbjct: 392  ----KNQAKFDKITRYAMELMYLGKVLQSFYSNEEEIEEYMEDT--IFKQVKVHHTTSFW 445

Query: 439  YQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLIALDPPNIG 498
             Q+LN+ +S F   +   + +  +D+  HFINL   S  +++DII NYE  +  DP N  
Sbjct: 446  TQILNEYQSIF---SSQKTSTRCVDE--HFINLCIDSNVSEKDIITNYEIQLRTDPDNDS 500

Query: 499  TYFDALSYIANRKGSYQLI-AYCGKQDVVGQENINMALKCFNIDPNVVN-LEXXXXXXXX 556
             YF++L Y++ +   Y ++  YC +  ++ +     AL+ F       N +E        
Sbjct: 501  KYFESLKYVSRKFPDYIVLEKYCKENVIISKAAYLHALEIFKYSEEYFNAIEHVSEIWDK 560

Query: 557  XXYKNESVKEGAD--FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETLEIDSSV 614
                 +S     D   V+L ++    A ++ S  L +   +EP+ +   AY  L +D+ +
Sbjct: 561  YTELVQSNNNNDDQYRVDLVDSFYSLATVKKSSPLIYITKYEPFFHPVTAYLKLNVDAKL 620

Query: 615  DDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYYNIGRYD 674
            D + I  AY+++  + P  KI  DRAL+ IAIQR  + L   L +NCS F    +     
Sbjct: 621  DSENIVLAYTMQIREVPEHKIQFDRALFAIAIQRHDLSLLYVLKQNCSAFNECISNIILT 680

Query: 675  YRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNSKLINNF 734
               A  I+ + + +++  I+  F   W          F+    AL ++   R S L+ +F
Sbjct: 681  SDDAFEIIGMPKTSSELSIINTFTKYWKETDDSNPVNFILASAALREVSKHRASALLRHF 740

Query: 735  LMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAK 794
               G ++P  +  E WPTGINNIGNTCYLNSLLQYYFSI+  RE++  Y     D  ++ 
Sbjct: 741  YEFGKVNPKMIDSELWPTGINNIGNTCYLNSLLQYYFSITLFREFIENYQSIESDLLNS- 799

Query: 795  RNAK-TIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFAPSN 853
             NA+ + RR+GGRE+ +NE+ RS+QFIYQ++DLF  M++T  R VTP  +LAYLAFAP+N
Sbjct: 800  -NAEMSKRRVGGREIQNNEINRSVQFIYQVQDLFKLMVHTKSRKVTPSNQLAYLAFAPNN 858

Query: 854  VEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEASPTEDIYMTDDDML 913
             E++F++                                   ++E   +E+  +T    +
Sbjct: 859  AEIKFKH-----------------------------------KSELESSEEHQLTTSHSI 883

Query: 914  GAAKATDGINKEDESTENGIDILPSTK-----VAKISSDQLENALEMGRQQDVTECIGNV 968
              + AT  I+  D  T++    L ST      VA ++ D LE  LE+G QQDVTECI  V
Sbjct: 884  ALSSAT-SISHSDIDTQDHDISLNSTSYSNRLVAMVTRDDLETTLEIGNQQDVTECINTV 942

Query: 969  LYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVNVG 1028
            LYQ+E+GS PL ++  DNEQ DLVK+LFYGE  Q+I P+    +   K E + SLLVN+ 
Sbjct: 943  LYQVETGSMPLYLDA-DNEQMDLVKELFYGETIQEICPIKKFIKGHEKRELYSSLLVNIL 1001

Query: 1029 DHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMPFKSI 1088
            D P D+Y+ LD YF DE+++M+EYGEVK+T++ITK PTIL +QIQRVYYD+E+ +P+K  
Sbjct: 1002 DSPTDLYEVLDEYFADEYMSMEEYGEVKKTLSITKLPTILNIQIQRVYYDKEKLVPYKCG 1061

Query: 1089 EPLPFSAKIYMDRYV--DTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLSRKE 1146
              LPF  +I++DRY+  +  + ++LE     A+++ +L ++K R                
Sbjct: 1062 TALPFKNEIFLDRYIKGNKKENDVLE----KARLELKLAKVKYR---------------- 1101

Query: 1147 AYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETISHQF 1206
                                     EL +        I D + T Y++I +L   I  + 
Sbjct: 1102 -------------------------ELVSEYNSVNKSISDRIITTYDRIEELNAVIEEEV 1136

Query: 1207 EQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEG 1266
             +  K+ YSLFAVFIHRG+AS+GHYWVYI+D+ +NGIWRKYND  V+   ++E+F   +G
Sbjct: 1137 TKDAKIRYSLFAVFIHRGQASFGHYWVYIRDF-ENGIWRKYNDHQVTGAHEDEIFKCVDG 1195

Query: 1267 NTATPYFLVYVKEGSEKDIEPLKR 1290
            + +TPYFL YV    +  ++PL R
Sbjct: 1196 DISTPYFLAYVDSSKKSIVKPLVR 1219

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 26/36 (72%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKT 786
           P G+ N+GNTCYLN+ LQ  F I PLRE +L Y ++
Sbjct: 108 PIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQS 143

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPY 1272
            Y+L  +  H+G  S  GHY  +I+D     IW K+ND+ V+ V  E++     G  +   
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKIETLAGGGESDSA 493

Query: 1273 FLVYVK 1278
             ++  K
Sbjct: 494  LILLYK 499

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 740 IDPSCL--PVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDF 790
           +DPS     + + P G+ N+GNTCY+N+ LQ  + I+PLRE +L + K   +F
Sbjct: 90  LDPSVQMQKLSSTPIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNF 142

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTA-TP 1271
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ VS +  E++ +   G  + + 
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVSVIEKEKIESLAGGGESDSA 482

Query: 1272 YFLVY 1276
              LVY
Sbjct: 483  LILVY 487

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 39/90 (43%), Gaps = 25/90 (27%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGD 810
           P G+ N+GNTCY N+ LQ  + I PLRE VL Y++   D +                   
Sbjct: 105 PMGLRNMGNTCYFNASLQALYRIKPLREKVLAYNEPNPDLHG------------------ 146

Query: 811 NEVERSIQFIYQLRDLFYAMIYTNKRCVTP 840
                  Q + QLR+ F A     ++  TP
Sbjct: 147 -------QLVIQLRNCFNAFAQRKEKEFTP 169

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 88/230 (38%), Gaps = 54/230 (23%)

Query: 1061 ITKFPTILQVQIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKM 1120
            ITK P  L VQ  R Y+ R      K +  + F  ++      D AD  +L     TAK+
Sbjct: 290  ITKLPEYLTVQFVRFYWKRSTGKKSKILRKVQFPFQL------DVAD--LLTPEYATAKI 341

Query: 1121 KA--ELVQLKKRQ--------QELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQ 1170
            K   EL ++ K++        Q +L    + L+  E Y   +   +S            +
Sbjct: 342  KVRDELREVDKQREDDLKEFNQNILEHVPLSLTPAERYETQMALEESKR----------E 391

Query: 1171 DELSTILKKAGTDI--DDELSTIYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEAS- 1227
              L+   KK   D+   +  S++YN                      L  V  H+G  S 
Sbjct: 392  HWLAEFAKKFPKDLRQGENPSSVYN----------------------LIGVVTHQGANSD 429

Query: 1228 YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTA-TPYFLVY 1276
             GHY  +++D      W KYND+ V  V  E+V     G  + +   L+Y
Sbjct: 430  SGHYQAFVRDDADENKWYKYNDDKVYVVTREKVEQLAGGGESDSALILIY 479

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 23/33 (69%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           P G  N+GNTCYLNS LQ  + I PLRE +L Y
Sbjct: 107 PIGFQNMGNTCYLNSTLQALYRIKPLRELILSY 139

 Score = 39.7 bits (91), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTA-TP 1271
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ VS V  E++ + + G  + + 
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVSVVDKEKIESLSGGGESDSA 490

Query: 1272 YFLVY 1276
              L+Y
Sbjct: 491  LILIY 495

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 50/112 (44%), Gaps = 22/112 (19%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGD 810
           P G+ N+GNTCY+NS LQ  + I PLRE +L +    E+            R G      
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKEN------------RSG------ 146

Query: 811 NEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFA-PSNVEVEFENG 861
              E+ IQ + +L+  F  +    +   TP   LA L    P   E + E+G
Sbjct: 147 ---EQHIQLVAELKRCFQQLRDRPQESTTPILLLATLRKCYPQFAERDQESG 195

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTA-TP 1271
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ VS +  E++ +   G  + + 
Sbjct: 426  YNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVSVIEKEKIESLAGGGESDSA 485

Query: 1272 YFLVY 1276
              L+Y
Sbjct: 486  LILIY 490

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 48/112 (42%), Gaps = 22/112 (19%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGD 810
           P G+ N+GNTCY+NS LQ  + I PLR+ VL Y    E   +                  
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPREKPSE------------------ 100

Query: 811 NEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFA-PSNVEVEFENG 861
              E+  Q + +LR  F  +    +  VTP   LA L    P   E + E+G
Sbjct: 101 ---EQHHQLVSELRRCFQQLKDKPQESVTPMLLLAMLRKCYPQFAERDQESG 149

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTA-TP 1271
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ VS +  E++ +   G  + + 
Sbjct: 380  YNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVSIIEKEKIESLAGGGESDSA 439

Query: 1272 YFLVY 1276
              L+Y
Sbjct: 440  LILIY 444

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 24/33 (72%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           P GI N+GNTCY+N+ LQ  F I PLRE VL +
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEF 133

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 24/33 (72%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           P GI N+GNTCY+N+ LQ  + I PLRE +L +
Sbjct: 59  PMGIVNMGNTCYMNATLQGLYGIVPLREQILAF 91

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTA-TP 1271
            Y L  V  H+G  S  GHY  +++D   +  W K+ND+ V+ +  E++ +   G  + + 
Sbjct: 377  YDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVTAIEKEKIESLAGGGESDSA 436

Query: 1272 YFLVY 1276
              L+Y
Sbjct: 437  LILIY 441

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSK 785
           P G  N+GNTCYLN+ LQ  + I PLR+ +L Y++
Sbjct: 108 PIGFQNMGNTCYLNATLQALYRIEPLRDMILDYNQ 142

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTA-TP 1271
            Y L  V  H+G  S  GHY  +I+D      W  +ND+ VS VP E++     G  + + 
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDEDKWYNFNDDKVSVVPKEKIEGLAGGGESDSA 484

Query: 1272 YFLVY 1276
              L+Y
Sbjct: 485  LILIY 489

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G+W  Y+DE ++++ D+EV   T      
Sbjct: 671  VKYQLISVVVHEGRSLSSGHYVAHCK--QPDGLWATYDDEYINKISDKEVLRETNA---- 724

Query: 1271 PYFLVYVK 1278
             Y+LVY +
Sbjct: 725  -YYLVYSR 731

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 1214 YSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT--EGNTAT 1270
            Y L  V IH G +  +GHY    K  N    W  ++DETV  V ++ V  FT    N AT
Sbjct: 588  YELTGVVIHMGGSPQHGHYVSLCK--NDKFGWLLFDDETVESVTEKTVLEFTGDSSNQAT 645

Query: 1271 PYFLVYVKEGSEKDIEPL 1288
             Y L Y KE  EKD +P+
Sbjct: 646  AYVLFY-KELDEKDTKPV 662

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  ++++ LR  +L Y
Sbjct: 138 GYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%)

Query: 732 NNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFY 791
           NNF+ +   +         P G  N+GNTCYLN+ LQ  + +  LR+ +L Y+ + E   
Sbjct: 89  NNFIEDLAPEQQVQQFAETPVGFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASN 148

Query: 792 DAKRNAKTIRRI 803
              ++ +T ++I
Sbjct: 149 SGVQDEETHKQI 160

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPY 1272
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ VS V  E++ +   G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1273 FLVYVK 1278
             ++  K
Sbjct: 490  LILMYK 495

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 732 NNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYS 784
           NNF+ +   +         P G  N+GNTCYLN+ LQ  + ++ LRE +L Y+
Sbjct: 89  NNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLREMILNYN 141

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPY 1272
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ VS V  E++ +   G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1273 FLVYVK 1278
             ++  K
Sbjct: 490  LILMYK 495

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%)

Query: 729 KLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           K  N+F+ +   D      ++ P G+ N+GNTCY+N+ LQ  F +  +R+ +L Y
Sbjct: 84  KGTNHFIEDLTPDQQMQKFDSNPIGLQNMGNTCYMNATLQALFRVDSIRDLILNY 138

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPY 1272
            Y+L  +  H+G  S  GHY  +I+D      W K+ND+ VS V  E++     G  +   
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVSVVEKEKIEALAGGGESDSA 483

Query: 1273 FLVYVK 1278
             ++  K
Sbjct: 484  LILMYK 489

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           P G  N+GNTCYLN+ LQ  F +  LRE +L Y
Sbjct: 107 PIGFKNMGNTCYLNATLQSLFRMDQLRELILNY 139

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGN 1267
            Y+L  V  H+G  S  GHY  +I+D N   +W K+ND+ VS V  E V     G 
Sbjct: 430  YNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVSIVEKERVEALAGGG 484

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 1201 TISHQFEQFKKVGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEE 1259
            T+S  F+      Y L +  IH G+   YGHY    K   +   W  ++DETV  V ++ 
Sbjct: 546  TVSSTFDSKLSKRYELASAVIHLGDGPQYGHYISLCK--TETFGWLLFDDETVEAVDEQT 603

Query: 1260 VFNFTEGNTATPYFLVYVKEGSEKD 1284
            V +FT  N+ T Y L Y  E SE D
Sbjct: 604  VLSFTGENSDTAYVLFY-NEVSEYD 627

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 9/53 (16%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY---------SKTYEDFYDAKRN 796
           G  N GNTCY NS+LQ +F+ S  R  +L +         ++T E F  +KRN
Sbjct: 128 GYENFGNTCYCNSILQCFFNHSVFRTSMLSFPSSNSDGERARTLETFGRSKRN 180

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1202 ISHQFEQFKKVGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEV 1260
            +S  F+      Y L  V IH G    +GHY    K  N+   W  Y+DETV  V +E V
Sbjct: 592  VSSTFDTSVSKRYELSGVVIHMGSGPQHGHYVCICK--NEKFGWLLYDDETVESVSEETV 649

Query: 1261 FNFT--EGNTATPYFLVY 1276
              FT   G+  T Y L Y
Sbjct: 650  LKFTGHSGDQTTAYVLFY 667

 Score = 35.8 bits (81), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  ++I   R  VL Y
Sbjct: 137 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 167

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%)

Query: 732 NNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           NNF+ +   +         P G  N+GNTCYLN+ LQ  + ++ LR+ +L Y
Sbjct: 89  NNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLRDMILNY 140

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPY 1272
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ VS V  E++ +   G  +   
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAGGGESDSA 489

Query: 1273 FLVYVK 1278
             ++  K
Sbjct: 490  LILMYK 495

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRR 802
           TG+ N+GNTCY+NS+LQ  F  S  R+  LG    Y  + + KR+   I +
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLG--GKYHRYLNPKRSNTIISK 636

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500 bp,
            499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEG 1266
            Y L  +  H+G  S  GHY  +I+D N   IW K+ND+ VS +  E++ +   G
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKVSIIEKEKIESLAGG 483

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           P G  N+GNTCYLN+ LQ  + I  LR+ VL +
Sbjct: 106 PIGFKNMGNTCYLNATLQALYRIDDLRDAVLNF 138

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1202 ISHQFEQFKKVGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEV 1260
            +S  F+      Y L  V IH G    +GHY    K  N+   W  Y+DETV  + +E V
Sbjct: 587  VSSTFDTSVSKKYELSGVVIHMGSGPQHGHYVCICK--NEKFGWLLYDDETVESIREETV 644

Query: 1261 FNFT--EGNTATPYFLVY 1276
              FT   G+  T Y L Y
Sbjct: 645  LQFTGHPGDQTTAYVLFY 662

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  ++I   R  +L Y
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNILQY 165

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 732 NNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           ++F+ +   D     + + P G  N+GNTCY+NS LQ  F +  L++ +L Y
Sbjct: 89  SSFIEDLAPDQQMQKLNDLPIGFQNMGNTCYMNSTLQALFRVDVLKDMILNY 140

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTA-TP 1271
            Y L  +  H+G  S  GHY  +I+D N    W K+ND+ VSE   +++     G  + + 
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVSEYEKDKIEQLAGGGESDSA 495

Query: 1272 YFLVYVKEG 1280
              L+Y   G
Sbjct: 496  LILIYKGMG 504

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 1211 KVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            K+ Y L AV IH G  +YGHY  Y K  NQ   W + +DE+V EV + EV 
Sbjct: 419  KIIYDLKAVIIHYGTHNYGHYISYRKFMNQ---WWRISDESVIEVDEMEVL 466

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 24/95 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEV---------------PDE 1258
            Y L  V +H G+ S GHY+  IK   ++  W +++DE V +V               PD+
Sbjct: 431  YKLHGVLVHAGDISTGHYYAMIKPSTEDQ-WYRFDDEKVWKVTKTQVFDENFGLDRIPDD 489

Query: 1259 EVF--------NFTEGNTATPYFLVYVKEGSEKDI 1285
            EV         N+      + Y LVY++E  E D+
Sbjct: 490  EVRLMSREQYQNYLLARHTSAYMLVYIREDQEADL 524

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 16/29 (55%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R  V
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV 221

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 61/146 (41%), Gaps = 10/146 (6%)

Query: 989  DDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFL- 1047
            +D + ++F G +K   I    V     ++E F  L +NV +  +D+  + + Y + E + 
Sbjct: 296  EDKLNEIFVGRMKS-YIKCINVDYESSRVEEFWDLQMNVKN-LKDLKSSFENYIEIELMN 353

Query: 1048 -----TMDEYG--EVKRTVAITKFPTILQVQIQRVYYDRERFMPFKSIEPLPFSAKIYMD 1100
                    +YG  + ++ V    FP +L +Q++R  YD       K  +   F   I + 
Sbjct: 354  GENQYAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVS 413

Query: 1101 RYVDTADPEILETRERTAKMKAELVQ 1126
             Y+D    E  E      K+   LV 
Sbjct: 414  SYIDKMGTEDTEMPPCIYKLHGVLVH 439

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            Y L  +  HRG  + GHY  Y K    +G+W ++ND  V +VP E++           Y 
Sbjct: 423  YELTGIVTHRGTVNEGHYITYTK--TADGVWYQFNDSVVMKVPLEQMLK------EQAYL 474

Query: 1274 LVYV 1277
            L+Y 
Sbjct: 475  LIYT 478

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATP-- 1271
            Y+L  V +H GE S GHY+  IK  +    W +++D+ V  V  E+ F+   G+   P  
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKP-DVGDQWFRFDDDKVWRVTKEQAFDENFGHEPLPDD 497

Query: 1272 ---------------------YFLVYVKEGSEKDI 1285
                                 Y LVY++E  EK++
Sbjct: 498  KLRSLTREQYQNYLIARQTSAYMLVYIREDMEKNV 532

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYV 780
           G+ N G TCYLNSLLQ YF     R+ V
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV 230

 Score = 32.7 bits (73), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 54/108 (50%), Gaps = 10/108 (9%)

Query: 979  LQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVNVGDHPRDIYDAL 1038
            L+   +  E +  + +LF G++K  I  ++ V     ++E F  + +NV +  + + ++ 
Sbjct: 295  LETRMKGTEVEGALNELFVGKMKSYIRCIN-VDYESSRVEDFWDIQLNVKN-LKGVQESF 352

Query: 1039 DMYFKDEFL------TMDEYG--EVKRTVAITKFPTILQVQIQRVYYD 1078
            D Y + E +         +YG  + K+ V    FP++L +Q++R  YD
Sbjct: 353  DNYVEVEIMDGENQYAAQDYGLQDAKKGVVFESFPSVLHLQLKRFEYD 400

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 703 NEQIHEADQFLNYKCALMKLG-----LERNSKLINNFLMNGVIDPSCLPVENWPTGINNI 757
           N+ + + D  +     +M LG     L    K  N+F+ +   D     +++ P G  N+
Sbjct: 57  NDSMTDLDSVIKPNSTIMMLGTPDANLITKPKSQNHFIEDLSPDQQLQKMDSTPIGFQNM 116

Query: 758 GNTCYLNSLLQYYFSISPLREYVLGY 783
           GNTCY+N+ LQ  +    +R+ +L Y
Sbjct: 117 GNTCYMNATLQALYRTDDIRQMILDY 142

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPY 1272
            Y+L  +  H+G  S  GHY  +++D N    W K+ND+ V+ V  E++     G  +   
Sbjct: 433  YNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVTVVEKEKIEALAGGGESDSA 492

Query: 1273 FLVYVK 1278
             ++  K
Sbjct: 493  LILMYK 498

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1202 ISHQFEQFKKVGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEV 1260
            +S  F+      Y L  V IH G    +GHY    K  N+   W  Y+DETV  + +E V
Sbjct: 581  VSSTFDSSISKKYELSGVVIHMGSGPQHGHYVCICK--NEKFGWLLYDDETVESIREETV 638

Query: 1261 FNFT--EGNTATPYFLVY 1276
              FT   G+  T Y L Y
Sbjct: 639  LKFTGHPGDQTTAYVLFY 656

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  ++IS  R  VL Y
Sbjct: 127 GYENFGNTCYCNSVLQCLYNISEFRCNVLRY 157

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 26/103 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEV---------------PDE 1258
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE V  V               PDE
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1259 EVFNFTEG--------NTATPYFLVYVKEGSEKDIEPLKRIIE 1293
            +V   T G           + Y LVY+++  E+D+  L+ ++E
Sbjct: 508  KVRTMTRGEYQNYIIQRHTSAYMLVYIRQEQEEDL--LRPVLE 548

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 2/43 (4%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAK 794
           TG+ N+GNTCY+NS+LQ  F+    R+  L  S  YED++  +
Sbjct: 556 TGLRNMGNTCYINSMLQCLFATRKFRDLFL--SPKYEDYFSKR 596

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 732 NNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           NNF+ +   +         P G  N+GNTCYLN+ LQ  + +  +R+ +L Y
Sbjct: 89  NNFIEDLAPEQQVQQFAQSPVGFKNMGNTCYLNATLQALYRVDDVRDMILNY 140

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPY 1272
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ V+ V  E++ +   G  +   
Sbjct: 431  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVTAVEKEKIESLAGGGESDSA 490

Query: 1273 FLVYVK 1278
             ++  K
Sbjct: 491  LILMYK 496

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           P G+ N+GNTCY+NS LQ  + +  LR+ VL Y
Sbjct: 108 PIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKY 140

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTA-TP 1271
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ VS V  E++     G  + + 
Sbjct: 427  YDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVSVVEREKIEALAGGGESDSA 486

Query: 1272 YFLVY 1276
              L+Y
Sbjct: 487  LILIY 491

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 23/31 (74%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  +++SPLRE +L +
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENILQF 171

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1214 YSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT--EGNTAT 1270
            Y L  + +H G    +GHY    K  +Q   W  ++DETV  V +E V  FT    N AT
Sbjct: 602  YELAGIVVHMGGGPQHGHYVSLCK--HQKFGWLLFDDETVEAVKEETVLEFTGESANMAT 659

Query: 1271 PYFLVY 1276
             Y L Y
Sbjct: 660  AYVLFY 665

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 1214 YSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT--EGNTAT 1270
            Y L  V IH G    +GHY    +  N+   W  Y+DETV  + +E V  FT   G+  T
Sbjct: 601  YELSGVVIHMGSGPQHGHYVCICR--NEKFGWLLYDDETVESIKEETVLQFTGHPGDQTT 658

Query: 1271 PYFLVYVKEGSEK 1283
             Y L Y +  ++K
Sbjct: 659  AYVLFYKETQADK 671

 Score = 35.8 bits (81), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  ++I   R  VL Y
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 165

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 9/69 (13%)

Query: 1211 KVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            K  YSL ++ +H G   YGHY  Y +  +Q   W + +DE+V +V ++EVF      +A+
Sbjct: 425  KCVYSLKSIVVHYGSHDYGHYISYRRFEDQ---WWRISDESVLKVDEDEVF------SAS 475

Query: 1271 PYFLVYVKE 1279
              F+V+ ++
Sbjct: 476  GIFIVFYEQ 484

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATP-- 1271
            Y+L  V +H G+ S GHY+  IK   Q+  W +++DE V +V  ++VF    G    P  
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDLQDQ-WYRFDDEKVWKVTKKQVFEENFGMNKLPEE 502

Query: 1272 ---------------------YFLVYVKEGSEKDI 1285
                                 Y LVY++E  E ++
Sbjct: 503  EIRGMTREQYQNYLITRHTSAYMLVYIREDKEPEV 537

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 235

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 24/95 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETV---------------SEVPDE 1258
            Y L  V +H G+ S GHY+  I+  + +G W +++D+ V               +++PD+
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQP-DAHGSWYRFDDDRVIKATDKQVFEENFGKAKLPDD 489

Query: 1259 EVFNFTE--------GNTATPYFLVYVKEGSEKDI 1285
            E+  FT+            + Y LVY+++  E+ I
Sbjct: 490  EIQGFTKDEYQNYLLARQTSAYMLVYIRKDMEESI 524

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 9/125 (7%)

Query: 992  VKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFL---- 1047
            + +LF G++K   I    V     ++E F  + +NV D  +++ ++ + Y + E +    
Sbjct: 303  INELFVGKMKS-CIKCINVDYESSRVEDFWDIQLNVKDM-KNLQESFEQYIEVELMNGEN 360

Query: 1048 ---TMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVD 1104
                 D   +  + V    FP +L +Q++R  YD       K  +   F   I +  Y+D
Sbjct: 361  QYAAQDHGLQDAQKVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLD 420

Query: 1105 TADPE 1109
            +A P+
Sbjct: 421  SAAPK 425

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 1198 LEETISHQFEQ--FKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEV 1255
            + +TI  +F+      + YSL +V +H G  +YGHY  + K     G+W + +DETV  V
Sbjct: 704  IPQTIRKKFDSTPIGPLTYSLRSVIVHYGTHNYGHYIAFRK---YRGVWWRISDETVYIV 760

Query: 1256 PDEEVFN 1262
             + EV +
Sbjct: 761  DEAEVLS 767

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 22/110 (20%)

Query: 719 LMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLRE 778
           +M+  + R+S++ +N L +G           +  G+ N GNTC++NS+LQ          
Sbjct: 105 IMRRWMPRSSQMDSNVLNHG----------GYIAGLLNDGNTCFMNSVLQ---------- 144

Query: 779 YVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVER-SIQFIYQLRDLF 827
             L  SK   DF D     +  +     +VGD + E   I F   L +L 
Sbjct: 145 -SLASSKELMDFLDTTIKQEQEQEQEQEQVGDEKKEDVDIGFTLSLNELL 193

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 24/95 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEV---------------PDE 1258
            Y+L  V +H G+ S GHY+  IK  N    W +++D+ V +V               PDE
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKP-NVTDQWFRFDDDKVWKVTKTQAFDENFGHDNLPDE 497

Query: 1259 EVFNFTE--------GNTATPYFLVYVKEGSEKDI 1285
            ++  FT             + Y LVY++E  E+ +
Sbjct: 498  KLRTFTREQYQNYLIARQTSAYMLVYIREDMEEKV 532

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 33/75 (44%), Gaps = 20/75 (26%)

Query: 726 RNSKLINNFLMNGVI----------DPSCLPVENWPT----------GINNIGNTCYLNS 765
           RNS   + FL+NG +          DP+ +   N+            G  N G TCYLNS
Sbjct: 156 RNSSRNSGFLVNGSLNVSVFIRILKDPTGVLWHNFMNYDSKKLTGYIGFKNQGATCYLNS 215

Query: 766 LLQYYFSISPLREYV 780
           LLQ YF     R+ V
Sbjct: 216 LLQSYFFTKLFRKMV 230

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 65/158 (41%), Gaps = 34/158 (21%)

Query: 1163 QGIVFEGQDE-LSTILKKAGTDIDDELSTIYNQITQLEETISHQFEQFKKV--------G 1213
            +G+VFE   E L   LK+   D + +     N   +  ETI       K+V         
Sbjct: 436  KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNN 495

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATP-- 1271
            Y+L  V +H G+ S GHY+  IK    +  W +++DE V  V  ++VF+   G    P  
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTDDK-WYRFDDEKVWRVTKKQVFDENFGLNRLPED 554

Query: 1272 ---------------------YFLVYVKEGSEKDI-EP 1287
                                 Y LVYVK+ +E  I EP
Sbjct: 555  TLRKMTRKEYQDYLIARHTSAYMLVYVKDLAENGILEP 592

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLV 287

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 751 PTGINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           P G+ N+GNTCYLN+ LQ  F    L++ +L Y
Sbjct: 108 PLGLQNMGNTCYLNATLQALFRADELKDLILQY 140

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 1214 YSLFAVFIHRGEAS-YGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPY 1272
            Y L  V  H+G  S  GHY  +I+D +    W K+ND+ VS +  E++     G  +   
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVSPIEKEKIEALAGGGESDSA 485

Query: 1273 FLVYVK 1278
             ++  K
Sbjct: 486  LILLYK 491

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 5/56 (8%)

Query: 726 RNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVL 781
           +N   ++N+ M   + PS     +  TG+ N+GNTCY+NS LQ    I  LR+Y L
Sbjct: 272 KNYHWLSNYFMYNQLTPS-----SGITGLYNLGNTCYMNSALQCLVHIPELRDYFL 322

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 26/103 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF------------ 1261
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE V  V  ++VF            
Sbjct: 448  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 506

Query: 1262 -----------NFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293
                       N+      + Y LVY+++  E+D+  L+ ++E
Sbjct: 507  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQDQEQDL--LRPVVE 547

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
            (REAL)
          Length = 763

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G W  Y+DE ++++ + +V   T      
Sbjct: 642  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINKISERDVLKETNA---- 695

Query: 1271 PYFLVYVK 1278
             Y+L+Y +
Sbjct: 696  -YYLLYTR 702

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 724 LERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVL-- 781
           +E N   ++N  +   ++P+     +  TG+ N+GNTCY+NS LQ    +  LR+Y L  
Sbjct: 338 VEGNHHWVSNHFVYNKLEPA-----SGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFLYN 392

Query: 782 GYSK 785
           GY K
Sbjct: 393 GYEK 396

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 12/86 (13%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSE-VPDEEVFNFTEGNTATPY 1272
            Y L+AV  H G    GHY  Y+K++  N  W  ++D  V+E VP+  V         + Y
Sbjct: 1051 YDLYAVDNHYGGLGGGHYTAYVKNFMDNK-WYYFDDSRVTETVPENSV-------AGSAY 1102

Query: 1273 FLVYV---KEGSEKDIEPLKRIIEES 1295
             L Y+   K+G+E     L+ II ES
Sbjct: 1103 LLFYIRRTKDGNELGGSKLQEIIRES 1128

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G W  Y+DE ++++ + +V    E N   
Sbjct: 643  VKYQLISVVVHEGRSLSSGHYIAHCK--QPDGSWSTYDDEYINKITERDVLR--ESNA-- 696

Query: 1271 PYFLVYVK 1278
             Y+LVY +
Sbjct: 697  -YYLVYTR 703

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 29/41 (70%), Gaps = 2/41 (4%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYD 792
           TG+ N+GNTCY+NS+LQ  F+ +  R+  L  S  +E+F++
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATTKFRD--LFVSGKFEEFFN 646

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREY 779
            G+NN+GNTCY+NS LQ    I P+R+Y
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDY 425

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G W  Y+DE ++++ ++++    E N   
Sbjct: 637  VRYQLISVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKISEKQLLK--EPNA-- 690

Query: 1271 PYFLVYVK 1278
             YFLVY +
Sbjct: 691  -YFLVYTR 697

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 726 RNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVL 781
           +N   ++N+     + PS   +     G+NN+GNTCY+NS LQ    I  LR+Y L
Sbjct: 321 KNYHWLSNYFHYNALTPSRGNI-----GLNNLGNTCYMNSALQCLVHIPQLRDYFL 371

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1202 ISHQFEQFKKVGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEV 1260
            ++  F+   +  Y L  V IH G +  +GHY    K  N    W  ++DETV  V +  V
Sbjct: 680  VASTFDSSIEKAYELTGVVIHMGSSPQHGHYVSLCK--NDKFGWLLFDDETVESVSESTV 737

Query: 1261 FNFT--EGNTATPYFLVY 1276
              FT    N AT Y L Y
Sbjct: 738  LEFTGDPNNQATAYVLFY 755

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYS 784
           G  N GNTCY NS+LQ  +++   R  +L YS
Sbjct: 173 GYENFGNTCYCNSVLQCLYNLYEFRLNMLEYS 204

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 82/208 (39%), Gaps = 43/208 (20%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDN 811
           TG+ N+G+TCY+NS+LQ  F+    R+  L  S  Y D+            I    +   
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFL--SPKYHDY------------ISKGYIHRA 658

Query: 812 EVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFAPSNVEVEFENGVTDAKEDVSH 871
           ++ RS   +++        +Y N  C          +  PS     F       + D   
Sbjct: 659 QISRSFHMLFK-------KMYMNGGC----------SVVPSG----FLKACNSMRPDFKI 697

Query: 872 YNDDKTSD--TLIKIGEGDEDLGEAERTEASPTEDIYMTDDDMLGAAKATDGINKEDEST 929
            ND + +    L  + +  ++L + E+  A+    + + DDD L           ED  +
Sbjct: 698 PNDQQDTQEFLLFLLDQLHDELSDPEQV-ANDYPQLLLHDDDNLQVDGKEYDKWFEDSIS 756

Query: 930 ENGIDILPSTKVAKISSDQLENALEMGR 957
           +NG+     + +  I   Q+EN L+  R
Sbjct: 757 KNGL-----SPIDSIFQGQMENCLQCQR 779

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 26/103 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF------------ 1261
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE V  V  ++VF            
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1262 -----------NFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293
                       N+      + Y LVY+++  E+D+  L+ ++E
Sbjct: 508  KVRTMTRDDYQNYIIQRHTSAYMLVYIRQEQEQDL--LRPVLE 548

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            YSL +V +H G  +YGHY  + K     G W + +DETV  V + EV +
Sbjct: 624  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVGIVTEAEVLS 669

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G+ N GNTCY NS+LQ  F++S LR  +L Y
Sbjct: 134 GLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

 Score = 38.9 bits (89), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 11/77 (14%)

Query: 1214 YSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT--EGNTAT 1270
            Y L  + IH G    +GHY V I  ++  G W  Y+DETV  + +E VF F   E +  T
Sbjct: 637  YELNGIVIHMGGGPQHGHY-VAICKHDMFG-WLLYDDETVESIDEETVFKFVGDEKDMTT 694

Query: 1271 PYFLVYVKEGSEKDIEP 1287
             Y L +      K+++P
Sbjct: 695  AYVLFF------KEVDP 705

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYD 792
           TG+ N+GNTCY+NS+LQ  F+ +  R   L  S  YE + D
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRNIFL--SHKYEKYMD 791

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            YSL +V +H G  +YGHY  + K     G W + +DETV  V + EV +
Sbjct: 708  YSLRSVIVHYGTHNYGHYIAFRK---HRGFWWRISDETVYIVDEAEVLS 753

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 26/103 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF------------ 1261
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE V  V  ++VF            
Sbjct: 449  YNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLPDE 507

Query: 1262 -----------NFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293
                       N+      + Y LVY+++  E+D+  L+ ++E
Sbjct: 508  KVRTMTREDYQNYIIQRHTSAYMLVYIRQEQEEDL--LRPVLE 548

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 77/173 (44%), Gaps = 27/173 (15%)

Query: 958  QQDVTECIGNVLYQLESGSEPLQINPEDNEQDD----LVKQLFYGEIKQDIIPLSGVGET 1013
            QQD  E +   L QL    +  + +   NEQ++    +   +F GE+K  I+      ++
Sbjct: 241  QQDAHEFLQYFLNQLH---QDYKRDSSHNEQENNCPCVAHSIFQGELKSSIVCPECQNDS 297

Query: 1014 RPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVK--------RTVAITKFP 1065
            +  ++ F+ L +++ D   D+Y  LD + K E L    Y   +        +   I K P
Sbjct: 298  KTIIDPFMDLSLDIKD-KTDLYQCLDSFHKKEKLHDFNYHCSRCNTSLDPIKQFTINKLP 356

Query: 1066 TILQVQIQRVYYDRERFMPFKSIE-------PLPFSAKIYMDRYVDTADPEIL 1111
             +L +Q++R     E F+   +++       PL  + + Y DR  +   P+I+
Sbjct: 357  PMLVLQLKRF----EHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDII 405

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            Y L  +  H G  + GHY V +K    +G W K+ND  +S + ++E  
Sbjct: 406  YELTGILSHIGSINEGHYVVVLKI--NDGRWFKFNDSMISVIKEDEAL 451

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 28/97 (28%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF------------ 1261
            Y+L  V +H G+ S GHY+  IK    +  W +++D+ V +V  ++VF            
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIKP-GLDDKWYRFDDDKVWQVTKKQVFEQNFGFDRLPEY 494

Query: 1262 -----------NFTEGNTATPYFLVYVKEGSEKDIEP 1287
                       N+      + Y LVY+KE    D+EP
Sbjct: 495  ELRSLSKEQYQNYLIARQTSAYMLVYIKE----DMEP 527

 Score = 34.3 bits (77), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G+ N G TCYLNSLLQ Y+     R+ V
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFTKYFRKLV 227

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 5/51 (9%)

Query: 731 INNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVL 781
           ++N+ +   + PS        TG+ N+GNTCY+NS LQ    I  LR+Y L
Sbjct: 286 LSNYFIYNTLQPS-----QGITGLTNLGNTCYMNSALQCLVHIPELRDYFL 331

 Score = 34.3 bits (77), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 47/114 (41%), Gaps = 14/114 (12%)

Query: 1184 IDDELSTIYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGI 1243
            IDD   T++  I  L+ T     E  +   Y L AV  H G    GHY  Y+K    N  
Sbjct: 932  IDD---TVHFPIKSLDMTEHLVHEDPRGSIYDLIAVDNHFGGLGGGHYTAYVK---TNDK 985

Query: 1244 WRKYNDETVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDI--EPLKRIIEES 1295
            W  ++D  V+E   E           + Y L Y++      I  E L+ II +S
Sbjct: 986  WFYFDDSRVTETKPESSI------AGSAYLLFYLRRTESGKIGSERLQSIILQS 1033

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G W  Y+DE ++++ + +V    E N   
Sbjct: 667  VKYQLLSVVVHEGRSLSSGHYIAHCK--QPDGTWATYDDEYINKISERDVLK--EPNA-- 720

Query: 1271 PYFLVYVK 1278
             Y+L+Y +
Sbjct: 721  -YYLLYTR 727

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 11/81 (13%)

Query: 1202 ISHQFEQFKKV---GYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPD 1257
            I+   E  KKV    Y L +V +H G + S GHY  + +    +G W  Y+DE ++++  
Sbjct: 746  ITEYCESSKKVLPAKYQLLSVVVHEGRSLSSGHYIAHCRQ--PDGTWATYDDELINKI-- 801

Query: 1258 EEVFNFTEGNTATPYFLVYVK 1278
             E+   TE N    Y+LVY +
Sbjct: 802  SELKLLTEPNA---YYLVYTR 819

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSK 785
           G  N GNTCY NS+LQ  +++S LRE +L + K
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPK 173

 Score = 39.3 bits (90), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT--EGNTATP 1271
            Y L  + +H G      ++V +  + + G W  ++DETV  V +E V  FT    N AT 
Sbjct: 602  YELAGIVVHMGGGPQHGHYVSLCKHEKFG-WLLFDDETVEAVKEETVLEFTGESPNMATA 660

Query: 1272 YFLVY 1276
            Y L Y
Sbjct: 661  YVLFY 665

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 7/60 (11%)

Query: 723 GLERNSKLINNFLM-NGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVL 781
           G+E++   ++N+   N +  PS +       G++N+GN+CY+NS LQ    I  LR+Y L
Sbjct: 274 GVEKDQHWLSNYYYYNKLSPPSGI------VGLSNLGNSCYMNSALQCLVHIPELRDYFL 327

 Score = 32.7 bits (73), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 72/171 (42%), Gaps = 19/171 (11%)

Query: 1133 ELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGT--DIDDELST 1190
            EL S++EV  +    Y       +    Q+Q  ++   D L+  LK+        D++S 
Sbjct: 879  ELFSKSEVLGAADSWYCPNCKEHRQATKQIQ--LWNTPDILTIHLKRFENRHSFSDKISD 936

Query: 1191 IYN-QITQL---EETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRK 1246
            + +  IT L   E  + H   Q     Y L AV  H G    GHY  Y+K++  +G W  
Sbjct: 937  VVDFPITGLDMSEHLVCHDPNQ--NSMYDLIAVDNHYGGLGGGHYTAYVKNF-MDGKWYY 993

Query: 1247 YNDETVSEVPDEEVFNFTEGNTATPYFLVYVK--EGSEKDIEPLKRIIEES 1295
            ++D  VSE   E         +   Y L Y +  EG +     LK+++  S
Sbjct: 994  FDDSRVSETEAERAI------SGAAYLLFYRRRIEGEDVGTPELKKLLVSS 1038

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            YSL +V +H G  +YGHY  + K     G W + +DETV  V + EV + T G     Y 
Sbjct: 683  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVLS-TPGVFMLFYE 738

Query: 1274 LVYVKEGSE--KDIEPL 1288
              Y KE  E   D+E L
Sbjct: 739  YDYDKETGEMKDDLEAL 755

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 740 IDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYV-LGYSKTYEDFYDAKRN 796
           +D   L    +  G+ N GNTC++NS+LQ   S   L +++     KTYED   +++N
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTYEDIERSEQN 146

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G W  Y+DE ++++ + E+    E N   
Sbjct: 753  VKYQLLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKISEREMLK--EPNA-- 806

Query: 1271 PYFLVYVK 1278
             Y+L+Y +
Sbjct: 807  -YYLLYTR 813

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G W  Y+DE ++++ + EV    E N   
Sbjct: 660  VKYELLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKITEREVLK--ERNA-- 713

Query: 1271 PYFLVYVK 1278
             Y+++Y +
Sbjct: 714  -YYVLYTR 720

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G W  Y+DE ++++ +  V          
Sbjct: 636  VKYQLISVVVHEGRSLSSGHYIAHCK--QPDGTWATYDDEYINKITERNVL-----KEVN 688

Query: 1271 PYFLVYVK 1278
             Y+LVY +
Sbjct: 689  AYYLVYTR 696

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATP 1271
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE V +V   +VF    G  A P
Sbjct: 439  YNLHGVLVHAGDISTGHYYTLIKPGLEDQ-WYRFDDERVWKVTKNQVFEENYGLDALP 495

 Score = 34.3 bits (77), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 16/29 (55%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R  V
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV 231

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 724 LERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVL-- 781
           +E N    +N+     ++P+     +  TG+ N+GNTCY+NS LQ    I  LR+Y L  
Sbjct: 341 IEGNHHWPSNYFAYNKLEPA-----SGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYD 395

Query: 782 GY 783
           GY
Sbjct: 396 GY 397

 Score = 32.7 bits (73), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            Y L+AV  H G    GHY  Y+K++  N  W  ++D  V+E   E   N   G+    ++
Sbjct: 1052 YDLYAVDNHYGGLGGGHYTAYVKNFADNK-WYYFDDSRVTETAPE---NSIAGSAYLLFY 1107

Query: 1274 LVYVKEGSEKDIEPLKRIIEES 1295
            +   K+G+      L+ II++S
Sbjct: 1108 IRRHKDGNGLGSSKLQEIIQKS 1129

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 40.0 bits (92), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            Y L ++  H+G  + GHY V +K    +G W K+ND  VS + +EE  
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVKV--NDGQWFKFNDSMVSAITEEEAL 478

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
            YNL186W
          Length = 661

 Score = 40.0 bits (92), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L  V +H G + S GHY V+ K    +G W  Y+DE ++++ + +V    E N   
Sbjct: 547  VKYQLTTVVVHEGRSLSSGHYIVHCK--QPDGTWATYDDEYINKITERDVLK--EPNA-- 600

Query: 1271 PYFLVYVK 1278
             Y+L+Y +
Sbjct: 601  -YYLLYTR 607

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAK 794
           TG+ NIG TCY+NS+LQ  F+    R+  L  S  YE ++  K
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL--STKYEHYFSRK 596

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVL--GYSK 785
           TG+ N+GNTCY+NS LQ    I   REY L  GY K
Sbjct: 321 TGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEK 356

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            YSL +V +H G  +YGHY  + K     G W + +DE+V+ V + EV +
Sbjct: 687  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDESVTIVDEAEVLS 732

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATP-- 1271
            Y L  V +H G+ S GHY+  IK  +    W +++DE V +V  ++VF+   G    P  
Sbjct: 448  YKLHGVLVHTGDISTGHYYTMIKP-DLGDQWYRFDDERVWKVDRKQVFDENFGLDKLPDS 506

Query: 1272 ---------------------YFLVYVKEGSEKDI 1285
                                 Y LVYVK+  E++I
Sbjct: 507  ELRGMTKEEYQSYLITRHTSAYMLVYVKDEVEEEI 541

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 237

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 39.7 bits (91), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            Y L  +  H+G  + GHY  + K     G W K+ND  VS +  EEV 
Sbjct: 411  YELIGIVSHKGTVNEGHYIAFCKI--SGGQWFKFNDSMVSSISQEEVL 456

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (70%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSKT 786
           G+ N GNTCY NS+LQ  ++++  RE +LG + +
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENILGLTPS 165

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            Y L  +  H+G  + GHY  + K     G W K+ND  VS +  EEV 
Sbjct: 413  YELIGIVSHKGTVNEGHYIAFCKI--SGGQWFKFNDSMVSSISQEEVL 458

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            Y+L +V +H G  +YGHY  Y K     G+W + +DE+V  V + EV +
Sbjct: 689  YALRSVIVHYGTHNYGHYIAYRK---FRGVWWRISDESVYVVDEAEVLS 734

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 33/72 (45%), Gaps = 5/72 (6%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT--EGNT 1268
            + Y L  + IH G+    GHY    K   +   W  Y+DETV  V +E V  F   E   
Sbjct: 563  IKYELSGIVIHVGDGPQMGHYVALCK--TEKYGWLFYDDETVESVSEETVLKFIGDEKTQ 620

Query: 1269 ATPYFLVYVKEG 1280
            +T Y L Y K G
Sbjct: 621  STAYVLFYKKLG 632

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  +++   R  +L Y
Sbjct: 127 GYENFGNTCYCNSVLQCLYNLPEFRLNILQY 157

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 41/94 (43%), Gaps = 22/94 (23%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKD--------YNQNGIWRKYNDETVSE------VPDEE 1259
            Y L  V +H G+ S GHY+  IK         ++ + +WR   ++   E      +PDE+
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSIEDQWYRFDDDKVWRVTKNQVFEENFGHVRLPDEK 502

Query: 1260 VFNFTE--------GNTATPYFLVYVKEGSEKDI 1285
            +  FT             + Y LVYV++  E  I
Sbjct: 503  LRTFTREQYQNYLISRQTSAYMLVYVRKDMEDKI 536

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLV 234

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 24/93 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATP-- 1271
            Y L  V +H G+ S GHY+  IK   ++  W +++DE V +V  ++VF+   G    P  
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKPTLEDQ-WYRFDDEKVWKVDKKQVFDENFGLDRLPDS 499

Query: 1272 ---------------------YFLVYVKEGSEK 1283
                                 Y LVY+ EG E+
Sbjct: 500  KLRSMTREEYQSYLITRHTNAYMLVYICEGMEE 532

 Score = 36.6 bits (83), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLG 782
            G  N G TCYLNSLLQ YF     R+ V G
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYG 234

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 23/34 (67%), Gaps = 2/34 (5%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVL--GY 783
           TG+ N+GNTCY+NS LQ    I  LR+Y L  GY
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGY 397

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 12/86 (13%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSE-VPDEEVFNFTEGNTATPY 1272
            Y L+AV  H G    GHY  Y+K++  N  W  ++D  V+E VP+  +         + Y
Sbjct: 1048 YDLYAVDNHYGGLGGGHYTAYVKNFANNK-WYYFDDSRVTETVPENSI-------AGSAY 1099

Query: 1273 FLVYV---KEGSEKDIEPLKRIIEES 1295
             L Y+   K+G E     L+ II+ S
Sbjct: 1100 LLFYIRRPKDGDELGGPKLQEIIKIS 1125

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 8/54 (14%)

Query: 732 NNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVL--GY 783
           N+F  N ++ P         TG++N+GN+CY+NS LQ    I  L++Y L  GY
Sbjct: 320 NHFYYNKLLPPRGT------TGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGY 367

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1202 ISHQFEQFKKVGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEV 1260
            IS  F+      Y L ++ +H GE+   GHY    K  +++  W  Y+DETV  V DE V
Sbjct: 575  ISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLCK--HKSYGWLIYDDETVQAVSDELV 632

Query: 1261 FNF--TEGNTATPYFLVY 1276
                  E  +AT Y L Y
Sbjct: 633  SRILNNEQRSATAYLLFY 650

 Score = 35.8 bits (81), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLG 782
           G  N G TCY NS+LQ  F+I   R+ ++G
Sbjct: 107 GFQNFGYTCYCNSILQALFNIGSFRDGIIG 136

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 39.7 bits (91), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 23/34 (67%), Gaps = 2/34 (5%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVL--GY 783
           TG+ N+GNTCY+NS LQ    I  LR+Y L  GY
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGY 397

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 12/86 (13%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSE-VPDEEVFNFTEGNTATPY 1272
            Y L+AV  H G    GHY  Y+K++  +  W  ++D  V+E VP+  +       + + Y
Sbjct: 1054 YDLYAVDNHYGGLGGGHYTAYVKNF-ADSKWYYFDDSRVTETVPENSI-------SGSAY 1105

Query: 1273 FLVYV---KEGSEKDIEPLKRIIEES 1295
             L Y+   K+G+E     L+ II +S
Sbjct: 1106 LLFYIRRAKDGNELGSHELQEIIRKS 1131

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 39.7 bits (91), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            Y+L +V +H G  +YGHY  + K     G+W + +DETV  V + EV +
Sbjct: 678  YALRSVIVHYGSHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVLS 723

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            Y L  +  H+G  + GHY  + K     G W K+ND  VS +  EEV 
Sbjct: 411  YELIGIVSHKGTVNEGHYIAFCKI--SGGQWFKFNDSMVSSISQEEVL 456

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 39.7 bits (91), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            YSL +V +H G  +YGHY  + K     G W + +DETV  V + EV 
Sbjct: 682  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 726

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 87/218 (39%), Gaps = 54/218 (24%)

Query: 740 IDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYV-LGYSKTYEDF-------- 790
           +D   L    +  G+ N GNTC++NS+LQ   S   L E++     KTYE+         
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSKELMEFLDNNVIKTYEEMEQNEHNKE 148

Query: 791 ----------YDAKRNAKTIRRIGG-------REVGDNEVERS-----IQFIYQLRDLFY 828
                     Y+ K+N+    ++ G       R++   E ER      I F   LRDL  
Sbjct: 149 ESEHEPEQGEYNNKKNSNRSGKVYGKHKKKLNRKLSSKEEERENQEPDITFSTALRDLLA 208

Query: 829 AM---IYTNK-----------RCVTPRRELAYLAFAPSNVEVEFENGVTDAKEDVSHYND 874
           A+    Y +K              +PR+ +  L +   + +  F+N + + + +V   N 
Sbjct: 209 ALNDKYYRDKPYFKTNSLLKSMSKSPRKNI-LLGYDQEDAQEFFQNILAELESNVKSLNT 267

Query: 875 DKTSDTLIKIGE-------GDEDLGEAERTEASPTEDI 905
           +K   T I           G ++LGE   T   PTE I
Sbjct: 268 EKLDSTPIAKSNLPEDALVGQQNLGEV-GTVYIPTEQI 304

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 39.7 bits (91), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 2/77 (2%)

Query: 711 QFLNYKCALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYY 770
           Q  +Y   ++ L +E   K  N    +     + L   +   G++N+GNTCY+NS LQ  
Sbjct: 298 QLKDYDSQIISLVVEVKQKSSNQHWPSNFFHYNKLNAPSGIMGLSNLGNTCYMNSALQCL 357

Query: 771 FSISPLREYVL--GYSK 785
             I  L EY L  GY +
Sbjct: 358 LHIPELNEYFLYKGYER 374

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
            (REAL)
          Length = 776

 Score = 39.7 bits (91), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G W  Y+DE ++++ + +V    E N   
Sbjct: 655  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGNWATYDDEYINKISERDVLK--EPNA-- 708

Query: 1271 PYFLVYVK 1278
             Y+L+Y +
Sbjct: 709  -YYLLYTR 715

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 39.7 bits (91), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            YSL +V +H G  +YGHY  + K     G W + +DETV  V + EV 
Sbjct: 685  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 729

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 39.7 bits (91), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 24/95 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF------------ 1261
            Y+L  V +H G+ S GHY+  IK   ++  W +++D+ V  V  ++VF            
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKPGLEDA-WYRFDDDKVWRVTKKQVFEQNFGFDKLSEY 485

Query: 1262 -----------NFTEGNTATPYFLVYVKEGSEKDI 1285
                       N+      + Y LVY++E  E  I
Sbjct: 486  DLRSLTKEQYQNYLIARQTSAYMLVYIREDMESTI 520

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G+ N G TCYLNSLLQ Y+     R+ V
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLV 218

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 39.7 bits (91), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            YSL +V +H G  +YGHY  + K     G W + +DETV  V + EV +
Sbjct: 681  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVLS 726

 Score = 32.7 bits (73), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 83/218 (38%), Gaps = 54/218 (24%)

Query: 740 IDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYV-LGYSKTYEDFYDAKRNA- 797
           +D   L    +  G+ N GNTC++NS+LQ   S   L E++     +TYE+    + N  
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYEEIEQNEHNEE 148

Query: 798 -------------KTIRRIGGREVGDNEV----------------ERSIQFIYQLRDLFY 828
                        K   R GG+  G ++                 E  I F   LRDL  
Sbjct: 149 GNGQESAQDEATHKKNTRKGGKVYGKHKKKLNRKSSSKEDEEKSQEPDITFSVALRDLLS 208

Query: 829 AM---IYTNK-----------RCVTPRRELAYLAFAPSNVEVEFENGVTDAKEDVSHYND 874
           A+    Y +K              +PR+ +  L +   + +  F+N + + + +V   N 
Sbjct: 209 ALNAKYYRDKPYFKTNSLLKAMSKSPRKNI-LLGYDQEDAQEFFQNILAELESNVKSLNT 267

Query: 875 DKTSDTLIKIGE-------GDEDLGEAERTEASPTEDI 905
           +K   T +   E       G  +LGE   T   PTE I
Sbjct: 268 EKLDTTPVAKSELPDDALVGQLNLGEV-GTVYIPTEQI 304

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 39.3 bits (90), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G W  Y+DE ++++ ++++          
Sbjct: 393  VKYQLISVVVHEGRSLSSGHYIAHCKQ--PDGSWSTYDDEYINKISEKQML-----KEPG 445

Query: 1271 PYFLVYVK 1278
             Y+LVY +
Sbjct: 446  AYYLVYTR 453

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 39.7 bits (91), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            Y L +V +H G  +YGHY  + K     G W + +DETV  V + EV      +T + + 
Sbjct: 672  YELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSVFM 723

Query: 1274 LVY 1276
            L Y
Sbjct: 724  LFY 726

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 39.3 bits (90), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            + L  +  HRG  + GHY  + K     G W K+ND  VS + +EE+           Y 
Sbjct: 405  FELIGIIAHRGTVNEGHYIAFTKV--TTGHWFKFNDSMVSSITEEELLQ------EQAYL 456

Query: 1274 LVYV 1277
            L YV
Sbjct: 457  LFYV 460

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 39.3 bits (90), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            Y+L +V +H G  +YGHY  + K     G+W + +DETV  V + EV +
Sbjct: 679  YALRSVIVHYGTHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVLS 724

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 39.3 bits (90), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  +++S LRE +L +
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSLRENILQF 172

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 1214 YSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT--EGNTAT 1270
            Y L  + +H G    +GHY V +  + + G W  ++DETV  V +E V  FT    N AT
Sbjct: 605  YQLAGIVVHMGGGPQHGHY-VSLCKHEKFG-WLLFDDETVEAVKEETVLEFTGESPNMAT 662

Query: 1271 PYFLVY 1276
             Y L Y
Sbjct: 663  AYVLFY 668

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 39.3 bits (90), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            YSL +V +H G  +YGHY  + K     G W + +DETV  V + EV +
Sbjct: 644  YSLRSVIVHYGTHNYGHYIAFRK---FRGCWWRISDETVYIVDEAEVLS 689

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%)

Query: 711 QFLNYKCALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYY 770
           QF+ YK + +    + N+         G ID   L    +  G+ N GNTC++NS+LQ  
Sbjct: 50  QFIKYKMSDLTNKFKNNNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNSVLQSL 109

Query: 771 FSISPLREYV 780
            S   L  ++
Sbjct: 110 ASSKELNAFL 119

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 39.3 bits (90), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 29/43 (67%), Gaps = 2/43 (4%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAK 794
           TG+ N+GNTCY++S+LQ  F+ + LR+  L  +  YE + + K
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLRD--LFITTKYESYINHK 665

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 38.9 bits (89), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            YSL +V +H G  +YGHY  + K     G W + +DETV  V + EV 
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAFRK---YRGYWWRISDETVYIVDETEVL 621

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 38.9 bits (89), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVL 781
           G++N+GNTCY+NS LQ    I  LR+Y L
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFL 352

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 11/85 (12%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEV-PDEEVFNFTEGNTATPY 1272
            Y L+AV  H G    GHY  Y+K++  N  W  ++D  V E  P++ V       + + Y
Sbjct: 962  YDLYAVDNHYGGLGGGHYTAYVKNFIDNK-WYYFDDSRVYETDPEKSV-------SGSAY 1013

Query: 1273 FLVYVKEGSEKD--IEPLKRIIEES 1295
             L Y++ GS +    E L+ +I++S
Sbjct: 1014 LLFYLRRGSNESGGSEQLRELIKKS 1038

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 1189 STIYNQIT-QLEETISHQFEQFKKVGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRK 1246
            S ++N+I   L  T+   F+      Y L  V +H G + ++GHY V I  + + G W  
Sbjct: 557  SKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVLHVGASPTHGHY-VSICKHEKYG-WLM 614

Query: 1247 YNDETVSEVPDEEVFNFT--EGNTATPYFLVY 1276
            Y+DET+  +P+E V +      N  T Y L Y
Sbjct: 615  YDDETIESIPEEAVTSHVGEPNNPITAYVLFY 646

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTY 787
           G  N G+TCY NS+LQ  +++   R+ +L + + Y
Sbjct: 122 GYENFGHTCYCNSVLQCIYNLPEFRKSILQFPQRY 156

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + +    +G W  Y+DE ++++ +  V        A 
Sbjct: 689  VKYELLSVVVHEGRSLSSGHYIAHCR--QPDGSWATYDDEYINKISELNVL-----KEAN 741

Query: 1271 PYFLVYVK 1278
             Y+L+Y +
Sbjct: 742  AYYLLYTR 749

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 55/140 (39%), Gaps = 15/140 (10%)

Query: 958  QQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKL 1017
             QD  E    ++ QL    +    NP+D   D+ + + F G +   I  LS    T  + 
Sbjct: 512  HQDAHEFFNFLINQLSDYIQTDCANPQD---DNFINESFQGILTNRIKCLSCDNVTS-RD 567

Query: 1018 ERFLSLLVNVGDHPR--DIYDALDMYFKDEFLTMDE---------YGEVKRTVAITKFPT 1066
            E FL   + V +H    DI   L  Y + E L               E +RTV + K P 
Sbjct: 568  EPFLDFPIEVQEHKEFTDISTILKSYHQKEMLGGHNKFYCSQCCTLQEAQRTVGLKKLPN 627

Query: 1067 ILQVQIQRVYYDRERFMPFK 1086
             L + ++R  Y  E F   K
Sbjct: 628  TLALHLKRFKYSEEHFTNIK 647

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT--EGNTATP 1271
            Y L  + +H G +    ++V I   ++ G W  ++DET S + +EEV +F   E +  T 
Sbjct: 672  YKLQGIVVHMGSSPQQGHYVAICKTDKYG-WLLFDDETASWINEEEVLSFIGDEKSQNTA 730

Query: 1272 YFLVYVKEGSEKD 1284
            Y L Y +   E D
Sbjct: 731  YVLFYEEVKDEND 743

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSK-----TYEDFYDAKRNAKTI 800
           G  N GNTCY NS+LQ  +++S +RE +L + +     T+   Y+ K N   I
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQFPEKPNESTHPRKYEVKGNKPRI 194

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1214 YSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT--EGNTAT 1270
            Y L  + +H G    +GHY    K  ++   W  ++DETV  V +E V  FT    N AT
Sbjct: 604  YELSGIVVHMGGGPQHGHYVSLCK--HEIFGWLLFDDETVEAVKEEAVLEFTGESPNMAT 661

Query: 1271 PYFLVY 1276
             Y L Y
Sbjct: 662  AYVLFY 667

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            YSL +V +H G  +YGHY  + K     G+W + +DET   V + EV +
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAFRK---FRGVWWRISDETAYIVDEAEVLS 719

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 84/208 (40%), Gaps = 43/208 (20%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDN 811
           +G+ N+GNTCY+NS+LQ  F+ +  R   L  S  Y+++            IG +   D 
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFL--SNRYKEY------------IGTK--VDP 489

Query: 812 EVERSIQFIYQLRDLFYAMIYTNKRC-VTPRRELAYLAFAPSNVEVEFENGVTDAKEDVS 870
            +  S   +++        +Y N  C V P   L    F   ++ +       D ++D  
Sbjct: 490 HLSNSFHILFR-------KMYLNGGCAVIPVLFLKTCNFLRPDLRIP------DVQQDTQ 536

Query: 871 HYNDDKTSDTLIKIGEGDEDLGEAERTEASPTEDIYMTDDDMLGAAKATDGINKEDESTE 930
            +        ++ + +   +L   +    S   D+   D D +    A +      ES E
Sbjct: 537 EF-------LILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLE 589

Query: 931 N-GIDILPSTKVAKISSDQLENALEMGR 957
           N G+ +     + +I   QLEN+LE  R
Sbjct: 590 NEGLSL-----IHEIFQGQLENSLECQR 612

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G W  Y+DE ++++ ++++          
Sbjct: 625  VKYQLISVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKITEKQML-----KEPG 677

Query: 1271 PYFLVYVK 1278
             Y+L+Y +
Sbjct: 678  AYYLIYTR 685

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            Y+L  V +H G+ S GHY+  IK  +    W +++DE V +V  ++VF
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKP-DLEDQWYRFDDEKVWKVTKKQVF 484

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 17/29 (58%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R+ V
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 229

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 752  TGINNIGNTCYLNSLLQYYFSISPLREYVLG 782
            TG+ N+ NTCY+NS+LQ  FS S  R   L 
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 8/71 (11%)

Query: 1207 EQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEG 1266
            E    + Y L  V  H+G    GHY    K   ++G W K+ND  V+ V +E+V      
Sbjct: 382  EYIPNIAYDLLNVVSHQGTVDQGHYTTVSK--TEDGQWFKFNDSVVTSVTEEQVLE---- 435

Query: 1267 NTATPYFLVYV 1277
                 Y L Y+
Sbjct: 436  --QQAYLLFYI 444

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVL--GYSK 785
           G++N+GNTCY+NS LQ    I   ++Y L  GY K
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEK 381

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKR 795
           TG+ N+GNTCY+NS+LQ  F+    R+  L  +  Y  F +  +
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFRDLFL--TSKYSSFLNGSK 649

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1214 YSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPY 1272
            Y L  V +H G + S GHY V+ K     G W  Y+DE ++ + +++V    E N    Y
Sbjct: 587  YQLITVVVHEGRSLSSGHYIVHCK--QPEGHWATYDDEYINNINEKDVLR--EPNA---Y 639

Query: 1273 FLVYVK 1278
            +LVY +
Sbjct: 640  YLVYTR 645

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 6/57 (10%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVG 809
           G+ N+G+TC++NS+LQ    I+ LR+Y L     Y  F  A+ N +     GGR  G
Sbjct: 352 GLANLGSTCHINSVLQCLTHITELRDYFL-----YNGF-AAELNTRNSLGYGGRVAG 402

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            Y L +V +H G  +YGHY  + K     G W + +DETV  V + EV      +T+  + 
Sbjct: 658  YVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVL-----STSGVFM 709

Query: 1274 LVY 1276
            L Y
Sbjct: 710  LFY 712

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 9/78 (11%)

Query: 712 FLNYKCALM----KLG-LERNSKLINNFLM----NGVIDPSCLPVENWPTGINNIGNTCY 762
           F+ YK  +M     +G + RN    N F       G +D   L    +  G+ N GNTC+
Sbjct: 43  FIKYKSFIMNNLSHIGDMTRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCF 102

Query: 763 LNSLLQYYFSISPLREYV 780
           +NS++Q   S + L +++
Sbjct: 103 MNSVIQSLASSAELMKFL 120

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
            Y L  +  HRG  + GHY  + K     G W K+ND  V+ +   EV 
Sbjct: 411  YELIGIVSHRGTVNEGHYIAFCKI--SGGQWFKFNDSVVTSIAQGEVL 456

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
            UBP10Ubiquitin-specific protease that deubiquitinates
            ubiquitin-protein moieties; may regulate silencing by
            acting on Sir4p; involved in posttranscriptionally
            regulating Gap1p and possibly other transporters;
            primarily located in the nucleus
          Length = 792

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + K    +G W  Y+DE ++ + + +V    E N   
Sbjct: 672  VKYQLLSVVVHEGRSLSSGHYIAHCKQ--PDGSWATYDDEYINIISERDV--LKEPNA-- 725

Query: 1271 PYFLVYVK 1278
             Y+L+Y +
Sbjct: 726  -YYLLYTR 732

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 726 RNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVL 781
           +N    +N+ +   + PS     N   G+ N+GNTCY+NS LQ    I   ++Y L
Sbjct: 328 KNQHWASNYYIYNQMTPS-----NGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFL 378

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 756

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + + GHY  + K    +G W  Y+DE ++++ + ++          
Sbjct: 646  VKYQLISVVVHEGRSLTSGHYIAHCK--QPDGSWSTYDDEYINKISERQML-----KEPG 698

Query: 1271 PYFLVYVK 1278
             Y+LVY +
Sbjct: 699  AYYLVYTR 706

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
            (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 1212 VGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTAT 1270
            V Y L +V +H G + S GHY  + +    +G W  Y+DE ++++ +  V    E N   
Sbjct: 605  VKYQLISVVVHEGRSLSSGHYIAHCR--QPDGSWAIYDDEYINKISERNVLK--EPNA-- 658

Query: 1271 PYFLVYVK 1278
             Y+L+Y +
Sbjct: 659  -YYLIYTR 665

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
            Anc_3.270 YBR058C
          Length = 795

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 64/138 (46%), Gaps = 19/138 (13%)

Query: 958  QQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKL 1017
            QQD TE +  +L QLE       +  +DN  ++++K      I +D I     G  +   
Sbjct: 425  QQDATEFLTFLLEQLEK-----TLFKKDNNPNNIMKF-----IMEDKIQCQSCGNVKYSY 474

Query: 1018 E--RFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITK------FPTILQ 1069
            E   ++ L ++  ++P+++ + L  +F  E +  D     K+TV  TK       P  L 
Sbjct: 475  EPTEYIQLPLDGTNNPQNLVETLTNFFNGENIDFD-CPTCKKTVVATKRQRFKTSPNTLV 533

Query: 1070 VQIQRVYYDRERFMPFKS 1087
            +   R+ +++E + P K+
Sbjct: 534  ISPHRISFEKETWTPIKT 551

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVL 781
           GI N+GNTCY+NS+LQ  F  +  R+  L
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFRDLFL 242

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  ++I  LR+ V+ Y
Sbjct: 113 GYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDF 790
           TG+ N+GNTCY+NS++Q  F+    R   L  S  Y++F
Sbjct: 691 TGLRNLGNTCYINSMIQCLFATKSFRN--LFISMKYKEF 727

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            YSL +V +H G  +YGHY  + +     G W + +DETV  V + EV +
Sbjct: 654  YSLRSVVVHYGTHNYGHYIAFRR---YRGYWWRISDETVYIVDETEVLS 699

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
            YDL122W
          Length = 782

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            YSL +V +H G  +YGHY  + +     G W + +DE+V  V + EV +
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAFRR---YRGCWWRISDESVYIVEEAEVLS 719

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 726 RNSKLINNFLMN-GVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYV 780
           RN+  +N FL +   +D + L       G+ N GNTC++NS+LQ   S   L E++
Sbjct: 59  RNNSTLNRFLPSYNSMDDTILKRGGHIAGLVNDGNTCFMNSVLQSLASSRTLVEFL 114

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYE 788
           G+ N GNTCY NS+LQ  +++  LR  VL Y    E
Sbjct: 100 GLENYGNTCYCNSVLQCLYNLKELRVNVLKYPTRAE 135

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query: 1214 YSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNF-TEGNTATP 1271
            Y L  + IH G    +GHY V I  +   G W  Y+DETV  V ++ V  F  + N  T 
Sbjct: 592  YELNGIVIHMGGGPQHGHY-VAICKHELFG-WLLYDDETVESVGEDAVLRFIGDVNDMTT 649

Query: 1272 YFLVYVKEGSEKDIEP 1287
             ++++ K   E D  P
Sbjct: 650  AYVLFYKSKREDDDTP 665

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 716 KCALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISP 775
           K  +  L   RN  L   F +  +   S   V    TG+ N+GNTCY+N +LQ  F+ + 
Sbjct: 612 KLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNE 671

Query: 776 LRE-YVLGYSKTYE 788
           L+  ++ G  + Y+
Sbjct: 672 LKNLFISGKYREYQ 685

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            Y L  V +H G+ S GHY+  IK   ++  W +++DE V +V  ++ F+
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLEDQ-WYRFDDERVWKVSKKQAFD 487

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 16/29 (55%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R  V
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV 231

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 9/73 (12%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVL--GYSKTYE-----DFYDAKRNA--KTIRRI 803
           G+ N+GNTCY+NS LQ    +    EY L  GY K         +     NA  K I ++
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANAFGKLIHKL 474

Query: 804 GGREVGDNEVERS 816
               + DNE E+S
Sbjct: 475 FEERIIDNESEKS 487

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 44/92 (47%), Gaps = 11/92 (11%)

Query: 1207 EQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEV-PDEEVFNFTE 1265
            +Q K   Y L AV  H G    GHY  Y+K++  +  W  ++D  VS   P   +     
Sbjct: 1153 DQEKSNIYDLIAVDNHYGGLGGGHYTAYVKNF-VDQKWYYFDDSRVSLADPQRSI----- 1206

Query: 1266 GNTATPYFLVYVKEGSEKDI--EPLKRIIEES 1295
              + + Y L YV+  SE  I  + L +I+EES
Sbjct: 1207 --SGSAYLLFYVRRSSENPIKHQTLDKILEES 1236

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 18/90 (20%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDN 811
           TG+ N+GNTCY+NS++Q  F+    R   L  S  Y+++    +        G R    +
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFR--TLFISANYKNYLQPPK--------GSRSAHSS 650

Query: 812 EVERSIQFIYQLRDLFYAMIYTNKRC-VTP 840
           ++  S+       ++ +  +Y N  C V P
Sbjct: 651 KLSNSL-------NMLFNKMYLNGGCSVVP 673

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 4/57 (7%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKR--NAKTIRRIGGRE 807
           G  N GNTCY NS+LQ  ++ S LR+ ++ Y +  E  +D ++  N+ +I+ + G E
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILYPE--EAKFDPEQFDNSISIKNVIGDE 182

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 1191 IYNQITQLEET-ISHQFEQFKKVGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYN 1248
            ++N+IT   E  +   F++     Y L  + IH G    +GHY    K   +   W  Y+
Sbjct: 572  LFNKITYPSELHVRSTFDRSISKKYELSGIIIHLGAGPQHGHYVAMCK--TEKFGWLLYD 629

Query: 1249 DETVSEVPDEEVFNFT--EGNTATPYFLVY 1276
            DETV  V +++V        + AT Y L Y
Sbjct: 630  DETVEAVLEKDVLRHVGDSNDLATAYILFY 659

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 5/108 (4%)

Query: 1191 IYNQIT-QLEETISHQFEQFKKVGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYN 1248
            ++N+IT  L   ++ +F+      Y L  V +H G    +GHY    K    N  W  ++
Sbjct: 571  LFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGGGPQHGHYVSVCK--TDNFGWLFFD 628

Query: 1249 DETVSEVPDEEVFNFTEGNTATPY-FLVYVKEGSEKDIEPLKRIIEES 1295
            DETV  + + +V NFT   T +   ++++ KE  E D E  K +   S
Sbjct: 629  DETVETLDEPQVLNFTGDTTTSTTAYVLFYKETDEGDDEFGKTVTHSS 676

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYED 789
           G  N GNTCY NS+LQ  F+++  R  +L + +   D
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQFPERAPD 151

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            Y L  V  H+G  + GHY    K   +   W K+ND  VS V  EE  N
Sbjct: 403  YELIGVVAHKGTVNEGHYVATTKVAGRQ--WFKFNDSMVSSVTQEEALN 449

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFY 791
           G  N GNTCY NS+LQ  +++  LR ++L Y       Y
Sbjct: 144 GYENFGNTCYCNSVLQVLYNLPELRVHLLEYPARPASLY 182

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKT 799
            G+ N GNTCY+NS++Q  F    LR+  +     Y+DF   K++A+T
Sbjct: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFIS-EXXYKDF--IKKDAET 282

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYD 792
           TG+ N+G TCY+NS+LQ  F+ +  R+  L     YE F++
Sbjct: 599 TGLRNLGATCYINSMLQCLFATNMFRD--LFEPSNYERFFN 637

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 36.6 bits (83), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            Y L  +  H G  + GHY  + K   +NG W K+ND  V+++ +++V           Y 
Sbjct: 401  YELIGIISHTGSVNEGHYVAFCKI--ENGEWFKFNDSMVTKILEKDVLK------EQAYL 452

Query: 1274 LVYV 1277
            L Y+
Sbjct: 453  LFYI 456

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 37.0 bits (84), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVL--GYSK 785
           G++N+GNTCY+NS LQ    I  LR+Y    GY +
Sbjct: 290 GLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQ 324

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDF 790
           TG+ N+GNTCY+NS+LQ  F+    R+  L  S  ++ F
Sbjct: 678 TGLRNLGNTCYINSMLQCLFATRLFRD--LFISSKFQSF 714

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAK 798
           TG+ N+GNTCY+NS++Q  F+    R   L  S  Y+ +    R  +
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFR--TLFISSKYKSYLQQSRGNR 646

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIR 801
           TG+ N  NTCY+NS++Q  F  +P R+  L  +K Y  F   +   K ++
Sbjct: 292 TGLQNPCNTCYINSIIQCLFGSTPFRDLFL--TKKYRLFLKTEEYPKEVQ 339

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 1198 LEETISHQFEQFKKVGYSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVP 1256
            L+  +S  F       Y L  + +H G    +GHY    K  N+   W  ++DETV  + 
Sbjct: 597  LDLKVSSTFNPSISKNYELSGIVVHMGGGPQHGHYISLCK--NEKFGWLLFDDETVEAIS 654

Query: 1257 DEEVFNFT-EGNTATPYFLVYVKEGSEKDI 1285
            ++ V  +T + +T T  ++++ +E  ++ I
Sbjct: 655  EQAVLQYTGDKDTMTTAYVLFYQESQKEGI 684

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  +++   R  +L Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDF 790
           TG+ N+GNTCY+NS++Q  F+    R   L  S  Y+++
Sbjct: 598 TGLRNLGNTCYINSMIQCLFAAKTFR--TLFISSNYKNY 634

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVL 781
           TG+ N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFL 775

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 40/95 (42%), Gaps = 24/95 (25%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATP-- 1271
            Y L  V +H G+ S GHY+  IK   ++  W +++D+ V     +++F+   G    P  
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPSTKDE-WYRFDDDRVWRATKKQIFDDNFGFDRLPDE 498

Query: 1272 ---------------------YFLVYVKEGSEKDI 1285
                                 Y LVY+ E  E++I
Sbjct: 499  KIRTMTREQYQDYLIQRHTNAYMLVYIAEEKEEEI 533

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRN 796
           TG+ N+GNTCY+NS++Q  F+    R   L  S  Y+ +    R+
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFR--TLFISSKYKSYLQPIRS 651

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 36.2 bits (82), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVL--GYSK 785
           G++N+GNTCY+NS LQ    I  +R+Y +  G+ K
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEK 356

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 42/85 (49%), Gaps = 11/85 (12%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDY-NQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPY 1272
            Y L AV  H G    GHY  Y+K+  +QN  W  ++D  VS+   E+          + Y
Sbjct: 983  YDLIAVDNHYGGMGGGHYTAYVKNLTDQN--WYYFDDSRVSKTSPEKSI------AGSAY 1034

Query: 1273 FLVYVKEGSEKDIEP--LKRIIEES 1295
             L Y++ GS  +I+   LK II+ S
Sbjct: 1035 LLFYLRRGSLNNIDSKRLKDIIDTS 1059

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVL 781
           G+ N+GNTCY+NS LQ    I   R+Y L
Sbjct: 331 GLTNLGNTCYMNSALQCITHIPIFRDYFL 359

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 19/93 (20%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDN 811
           TG+ N  NTCY+NS++Q  F  +  R+  L  +K Y  F +  +  K +           
Sbjct: 298 TGLQNPCNTCYINSIIQCLFGTTLFRDLFL--TKKYRLFLNTNKYPKEV----------- 344

Query: 812 EVERSIQFIYQLRDLFYAMIYTNKRCVTPRREL 844
           ++ RSI        LF  M     R + P R L
Sbjct: 345 QLSRSIYV------LFKKMYLNGGRAIIPNRFL 371

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 1214 YSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT-EGNTATP 1271
            Y L  + +H G    +GHY    K  N N  W  ++DETV  V ++ V +F  + +T T 
Sbjct: 658  YELSGIVVHMGGGPQHGHYVSLCK--NDNFGWLLFDDETVESVSEKTVLDFVGDSSTLTT 715

Query: 1272 YFLVYVKE 1279
             ++++ +E
Sbjct: 716  AYVLFYRE 723

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 9/50 (18%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRR 802
           G  N GNTCY NS+LQ  ++++  R  +L +          +RN+ T R+
Sbjct: 132 GFENFGNTCYCNSVLQCLYNMTEFRIQMLQH---------PERNSNTRRK 172

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 6/51 (11%)

Query: 739 VIDPSCLPVENWPTGIN------NIGNTCYLNSLLQYYFSISPLREYVLGY 783
           +I PS  P+  +  G N      N GNTCY NS+LQ  +++  LR  +L +
Sbjct: 124 LIKPSVTPLLPYGDGSNKVFGYENFGNTCYCNSVLQVIYNLPELRVNLLEF 174

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 35.8 bits (81), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIR 801
           TG+ N  NTCY+NS++Q  FS +  R+  L  +K Y+ F + ++  K ++
Sbjct: 296 TGLRNPCNTCYINSMVQCLFSTTLFRDLFL--TKKYKLFLENEKYPKGLQ 343

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  ++++  R  +L Y
Sbjct: 116 GYENFGNTCYCNSVLQCLYNLTEFRTEILKY 146

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  ++++  R  VL Y
Sbjct: 147 GYENFGNTCYCNSVLQCLYNLTEFRLNVLQY 177

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 1214 YSLFAVFIHRGEA-SYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFT-EGNTATP 1271
            Y L  + +H G    +GHY    K  N N  W  ++DETV  V +  V  F  + ++ T 
Sbjct: 615  YELTGIVVHMGGGPQHGHYVSLCK--NDNFGWLLFDDETVEAVHESTVSKFIGDRDSLTT 672

Query: 1272 YFLVYVKEGSEKDIEPLKR 1290
             ++++ KE ++ + + L R
Sbjct: 673  AYVLFYKEIAQSENQDLSR 691

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  ++++  R  +L +
Sbjct: 125 GYENFGNTCYCNSVLQCLYNLTEFRLLLLQH 155

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 8/70 (11%)

Query: 1214 YSLFAVFIHRGEAS-YGHYW--VYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTE--GNT 1268
            Y L  V  H G +S  GHY   VY K++N+   W + +D  ++E+ D++V    E   ++
Sbjct: 841  YKLTGVIYHHGVSSDGGHYTADVYHKEHNK---WYRIDDVNITELEDDDVLKGGEEASDS 897

Query: 1269 ATPYFLVYVK 1278
             T Y L+Y K
Sbjct: 898  RTAYILMYQK 907

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 1203 SHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVF 1261
             H  E    + Y L  V  H G  + GHY   +K  + N  W K+ND  V+ + +EEV 
Sbjct: 369  CHTEENNSSIIYELNGVISHIGTVNEGHYIATLKLDSNN--WFKFNDSMVTSISEEEVL 425

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGY 783
           G  N GNTCY NS+LQ  ++++ LR  +L +
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNILQF 547

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 746 PVENWPTGINNIGNTCYLNSLLQYYFS 772
           P  N+  G+ N+GN+CYLNS+LQ  F+
Sbjct: 313 PNGNFGCGLINLGNSCYLNSILQALFA 339

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 771

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
            Y L +V +H G  +YGHY  + +     G W + +DE+V  V ++EV +
Sbjct: 681  YVLRSVIVHYGTHNYGHYIAFRR---FRGCWWRISDESVYIVDEQEVLS 726

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 18/21 (85%)

Query: 752 TGINNIGNTCYLNSLLQYYFS 772
            G+NN+GN+CY+NS+LQ  F+
Sbjct: 313 CGLNNLGNSCYMNSVLQVLFN 333

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 13/111 (11%)

Query: 1163 QGIVFEG-QDELSTILKKAGTDID-DELSTIYNQITQLEETI---------SHQFEQFKK 1211
            +G++FE     L   LK+   D + D+L  I N   +  ETI         S Q    + 
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKI-NDRYEFPETIDVSPYIEKGSEQLSNKEA 438

Query: 1212 VGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN 1262
              Y+L  V +H G+ S GHY+  I+    +  W +++D+ V  V  ++ F+
Sbjct: 439  CIYNLHGVLVHAGDISTGHYYTMIRP-GVSDEWYRFDDDKVWRVTKKQAFD 488

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 16/29 (55%)

Query: 752 TGINNIGNTCYLNSLLQYYFSISPLREYV 780
            G  N G TCYLNSLLQ YF     R  V
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLV 231

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYED 789
           G  N GNTCY NS+LQ  + +   R  VL Y +  E+
Sbjct: 162 GYENFGNTCYCNSVLQCLYHLPEFRLRVLEYPEKPEE 198

>TBLA0J00260 Chr10 (45003..47126) [2124 bp, 707 aa] {ON} Anc_7.514
            YLR452C
          Length = 707

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 11/96 (11%)

Query: 1138 NEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQ 1197
            NE  +   +AY E   FL+  AL L+ I+    ++L   + + G   +       N IT 
Sbjct: 462  NEFCVENLDAYIEIRKFLKQMAL-LKKIIDSKNNKLKRKVGRGGQSGN-------NIITT 513

Query: 1198 LEETISHQFEQFKKVGYSLFAVFIHRG---EASYGH 1230
            +E  +  Q  Q  ++GY L+++FI  G   + + GH
Sbjct: 514  IESALGKQANQCLEMGYHLYSLFIMIGAPYQINIGH 549

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
            YBR058C
          Length = 780

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 1214 YSLFAVFIHRGEASY-GHYWVYI-KDYNQNGIWRKYNDETV 1252
            Y L AV  H+G +++ GHY  +I K   Q   W  YNDE +
Sbjct: 717  YKLVAVVCHKGNSAHSGHYVAFIRKSVEQEEKWVLYNDEKI 757

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 8/64 (12%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            Y L AV  H G  + GHY    K     G W ++ND  +  + +EE            Y 
Sbjct: 394  YELVAVISHEGSVNQGHYTSMCKI--PGGQWFRFNDSMIVSISEEEALR------QQAYL 445

Query: 1274 LVYV 1277
            L YV
Sbjct: 446  LFYV 449

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNG-IWRKYNDETVSEVPDEEVFNFTEGNTATPY 1272
            Y L A+  H G    GHY    +    NG IW K+ND  V+ + +E++           Y
Sbjct: 409  YKLSAIISHHGTVHQGHYTTICRI---NGDIWAKFNDSMVTVISEEDMLK------EQAY 459

Query: 1273 FLVYV 1277
             L YV
Sbjct: 460  LLYYV 464

>KNAG0C04580 Chr3 (900175..901701) [1527 bp, 508 aa] {ON} Anc_5.487
           YOR149C
          Length = 508

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 199 TVKTRQLLEVSKKQAGITQ-YHLLDFEDLHHFDKRDLMTFDP 239
           +VKTR +  +++    +T+ YH  D  DL HFD  DL TF P
Sbjct: 456 SVKTRLMRYLNETSFKVTEDYHTFDHLDLDHFDVADLTTFIP 497

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
            (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 6/66 (9%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            Y+L+AV  H G    GHY  Y+   ++NG W  ++D    +   E+     E  T + Y 
Sbjct: 361  YNLYAVACHFGTLYGGHYTAYVNKEDKNG-WCYFDDTCWRKAKSED-----ECITTSAYV 414

Query: 1274 LVYVKE 1279
            L Y ++
Sbjct: 415  LFYHRK 420

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 26/63 (41%), Gaps = 8/63 (12%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            Y L  V  H G  + GHY    K  N    W K+ND  ++ V +E V           Y 
Sbjct: 403  YELIGVICHTGTVNEGHYICSCKLANNQ--WVKFNDSMITIVDNETVLK------EQAYL 454

Query: 1274 LVY 1276
            L+Y
Sbjct: 455  LIY 457

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 1212 VGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTE--GNTA 1269
              Y L  V  H G +S G ++     +     W + +D TV+E+  EEV    E   ++ 
Sbjct: 765  TSYKLTGVVYHHGLSSSGGHYTADVLHQDEEKWYRIDDTTVTEINKEEVVTGGEEGSHSR 824

Query: 1270 TPYFLVY 1276
            T Y L+Y
Sbjct: 825  TAYILIY 831

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
           Anc_2.69 YNL186W
          Length = 746

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 54/123 (43%), Gaps = 34/123 (27%)

Query: 677 QALGILQVNENANDEV-------ILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNSK 729
           + L  ++ NE  N +V       IL NF    FNE + +             +G  ++S+
Sbjct: 244 EKLKKMEANEKKNAKVVEPINSEILSNFYQ--FNEDVDD-------------IGTNKDSR 288

Query: 730 LINNF--LMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTY 787
           +I N+  +++G+           P G+ N G TCY N+ +Q    I  ++ Y+    +  
Sbjct: 289 IIKNWGPILSGLK----------PCGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRNN 338

Query: 788 EDF 790
           +D+
Sbjct: 339 KDY 341

>KLTH0A02046g Chr1 (179012..180424) [1413 bp, 470 aa] {ON} similar
           to uniprot|P43589 Saccharomyces cerevisiae YFR005C SAD1
           Conserved zinc-finger domain protein involved in
           pre-mRNA splicing required for assembly of U4 snRNA into
           the U4/U6 particle
          Length = 470

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%)

Query: 741 DPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTI 800
           D S  P  N   G+N++G+  +L+ ++Q    I+P+R++ L  S++  D    KR A  I
Sbjct: 143 DKSNTPYINGFIGLNDLGDNTHLSVIIQMMAHITPIRDFFLLESQSKIDDELIKRLALLI 202

Query: 801 RRIGGREV 808
           +++    +
Sbjct: 203 KKLWSPHI 210

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 8/66 (12%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273
            Y L  V  H G  + GHY   ++    +G W K+ND  +S V  E+V           Y 
Sbjct: 396  YRLSGVVSHSGTVNEGHYTAVLQ--LNSGEWFKFNDSMISVVSAEDVLR------EQAYL 447

Query: 1274 LVYVKE 1279
            L+Y  E
Sbjct: 448  LLYTVE 453

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNE 812
           G+ N+GN+CYLN ++Q       L +  L YS  +E + +         ++G + V    
Sbjct: 748 GLQNMGNSCYLNCIIQCLLGTHELTKIFLNYS--FERYINLN------SKLGSKGVLAKN 799

Query: 813 VERSIQFIY 821
           + + I  +Y
Sbjct: 800 LSKLIHLMY 808

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
            to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
            Ubiquitin-specific protease that specifically
            disassembles unanchored ubiquitin chains
          Length = 770

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 1214 YSLFAVFIHRGEASY-GHYWVYIKDYNQNG-IWRKYNDETVSEVPDEEVFNFTEGNTATP 1271
            Y L AV  H+G + + GHY  +IK   +    W  YNDE +    DE  F   E N    
Sbjct: 705  YKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFEDIEKNGYMF 764

Query: 1272 YF 1273
            +F
Sbjct: 765  FF 766

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
            UBP3Ubiquitin-specific protease involved in transport and
            osmotic response; interacts with Bre5p to co-regulate
            anterograde and retrograde transport between the ER and
            Golgi; involved in transcription elongation in response
            to osmostress through phosphorylation at Ser695 by Hog1p;
            inhibitor of gene silencing; cleaves ubiquitin fusions
            but not polyubiquitin; also has mRNA binding activity
          Length = 912

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 8/70 (11%)

Query: 1214 YSLFAVFIHRGEAS-YGHYW--VYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTE--GNT 1268
            Y L  V  H G +S  GHY   VY  ++N+   W + +D  ++E+ D++V    E   ++
Sbjct: 844  YKLTGVIYHHGVSSDGGHYTADVYHSEHNK---WYRIDDVNITELEDDDVLKGGEEASDS 900

Query: 1269 ATPYFLVYVK 1278
             T Y L+Y K
Sbjct: 901  RTAYILMYQK 910

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 20/24 (83%)

Query: 745 LPVENWPTGINNIGNTCYLNSLLQ 768
           LP +++  G+ N+GN+CYLNS+LQ
Sbjct: 316 LPNKDYGCGLINLGNSCYLNSVLQ 339

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGN--TATP 1271
            Y L  V  H G +  G ++     + Q   W + +D  +SE+ ++ V +  + +  T T 
Sbjct: 849  YKLTGVIYHHGSSPDGGHYTADVFHQQTNKWYRIDDVNISELKNDHVLDADDNDMGTRTA 908

Query: 1272 YFLVYVKE 1279
            Y L+Y K+
Sbjct: 909  YILIYEKK 916

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
            YER151C (REAL)
          Length = 910

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 8/71 (11%)

Query: 1214 YSLFAVFIHRGEAS-YGHYW--VYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTE--GNT 1268
            Y L  V  H G  S  GHY   VY  ++N+   W + +D  ++E+ D++V    E   ++
Sbjct: 842  YKLTGVIYHHGVGSDGGHYTADVYHSEHNK---WYRIDDVNITELEDDDVLKGGEEASDS 898

Query: 1269 ATPYFLVYVKE 1279
             T Y L+Y K+
Sbjct: 899  RTAYILMYQKK 909

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
            {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
            YML081W Hypothetical ORF
          Length = 1238

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 46/94 (48%), Gaps = 9/94 (9%)

Query: 1098 YMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLSRKEAYSETVNFLQS 1157
            +   + D    EIL+  +RT  +K+E++ LKK +Q LL +        ++Y+E +    +
Sbjct: 1106 WAKEFTDKQTAEILKAVDRTLWLKSEII-LKKVEQHLLPKG----YNMQSYAEFLRLQAN 1160

Query: 1158 NALQLQGIVFEGQDELSTILKKAGTDIDDELSTI 1191
             AL ++ +     DEL+       TDI + +  I
Sbjct: 1161 GALDVEVL----DDELARKAMNPSTDISETVGVI 1190

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 753 GINNIGNTCYLNSLLQYYFSISPLREYVLGYSK 785
           G  N GNTCY NS+LQ  F +   R  +L + +
Sbjct: 123 GYENFGNTCYCNSILQCLFFLDDFRIDILKHPR 155

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 1210 KKVGYSLFAVFIHRG-EASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTE--G 1266
            K   Y L  V  H G   S GHY   +    Q+  W + +D  V+E+  E+VF   +   
Sbjct: 719  KDTTYRLTGVVYHHGLSPSGGHYTADVLHQTQDK-WYRIDDNNVTEIRQEDVFKRGDEAS 777

Query: 1267 NTATPYFLVY 1276
            ++ T Y L+Y
Sbjct: 778  DSKTAYILIY 787

>Kpol_1039.38 s1039 (119085..121562) [2478 bp, 825 aa] {ON}
           (119085..121562) [2478 nt, 826 aa]
          Length = 825

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 45/99 (45%), Gaps = 13/99 (13%)

Query: 715 YKCALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSIS 774
           YK    + G++ NS LINN    GV+    L +E +   +N I  T Y+ +  + +    
Sbjct: 516 YKMMFERKGIKSNSSLINNLSALGVVSQEKL-IECYSNFVNEIEKTTYVAT--EDFLPPE 572

Query: 775 PLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEV 813
            L +Y++  +  +E +           + GGRE   NE+
Sbjct: 573 WLSDYLVKITDLFEAY----------EQHGGRESDTNEI 601

>KLLA0D06171g Chr4 complement(528904..531318) [2415 bp, 804 aa] {ON}
           similar to uniprot|P15274 Saccharomyces cerevisiae
           YML035C AMD1 AMP deaminase tetrameric enzyme that
           catalyzes the deamination of AMP to form IMP and ammonia
           may be involved in regulation of intracellular adenine
           nucleotide pools
          Length = 804

 Score = 32.7 bits (73), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 252 SSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFD--TLDPEAVPTGIDCLN 309
           S D+  L L+E++S+  D RE RE +QT +++  +Q    + D     P   P+      
Sbjct: 173 SYDSPSLELVELYSSVSDCRELREKYQTLSLQKHHQNPKNRPDWKIYPPPPKPSYNAANK 232

Query: 310 TVLKLLKQP 318
           TV+K+   P
Sbjct: 233 TVVKVSNLP 241

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 32.3 bits (72), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 66/151 (43%), Gaps = 22/151 (14%)

Query: 696 NFQTKWFNEQIHEADQFLN--YKCALMKLGLERNSKLINNFLMN--GVIDPSCLP--VEN 749
           N+   W    +    Q L      AL+ L L   S  + N+L++  G+   S  P  ++ 
Sbjct: 14  NYNRTWLELFLQRKGQLLRKITYTALLGLSLYVISPTVVNYLLSVLGLEKGSKGPKRLDK 73

Query: 750 WPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIRRIGGREVG 809
           + TG+ N GN C++NS +Q   ++ PL +     S T ED    ++ A T+    G    
Sbjct: 74  FTTGLVNPGNDCFINSSIQ---ALVPLDKLTTYLSATLED----EKTASTLPLHNGLATM 126

Query: 810 DNEVER---------SIQFIYQLRDLFYAMI 831
             E+++         S +FI QL  +F   I
Sbjct: 127 LLELQQLRSDPKSVSSKRFIQQLETIFGGKI 157

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 32.3 bits (72), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTE--GNTATP 1271
            Y L  V  H G +S G ++     + ++  W + +D ++ E+  E+V    E  G++ T 
Sbjct: 759  YHLTGVIYHHGVSSDGGHYTADVYHRESDKWYRIDDVSIIELEKEDVLKGGEESGDSRTA 818

Query: 1272 YFLVYVK 1278
            Y L+Y K
Sbjct: 819  YILMYQK 825

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 147,377,977
Number of extensions: 7267409
Number of successful extensions: 32333
Number of sequences better than 10.0: 362
Number of HSP's gapped: 33385
Number of HSP's successfully gapped: 474
Length of query: 1295
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1173
Effective length of database: 39,492,147
Effective search space: 46324288431
Effective search space used: 46324288431
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)