Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C014105.473ON36936918290.0
YOR136W (IDH2)5.473ON36936916190.0
NCAS0H022505.473ON42236916230.0
Smik_15.3165.473ON36936916140.0
Suva_8.1885.473ON36936916030.0
Skud_15.3005.473ON36936915990.0
SAKL0G03520g5.473ON36936915960.0
CAGL0I07227g5.473ON36836315670.0
KNAG0B040705.473ON37337315600.0
KLTH0F15048g5.473ON36836915330.0
Kwal_55.212735.473ON36836915320.0
Ecym_23135.473ON37037115270.0
KLLA0E03125g5.473ON36836915220.0
TDEL0A033705.473ON37137115180.0
Kpol_440.125.473ON36836915040.0
AFR137C5.473ON36736914790.0
TBLA0B022405.473ON37337314640.0
Kpol_543.85.473ON36836914470.0
ZYRO0D11220g5.473ON36836914440.0
KAFR0B063705.473ON37836314420.0
TPHA0J027705.473ON37637714270.0
TPHA0E014805.473ON37735812821e-177
ADL223W2.278ON3623727143e-91
Ecym_33162.278ON3623727049e-90
KLLA0F04103g2.278ON3613436988e-89
Smik_14.2902.278ON3603436943e-88
Skud_14.2932.278ON3613436831e-86
YNL037C (IDH1)2.278ON3603436812e-86
NDAI0B035902.278ON3593516761e-85
ZYRO0D02838g2.278ON3613446762e-85
TBLA0B069102.278ON3653776719e-85
Kwal_23.50122.278ON3613456673e-84
KLTH0G10186g2.278ON3603456674e-84
SAKL0E07876g2.278ON3613746656e-84
Kpol_1039.352.278ON3593726622e-83
NCAS0B062902.278ON3593726587e-83
KNAG0A052802.278ON3613636482e-81
CAGL0G02673g2.278ON3583676473e-81
TPHA0D015602.278ON3603626387e-80
TDEL0C038402.278ON3613476371e-79
KAFR0J014102.278ON3503716012e-74
Suva_14.3022.278ON3002855381e-65
TBLA0B059402.287ON3693864263e-48
CAGL0G02585g2.287ON3723544212e-47
YIL094C (LYS12)2.287ON3713904169e-47
Smik_9.852.287ON3713904151e-46
KNAG0A054202.287ON3723604142e-46
Kpol_1003.392.287ON3703904114e-46
Skud_9.792.287ON3713904115e-46
Suva_9.1052.287ON3713904115e-46
NCAS0B062502.287ON3733854106e-46
NDAI0B035502.287ON3723864108e-46
SAKL0E07656g2.287ON3683723951e-43
TPHA0C034102.287ON3713793932e-43
ZYRO0A01914g2.287ON3683903922e-43
ADL214C2.287ON3673543897e-43
TDEL0G021802.287ON3693903844e-42
Ecym_33262.287ON3663663844e-42
KLLA0E08339g2.287ON3693543844e-42
KAFR0J013602.287ON3733893741e-40
Kwal_27.115282.287ON3673583582e-38
KLTH0G10384g2.287ON3673543583e-38
AAL012C1.402ON3723522292e-20
Ecym_12961.402ON3632722204e-19
KAFR0I022001.402ON3653622109e-18
TBLA0C015001.402ON3652722099e-18
ZYRO0E04796g1.402ON3622662091e-17
NDAI0G042301.402ON3632662054e-17
Skud_3.431.402ON3643542028e-17
TDEL0B060001.402ON3623032001e-16
YCL018W (LEU2)1.402ON3643511992e-16
Smik_3.661.402ON3643511974e-16
NCAS0C048701.402ON3653551974e-16
KLLA0D04906g1.402ON3623051965e-16
KNAG0I012801.402ON4473931922e-15
CAGL0H03795g1.402ON3653591903e-15
Suva_3.31.402ON3643521895e-15
Kwal_0.2251.402ON3643551861e-14
SAKL0D08690g1.402ON3642671842e-14
Kpol_1048.631.402ON3643051791e-13
KLTH0H12188g1.402ON3643491772e-13
TPHA0B037301.402ON3653501664e-12
Suva_14.303singletonON53511134e-07
NCAS0A052504.152ON19534711.4
KNAG0H010303.302ON443116694.6
TDEL0A042205.559ON1334135686.3
ADR028W3.425ON83258687.2
KLTH0G12474g8.314ON22992667.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C01410
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   709   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   628   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    629   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   626   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   622   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   620   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   619   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   608   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   605   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   595   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   594   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   592   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   590   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   589   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   583   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   574   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   568   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   561   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   560   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   560   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   554   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   498   e-177
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   279   3e-91
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   275   9e-90
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   273   8e-89
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   271   3e-88
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   267   1e-86
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   266   2e-86
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   265   1e-85
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   265   2e-85
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            263   9e-85
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   261   3e-84
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   261   4e-84
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   260   6e-84
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   259   2e-83
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   258   7e-83
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              254   2e-81
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   253   3e-81
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   250   7e-80
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   249   1e-79
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   236   2e-74
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   211   1e-65
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   168   3e-48
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   166   2e-47
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   164   9e-47
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   164   1e-46
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              164   2e-46
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   162   4e-46
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   162   5e-46
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   162   5e-46
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   162   6e-46
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   162   8e-46
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   156   1e-43
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   155   2e-43
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   155   2e-43
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   154   7e-43
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   152   4e-42
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   152   4e-42
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   152   4e-42
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   148   1e-40
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   142   2e-38
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   142   3e-38
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    93   2e-20
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    89   4e-19
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    86   9e-18
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    85   9e-18
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    85   1e-17
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    84   4e-17
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    82   8e-17
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    82   1e-16
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    81   2e-16
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    80   4e-16
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    80   4e-16
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    80   5e-16
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    79   2e-15
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              78   3e-15
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       77   5e-15
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    76   1e-14
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    75   2e-14
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    74   1e-13
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    73   2e-13
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    69   4e-12
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    48   4e-07
NCAS0A05250 Chr1 (1038189..1038776) [588 bp, 195 aa] {ON} Anc_4....    32   1.4  
KNAG0H01030 Chr8 complement(172427..173758) [1332 bp, 443 aa] {O...    31   4.6  
TDEL0A04220 Chr1 complement(748109..752113) [4005 bp, 1334 aa] {...    31   6.3  
ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic ho...    31   7.2  
KLTH0G12474g Chr7 (1059087..1059776) [690 bp, 229 aa] {ON} simil...    30   7.8  

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/369 (95%), Positives = 351/369 (95%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV
Sbjct: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           LNVVSNPSSYSNAVSVCPNLYGDI                  ANIGHEVSIFEAVHGSAP
Sbjct: 241 LNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360

Query: 361 FTDAVIGRL 369
           FTDAVIGRL
Sbjct: 361 FTDAVIGRL 369

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/369 (81%), Positives = 331/369 (89%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M RN   RNT+RRFL+   QPSIG++TGKPNPSTGK+TVSFIEGDGIGPEIS+SVK+IF 
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VPI+WE CDVSP+F+NGLTTIP+PAVQSI KNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSIEGFKT Y+NVDLV+IRENTEGEYSGIEH+V PGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYA+EYARAIGRPRVIVVHKSTIQRLADGLFV+VAKELS+EYPD+ LETELIDN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSV 240

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           L VV+NPS+Y++AVSVCPNLYGDI                  ANIGH++SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGL NHAD+I+ AVLSTIASGPE RTGDLAG ATTSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTDAVIGRL 369
           FT+AVI RL
Sbjct: 361 FTEAVIKRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/369 (82%), Positives = 333/369 (90%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFR+ ILR TTRR LSVK+QPSIGK+TGKPNPSTGK+TVSFIEGDGIGPEIS SVKQIF 
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AAKVPI+WE CDV+PLFI+GLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 114 AAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 173

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFANVRPA+S++GFKT Y NVDLV+IRENTEGEYSGIEHVVTPGVVQSIKLITR+AS
Sbjct: 174 TFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREAS 233

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYA+EY RAIGRPR++VVHKSTIQRL+DGLFV+VAKELS+EYPDIQ ETELIDNTV
Sbjct: 234 ERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTV 293

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           L VVSNPSSY++AVSVCPNLYGDI                   NIG+E+SIFEAVHGSAP
Sbjct: 294 LKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAP 353

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAG+N ANPTALLLSSVMMLNHMGL+ HAD+IE AVLSTIASGPE RTGDLAG ATTS+
Sbjct: 354 DIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTST 413

Query: 361 FTDAVIGRL 369
           FTDAVI +L
Sbjct: 414 FTDAVIKKL 422

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/369 (81%), Positives = 331/369 (89%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M RN   RNT+RRFL+   QPSIGK+TGKPNPSTGK+TVSFIEGDGIGPEIS+SVK+IF 
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VPI+WE CDV+P+F+NGLTTIP+PAVQSI KNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EGFKT Y+NVDLV+IRENTEGEYSGIEH+V PGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYA+EYARAIGRPRVIVVHKSTIQRLADGLFV+VAKELS+EYPDI LETELIDN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELIDNSV 240

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           L VV+NPS+Y+NAVSVCPNLYGDI                  ANIGH++SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGL N+AD+I+ AVLSTIASGPE RTGDLAG ATTSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSS 360

Query: 361 FTDAVIGRL 369
           FT+AVI RL
Sbjct: 361 FTEAVIKRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/369 (81%), Positives = 331/369 (89%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M RN  LRNT+RRFLS   QPSIG++TGKP+PSTG++TVSFIEGDGIGPEIS+SVK+IF 
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VPI+WE CDV+P+F+NGLTTIP+PAVQSI KNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSIEGFKT Y+NVDLV+IRENTEGEYSGIEH+V PGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYA+EYARAIGRPR+IVVHKSTIQRLADGLFV+VAKELS+EYPDI  ETELIDN V
Sbjct: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           LNVV+NPS+Y+NAVSVCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 241 LNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAG++KANPTALLLSSVMMLNHMGL +HAD+I+ AVLSTIASGPE RTGDLAG ATTSS
Sbjct: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTDAVIGRL 369
           FT+AVI RL
Sbjct: 361 FTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/369 (80%), Positives = 331/369 (89%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M R+ + RNT+RRFL+   QPSIG+FTGKPNPSTG++TVSFIEGDGIGPEIS+SVK+IF+
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VPI+WE CDV+P+F+NGLTTIP+ AVQSI  NL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EGFKT Y+NVDLV+IRENTEGEYSGIEH+V PGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYA+EYARAIGRPRVIVVHKSTIQRLADGLFV+VAKELS+EYPDI LETELIDN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           L VV+NPS+Y+NAVSVCPNLYGDI                  ANIGH++SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAGQ+KANPTALLLSSVMMLNHMGL NHAD+I+ AVLSTIASGPE RTGDLAG ATTSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTDAVIGRL 369
           FT+AVI RL
Sbjct: 361 FTEAVIKRL 369

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/369 (80%), Positives = 327/369 (88%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M R+ +LR   RRFLS K QPSIG+FTGKPNPSTGK+TVSFIEGDG+GPEIS+SVK IF 
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA+VP++WE CDV+PLFINGLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS+EGFKT Y+NVDLV+IRENTEGEYSGIEHVV+PGVVQSIKLITRDAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYA+EYARA+GRP+V+VVHKSTIQRLADGLFVDVAKELS EYPDIQL+ +L+DNTV
Sbjct: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           LNVVSNP +Y++ VSVCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 241 LNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGL   AD IEKAVLSTIASGPE RT DLAG A+TSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360

Query: 361 FTDAVIGRL 369
           FT+AVI RL
Sbjct: 361 FTEAVIKRL 369

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/363 (81%), Positives = 321/363 (88%), Gaps = 1/363 (0%)

Query: 7   LRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPI 66
            R   RRFL+   QPSIG+FTGKPNPSTGKFTVSFIEGDGIGPEIS SVK+IF AA VP+
Sbjct: 7   FRLNARRFLATA-QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRIFQAADVPV 65

Query: 67  DWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFA 126
           +WE CDV+P+F+NGLTTIP+PAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTF LFA
Sbjct: 66  EWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFNLFA 125

Query: 127 NVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRY 186
           NVRPAKSIEGFKT Y+NVDLV+IRENTEGEYSGIEH+V+PGVVQSIKLITRDASERVIRY
Sbjct: 126 NVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRDASERVIRY 185

Query: 187 AYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSN 246
           AYEYARAIGRPR+IVVHKSTIQRLADGLFV+VAKEL+ EYPDIQLETELIDNT LNVVSN
Sbjct: 186 AYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELIDNTCLNVVSN 245

Query: 247 PSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQN 306
           PSSY++AVSVCPNLYGDI                  ANIGH+VSIFEAVHGSAPDIAGQN
Sbjct: 246 PSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQN 305

Query: 307 KANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVI 366
           KANPTALLLSSVMMLNHMG+  HAD+IEKAVL TIA G E RTGDL G A+T+SFTDA+I
Sbjct: 306 KANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAII 365

Query: 367 GRL 369
            +L
Sbjct: 366 KKL 368

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/373 (80%), Positives = 328/373 (87%), Gaps = 4/373 (1%)

Query: 1   MFRNIILRN--TTRRFL--SVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVK 56
           M RN +LRN  T RRFL  SVKNQPSIG+FTGKPNP+TGKF VSFIEGDGIGPEISQSVK
Sbjct: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60

Query: 57  QIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNL 116
            IF AA+VPI+WE CDV+P+F+NGLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120

Query: 117 TLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLIT 176
           TLRKTF LFANVRPAKSIEGFKT Y +VDLV+IRENTEGEYSGIEHVV PGVVQSIKLIT
Sbjct: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 177 RDASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELI 236
           RDASERVIRYA+EYA+AIGRPRV+VVHKSTIQRLADGLFV+VAKELS+EYP+I+LETELI
Sbjct: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240

Query: 237 DNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVH 296
           DNTVLNVVSNP+ Y++AVSVCPNLYGDI                  ANIG+E+SIFEAVH
Sbjct: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVH 300

Query: 297 GSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKA 356
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL + A +IE+AVL+TIAS  + RTGDL G A
Sbjct: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360

Query: 357 TTSSFTDAVIGRL 369
           TTSSFTDAVI  L
Sbjct: 361 TTSSFTDAVIKNL 373

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/369 (76%), Positives = 322/369 (87%), Gaps = 1/369 (0%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MF++  +RN+ R FL+ K QPSIG++TGKP+P+TGK+TVSFIEGDG+GPEIS++VK IF 
Sbjct: 1   MFKSSFVRNSAR-FLATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AAK PI WE CDVSPLFINGLTTIP+PA  SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFANVRPAKS++G+KT YDNVDLV+IRENTEGEYSGIEHVV+PGVVQSIKLIT+DAS
Sbjct: 120 TFGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYA+EYARA+ RP+V+VVHKSTIQRLADGLFV VA++LS+EYPDI+L+TELIDNTV
Sbjct: 180 ERVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELIDNTV 239

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           L+ V +P+ YS+ V VCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 240 LHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGL  HADKIEKAV +TIA+GPE RTGDL G A+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSS 359

Query: 361 FTDAVIGRL 369
           F +AVI RL
Sbjct: 360 FAEAVISRL 368

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/369 (78%), Positives = 319/369 (86%), Gaps = 1/369 (0%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFR+   RNT R F + K QPSIG++TGKP+P+TGK+TVSFIEGDG+GPEIS++VK IF 
Sbjct: 1   MFRSQFGRNTLR-FFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AAK PI WE CDV+PLFINGLTTIP+PA  SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSI+GFKT YDNVDLV+IRENTEGEYSGIEHVV PGVVQSIKLIT+DAS
Sbjct: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYA+EYARA+ RP+V+VVHKSTIQRLADGLFV VA++L++EYPDI+L+TELIDNTV
Sbjct: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTV 239

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           L+ V +P  YS+ V VCPNLYGDI                  ANIGHEVSIFEAVHGSAP
Sbjct: 240 LHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGL  HADKIEKAV STIASGPE RTGDLAG A+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSS 359

Query: 361 FTDAVIGRL 369
           F +AVI RL
Sbjct: 360 FAEAVISRL 368

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/371 (77%), Positives = 323/371 (87%), Gaps = 3/371 (0%)

Query: 1   MFRNIILRNTTRRFLSV--KNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQI 58
           MF+  I + + RR+L+   + QPSIG+FTGKPNP TGK+TVSFIEGDGIGPEISQSVK I
Sbjct: 1   MFKQSIFKGS-RRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDI 59

Query: 59  FDAAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTL 118
           F AAKVP++WE CDV+P+FINGLTTIP+PAVQSINKNLVALKGPLATPIGKGHRSLNLTL
Sbjct: 60  FSAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTL 119

Query: 119 RKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRD 178
           RKTFGLFANVRPAKSIEGFKT Y+NVDLV+IRENTEGEYSGIEHVV+PGVVQSIKLITRD
Sbjct: 120 RKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRD 179

Query: 179 ASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDN 238
           ASERVIRYA+EYARA+GRP+V+VVHKSTIQRLADGLFV+VA+E+ +EYPDI+L+ ELIDN
Sbjct: 180 ASERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELIDN 239

Query: 239 TVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGS 298
           TVLNVVS P  YS++V+VCPNLYGDI                  ANIGH VSIFEAVHGS
Sbjct: 240 TVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGS 299

Query: 299 APDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATT 358
           APDIAGQN ANPTALLLSSVMMLNHMGL+ HAD+IE AVL+T+AS  + RT DLAG ATT
Sbjct: 300 APDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATT 359

Query: 359 SSFTDAVIGRL 369
           SSFT AVI RL
Sbjct: 360 SSFTKAVIERL 370

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/369 (77%), Positives = 318/369 (86%), Gaps = 1/369 (0%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFR  I++ + R FL+ K QPSIG++TGKPNP TGK+TVSFIEGDG+GPEIS+SVK IF 
Sbjct: 1   MFRQSIVKQSCR-FLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AAKVPI+WE CDVSP+F+NGLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSIEG+KT Y+NV+LV+IRENTEGEYSGIEHVV PGVVQSIKLIT+DAS
Sbjct: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYA+EYARA+ R +V+VVHKSTIQRLADGLFVDVAK+LS EYPDI+L+TEL+DNTV
Sbjct: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           L  V +P +Y + V VCPNLYGDI                  ANIGH VSIFEAVHGSAP
Sbjct: 240 LKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGL  HADKIEKAVL+TIAS  + RTGDL G A+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359

Query: 361 FTDAVIGRL 369
           FTDAVI RL
Sbjct: 360 FTDAVIERL 368

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/371 (76%), Positives = 318/371 (85%), Gaps = 2/371 (0%)

Query: 1   MFRNIILRNTTRRFLS--VKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQI 58
           M R+ I R T  R L+     QPSIGK+TGKP+P TGK+TVSFIEGDG+GPEIS+SVK I
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 59  FDAAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTL 118
           F AAKVPI WE C V+PL +NG+TTIPE A +SIN+NLVALKGPLATPIGKGHRS+NLTL
Sbjct: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120

Query: 119 RKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRD 178
           RKTFGLFANVRPAKS+EGFKT Y++VDLV+IRENTEGEY+GIEHV+ PGVVQSIKLITR+
Sbjct: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180

Query: 179 ASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDN 238
           ASERVIRYAYEYARA+GRP+++VVHKSTIQRLADGLFV VAKEL+ E+PDIQL+TELIDN
Sbjct: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240

Query: 239 TVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGS 298
           TVLNVVSNPS YS+ V VCPNLYGDI                   NIGH+VSIFEAVHGS
Sbjct: 241 TVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGS 300

Query: 299 APDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATT 358
           APDIAGQNKANPTALLLSSVMMLNHMGL  HA KIEKAVL+TIA+GPE RTGDLAG A+T
Sbjct: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360

Query: 359 SSFTDAVIGRL 369
           SSFT+AVI RL
Sbjct: 361 SSFTEAVISRL 371

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/369 (76%), Positives = 319/369 (86%), Gaps = 1/369 (0%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M RN I R +  R ++   QP+IG+FTGKPNP TGK+TV FIEGDG+GPEIS+SVK IF 
Sbjct: 1   MLRNTIYRGSFARMMTT-GQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFA 59

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AAKVPI+WEPCDV P+F+NGLTTIP+ AVQSINK+LVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TF LFANVRPA+S+  +KT Y NVDLV+IRENTEGEYSGIEHV++PGV+QSIKLIT+DAS
Sbjct: 120 TFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLITKDAS 179

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYA+EY RAIGRPR++VVHKSTIQR+ADGLFV+VAKEL+ EYPDI+L+TELIDNT+
Sbjct: 180 ERVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELIDNTI 239

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           LNVV++P SY++AVSVCPNLYGDI                  ANIG +VSIFEAVHGSAP
Sbjct: 240 LNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAGQNKANPTALLLSSVMMLNHMGLN HA KIE A+LSTIASG E RTGDLAG ATTSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSS 359

Query: 361 FTDAVIGRL 369
           FT+AVI +L
Sbjct: 360 FTEAVINKL 368

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/369 (75%), Positives = 317/369 (85%), Gaps = 2/369 (0%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M R  + + + RR+L+   QPSIG++ GKPN + GK+TVSFIEGDG+GPEISQSVK IF 
Sbjct: 1   MLRQKLFQGS-RRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VP++WE CDV+PL +NGLTTIPEPAV SINKNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFANVRPAKSIEG+KT Y +VDLV+IRENTEGEYSGIEHVV+PGVVQSIKLITR+AS
Sbjct: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIRYA+EYAR +GRP+V+VVHKSTIQRLADGLFV+VA+EL +EYPDI+L+TEL+DNTV
Sbjct: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           LNVV+ P +Y + V+VCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 239 LNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAP 298

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAGQN+ANPTALLLSSVMMLNHMGL+ HA +IEKAVLSTIAS  E RT DLAG A+TSS
Sbjct: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358

Query: 361 FTDAVIGRL 369
           FT+AVI RL
Sbjct: 359 FTNAVIERL 367

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/373 (73%), Positives = 315/373 (84%), Gaps = 4/373 (1%)

Query: 1   MFRNIILRNTTRRFLS----VKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVK 56
           M R I  + + RR  S    ++    +GK+ G PNPSTG+FTV FIEGDG+GPEIS+SVK
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 57  QIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNL 116
            IF AA+VP+DWE CDVSPL INGLTTIPEPAVQ INK+ +ALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120

Query: 117 TLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLIT 176
           TLRKTFGLFANVRPA+SI G++T Y NVDLV+IRENTEGEYSGIEHVV PGVVQSIKLIT
Sbjct: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 177 RDASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELI 236
           RDASERVIRYAYEYARAIGRPR++VVHKSTIQ+LADGLFV++AKEL+ E+PDI+LETELI
Sbjct: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240

Query: 237 DNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVH 296
           DNTVLNVV +P SY++AV+VCPNLYGDI                  ANIG+EVSIFEAVH
Sbjct: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVH 300

Query: 297 GSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKA 356
           GSAPDIAGQNKANPTALLLSS MMLN+MGL ++++KIE A+L+TIASG E RTGDLAG A
Sbjct: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360

Query: 357 TTSSFTDAVIGRL 369
           TTSSFT++VI  L
Sbjct: 361 TTSSFTESVIKNL 373

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/369 (73%), Positives = 314/369 (85%), Gaps = 1/369 (0%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MF + +   T  RFLS   QPSIG+FTGKP+P+TGKFTV FIEGDG+GPEIS+SVK+IF 
Sbjct: 1   MFNSRLQLRTVSRFLST-GQPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFS 59

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AAKVPI+W PCDV P+F+NG TTIPEPAV+ INK+L+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWVPCDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TF LFANVRPA+SI  +K+ Y+NVDLV+IRENTEGEYSGIEHV+TPGV+QSIKLITR+A+
Sbjct: 120 TFNLFANVRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREAT 179

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERV+RYA+EY +AIGRPR++V+HKSTIQR+ADGLFV VA+EL+ EYPDI+LETE+ID ++
Sbjct: 180 ERVVRYAFEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDKSI 239

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           LNVVS P  YS+AVSVCPNLYGDI                  ANIG +VSIFEAVHGSAP
Sbjct: 240 LNVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAGQNKANPTALLLSSVMML HMGL+ HA+KIE AVL+TIASG E RT DL+G A+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSS 359

Query: 361 FTDAVIGRL 369
           FT+ VI RL
Sbjct: 360 FTEEVIQRL 368

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/369 (73%), Positives = 312/369 (84%), Gaps = 1/369 (0%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MF++ + R    R  S K QPSIGKFTGKP+P TG + VSFIEGDGIGPEIS+SVK IF 
Sbjct: 1   MFKSQVCRRAVARMFSSK-QPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFA 59

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AAKVP+D+E   V P+ +NG+T+IPE A +SIN NLVALKGPLATP+GKGHRS+NLTLRK
Sbjct: 60  AAKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
           TFGLFAN+RPAKS+EGFKTIYDNV+LV+IRENTEGEY+GIEH + PGVVQSIKLITR+AS
Sbjct: 120 TFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLITREAS 179

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240
           ERVIR+AYEYARA  RPR+IVVHKSTIQRL+DGLFVDVAKEL  E+PDI+LETELIDN V
Sbjct: 180 ERVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELIDNAV 239

Query: 241 LNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAP 300
           LN V++P+ YS+AVSVCPNLYGDI                   NIGH+VSIFEAVHGSAP
Sbjct: 240 LNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAP 299

Query: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           DIAG++KANPTALLLSSVMML+HMGL+ HA +IEKAVL+TIA+GPE RTGDL G A+TSS
Sbjct: 300 DIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSS 359

Query: 361 FTDAVIGRL 369
           FT+AVI +L
Sbjct: 360 FTEAVIKKL 368

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/363 (76%), Positives = 311/363 (85%), Gaps = 4/363 (1%)

Query: 11  TRRFLSVK--NQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDW 68
           T+RFLS++   QPSIG+FTGKP+ +TGK+TVSFIEGDGIGPEIS+SVK IF AA VPI W
Sbjct: 16  TKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITW 75

Query: 69  EPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANV 128
           E CDVSP+ ++GLTTIP+ AV+SINKNLV LKGPLATPIGKGHRSLNLTLRKTF LFANV
Sbjct: 76  ETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANV 135

Query: 129 RPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAY 188
           RPAKS+ GFKT YDNVDLV+IRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYA+
Sbjct: 136 RPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAF 195

Query: 189 EYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQE--YPDIQLETELIDNTVLNVVSN 246
           EYA+AIGRP+VIVVHKSTIQRL+DGLFV+VAKEL +E  + +I+L+TELIDNTVLNVV N
Sbjct: 196 EYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMN 255

Query: 247 PSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQN 306
           PS YS+AV VCPNLYGDI                  ANIG ++SIFEAVHGSAPDIAGQN
Sbjct: 256 PSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQN 315

Query: 307 KANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVI 366
           KANPTALLLSSVMML+HMGLN + DKIE AVL TIA+  + RTGDL G ATT+SFT+AVI
Sbjct: 316 KANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVI 375

Query: 367 GRL 369
             L
Sbjct: 376 DNL 378

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/377 (72%), Positives = 311/377 (82%), Gaps = 9/377 (2%)

Query: 1   MFRN---IILRNTTRRFL-----SVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEIS 52
           M RN   I  +NTT   +     S+ NQP+IG+FTGK N S+G +TV FIEGDG+GPEIS
Sbjct: 1   MLRNTAAIAQKNTTLLKILGSTRSISNQPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEIS 59

Query: 53  QSVKQIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHR 112
           +SVK IF AA VPI W+PCDV P+F+NGLTTIPEPAV++I ++LVALKGPLATP+GKGHR
Sbjct: 60  KSVKDIFSAANVPIQWQPCDVGPIFVNGLTTIPEPAVKAIKESLVALKGPLATPVGKGHR 119

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSI 172
           SLNLTLRKTF LFANVRPAKS+  +K+ Y+NVDLV+IRENTEGEYSGIEH+VTPGVVQSI
Sbjct: 120 SLNLTLRKTFDLFANVRPAKSVPNYKSTYENVDLVLIRENTEGEYSGIEHIVTPGVVQSI 179

Query: 173 KLITRDASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLE 232
           KLITR+ASE+VIRYAYEYA A+GRPR+IVVHKSTIQRL DGLFV +A EL  EYP I+LE
Sbjct: 180 KLITREASEKVIRYAYEYAIAVGRPRLIVVHKSTIQRLGDGLFVQIANELQSEYPSIKLE 239

Query: 233 TELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIF 292
           T+++DNTVLNVVSNP+ Y +AVSVCPNLYGDI                  ANIG +VSIF
Sbjct: 240 TQILDNTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIF 299

Query: 293 EAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDL 352
           EAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL  HA +IE AVLSTIASGPE RTGDL
Sbjct: 300 EAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDL 359

Query: 353 AGKATTSSFTDAVIGRL 369
            G ATTSSFT+ VI +L
Sbjct: 360 GGSATTSSFTECVIKKL 376

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  498 bits (1282), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/358 (67%), Positives = 282/358 (78%), Gaps = 1/358 (0%)

Query: 12  RRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPC 71
           R F++  ++ SIG F GKPNP TG +TV FIEGDG+GPEIS+SV+ IF AAKVPIDW  C
Sbjct: 20  RYFMTAADKISIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVNC 79

Query: 72  DVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA 131
           D+ PL ING TTIP+ AV  IN +L+ALKGPLATP+G+GHRS+NLTLRKTFGLFANVRPA
Sbjct: 80  DIGPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRPA 139

Query: 132 KSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYA 191
           KSI    + Y+NVDL++IRENTEGEYSGIEH + PGVVQSIKLITR ASE+VI+YA+EY 
Sbjct: 140 KSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYT 199

Query: 192 RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYS 251
           R+IGR  +IVVHK+TIQR  DGLFV  A+E++ +YPD+ L+ ELIDNTVLN + NP  Y+
Sbjct: 200 RSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKYA 259

Query: 252 NAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPT 311
           ++VSVCPNLYGDI                  ANIG  V ++EAVHGSAPDIAGQ+KANPT
Sbjct: 260 DSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIGETV-LYEAVHGSAPDIAGQDKANPT 318

Query: 312 ALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           ALLLSSVMMLNHMGL  +AD IE AVL+TI SG E RT DL G ATT+SFT AVI  L
Sbjct: 319 ALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  279 bits (714), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 160/372 (43%), Positives = 221/372 (59%), Gaps = 16/372 (4%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFRN +   T R + + + Q         P    G++TV+ I GDGIG E++ SV QIF+
Sbjct: 1   MFRNTLSHITKRGYAAGREQLL-------PKKYGGRYTVTLIPGDGIGKEVTDSVVQIFE 53

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGK-GHRSLNLTLR 119
           A  VP+DWE  ++S L  N      + AV+S+ +N V LKG   TP  + GH SLN+  R
Sbjct: 54  AENVPVDWESVELSALEENHEGV--QKAVESLKRNKVGLKGIWHTPADQTGHGSLNVAFR 111

Query: 120 KTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDA 179
           K   +FANV   KS  G KT   +VDLVIIRENTEGEYSG+EH   PGVV+S+K++T+  
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAK 171

Query: 180 SERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKEL-SQEYPDIQLETELIDN 238
           SER+ R+A+++A    R  V  VHK+ I +L DGLF +   E+ ++EYP++ + + ++DN
Sbjct: 172 SERIARFAFDFALKNNRKAVCAVHKANIMKLGDGLFRNTVSEIGAKEYPEVNVSSIIVDN 231

Query: 239 TVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHG 297
             +  V+ P  +   V V PNLYG I                  AN G E ++FE     
Sbjct: 232 ASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGCRH 288

Query: 298 SAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKAT 357
              DI GQ+ ANPTA++LSS +ML H+GLN +AD+I +A   TIA G    T D+ G AT
Sbjct: 289 VGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGKR-TTKDIGGTAT 347

Query: 358 TSSFTDAVIGRL 369
           T+ FT+AVI +L
Sbjct: 348 TTEFTNAVIDKL 359

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  275 bits (704), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 156/372 (41%), Positives = 221/372 (59%), Gaps = 16/372 (4%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M RN  ++ + RRF     Q         P    G++TV+ I GDG+G E++ SV  IF+
Sbjct: 1   MLRNTFVQISKRRFALASGQLL-------PKKYGGRYTVTLIPGDGVGKEVTDSVVNIFE 53

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGK-GHRSLNLTLR 119
           A  VPIDWE  ++S L  N      + AV+S+ +N V LKG  +TP  + GH SLN+  R
Sbjct: 54  AENVPIDWESVELSGLEEN--MEGVQKAVESLKRNKVGLKGIWSTPADQTGHGSLNVAFR 111

Query: 120 KTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDA 179
           K   +FANV   KS  G KT   +VDLVIIRENTEGEYSG+EH   PGVV+S+K++T+  
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAK 171

Query: 180 SERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKEL-SQEYPDIQLETELIDN 238
           SER+ R+A+++A    R  V  VHK+ I +L DGLF +   E+ ++EYP++++++ ++DN
Sbjct: 172 SERIARFAFDFALKNNRRSVCAVHKANIMKLGDGLFRNTVNEIGAKEYPELEVKSIIVDN 231

Query: 239 TVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHG 297
             +  V+ P  +   V V PNLYG I                  AN G E ++FE     
Sbjct: 232 ASMQAVAKPHQFD--VLVTPNLYGSI-LGNVGAALIGSPGLVPGANFGREYAVFEPGSRH 288

Query: 298 SAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKAT 357
              DI GQ+ ANPTA++LSS +ML H+GLN++AD+I KA    IA G    T D+ G A+
Sbjct: 289 VGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEGKH-TTKDIGGHAS 347

Query: 358 TSSFTDAVIGRL 369
           T+ FT A++ +L
Sbjct: 348 TTQFTKAIVDKL 359

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  273 bits (698), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 153/343 (44%), Positives = 211/343 (61%), Gaps = 10/343 (2%)

Query: 30  PNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAV 89
           P    G++TV+ I GDG+G E++ SV +IF+   +PIDWE  D+S L     T   + AV
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDISGL---ENTENVQRAV 79

Query: 90  QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148
           +S+ +N V LKG   TP  + GH SLN+ LRK   +FANV   KSI G KT  +N+D+VI
Sbjct: 80  ESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVI 139

Query: 149 IRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIVVHKSTIQ 208
           IRENTEGEYSG+EH   PGVV+S+K++TR  SER+ R+A+++A    R  V  VHK+ I 
Sbjct: 140 IRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKANIM 199

Query: 209 RLADGLFVDVAKEL-SQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXX 267
           +L DGLF +   E+ + EYP++ ++  ++DN  +  V+ P  +   V V PNLYG I   
Sbjct: 200 KLGDGLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LG 256

Query: 268 XXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 326
                          AN G E ++FE        DI GQN ANPTA++LSS +ML H+GL
Sbjct: 257 NIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHLGL 316

Query: 327 NNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           N +AD+I KA    I+ G +  T D+ G A+TS FT+AVI +L
Sbjct: 317 NAYADRISKATYDVISEG-KSTTRDIGGSASTSEFTNAVIEKL 358

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  271 bits (694), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 147/343 (42%), Positives = 215/343 (62%), Gaps = 10/343 (2%)

Query: 30  PNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAV 89
           P    G+FTV+ I GDG+G EI+ SVK IF+A K+P+DWE  ++     +    + E AV
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVKTIFEAEKIPVDWETVNIKQ--TDHKEGVYE-AV 78

Query: 90  QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148
           +S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL++
Sbjct: 79  ESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 149 IRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIVVHKSTIQ 208
           IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R+A+++A+   R  V  VHK+ I 
Sbjct: 139 IRENTEGEFSGLEHESVPGVVESLKIMTRPKTERIARFAFDFAKKYNRKAVTAVHKANIM 198

Query: 209 RLADGLFVDVAKELSQ-EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXX 267
           +L DGLF ++  E+ Q EYPDI + + ++DN  +  V+ P  +   V V P++YG I   
Sbjct: 199 KLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LG 255

Query: 268 XXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 326
                          AN G + ++FE        DI GQN ANPTA++LSSV+MLNH+GL
Sbjct: 256 NIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGL 315

Query: 327 NNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           N +A +I KAV  TIA G    T D+ G ++T+ FT+ +I +L
Sbjct: 316 NEYATRISKAVHETIAEGKH-TTKDIGGSSSTTDFTNEIINKL 357

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  267 bits (683), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 145/343 (42%), Positives = 215/343 (62%), Gaps = 10/343 (2%)

Query: 30  PNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAV 89
           P    G+FTV+ I GDG+G EI+ SV+ IF+A ++P+DWE  ++     +    + E AV
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAERIPVDWETINIKQ--TDHKEGVYE-AV 78

Query: 90  QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148
           +S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL++
Sbjct: 79  ESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 149 IRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIVVHKSTIQ 208
           IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+A+++A+   R  V  VHK+ I 
Sbjct: 139 IRENTEGEFSGLEHESVPGVVESLKVMTKPKTERIARFAFDFAKKYNRKAVTAVHKANIM 198

Query: 209 RLADGLFVDVAKELSQ-EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXX 267
           +L DGLF ++  E+ Q EYPDI + + ++DN  +  V+ P  +   V V P++YG I   
Sbjct: 199 KLGDGLFRNIITEIGQTEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LG 255

Query: 268 XXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 326
                          AN G + ++FE        DI GQN ANPTA++LSSV+MLNH+GL
Sbjct: 256 NIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGL 315

Query: 327 NNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           N +A +I KAV  TIA G    T D+ G ++T+ FT+ VI +L
Sbjct: 316 NENATRISKAVHETIAEGKH-TTRDIGGSSSTTDFTNEVINKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  266 bits (681), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 145/343 (42%), Positives = 213/343 (62%), Gaps = 10/343 (2%)

Query: 30  PNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAV 89
           P    G+FTV+ I GDG+G EI+ SV+ IF+A  +PIDWE  ++     +    + E AV
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQ--TDHKEGVYE-AV 78

Query: 90  QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148
           +S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL++
Sbjct: 79  ESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 149 IRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIVVHKSTIQ 208
           IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R+A+++A+   R  V  VHK+ I 
Sbjct: 139 IRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKANIM 198

Query: 209 RLADGLFVDVAKELSQ-EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXX 267
           +L DGLF ++  E+ Q EYPDI + + ++DN  +  V+ P  +   V V P++YG I   
Sbjct: 199 KLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LG 255

Query: 268 XXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 326
                          AN G + ++FE        DI GQN ANPTA++LSS +MLNH+GL
Sbjct: 256 NIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGL 315

Query: 327 NNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           N +A +I KAV  TIA G    T D+ G ++T+ FT+ +I +L
Sbjct: 316 NEYATRISKAVHETIAEGKH-TTRDIGGSSSTTDFTNEIINKL 357

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  265 bits (676), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 152/351 (43%), Positives = 213/351 (60%), Gaps = 10/351 (2%)

Query: 22  SIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGL 81
           ++ K T  P    G+FTV+ + GDG+G EI+ SV  IF +  VPIDWE  D+S L     
Sbjct: 13  TLAKETIIPKKYGGRFTVTLLPGDGVGKEITDSVVSIFKSENVPIDWETVDISGL---DH 69

Query: 82  TTIPEPAVQSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTI 140
           T   + AV S+ +N + LKG   TP  + GH SLN+  RK   ++ANV   KSIEG KT 
Sbjct: 70  TEGVKAAVDSLKRNKIGLKGIWHTPADQVGHGSLNVAFRKQLDIYANVAIFKSIEGVKTK 129

Query: 141 YDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVI 200
             NVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+A+++A+   R  V 
Sbjct: 130 IPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKSKSERIARFAFDFAKRNNRKSVT 189

Query: 201 VVHKSTIQRLADGLFVD-VAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPN 259
            VHK+ I +L+DGLF + V+K   +EYP+IQ  + ++DN  +  V+ P  +   V V P+
Sbjct: 190 AVHKANIMKLSDGLFRNTVSKIGEEEYPEIQTSSIIVDNASMQAVAKPHQFD--VMVTPS 247

Query: 260 LYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSV 318
           +YG I                   N G + ++FE        DI GQN ANPTA+LLS+ 
Sbjct: 248 MYGTI-VGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSAT 306

Query: 319 MMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           ++L+H+GL   A++I+ AV   IA G +  T D+ G A+T+ FT AVI +L
Sbjct: 307 LLLDHLGLEKSANRIKSAVYDVIAEG-KATTQDIGGSASTTEFTQAVINKL 356

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  265 bits (676), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 147/344 (42%), Positives = 217/344 (63%), Gaps = 11/344 (3%)

Query: 30  PNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAV 89
           P    G++TV+ I GDG+G E++ SV  IF A  VP+DW+  D+S +         + AV
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENVPVDWDRVDISGV---DRAEDVKSAV 78

Query: 90  QSINKNLVALKGPLAT-PIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLV 147
           +S+ +N + LKG   T P  + GH SLN+ LRK   ++ANV   KSI G +    +VDLV
Sbjct: 79  ESLKRNRIGLKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLV 138

Query: 148 IIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIVVHKSTI 207
           +IRENTEGE+SG+EH   PGVV+S+K++T+D  ER+ R+A++YA+   R +V+ VHK+ I
Sbjct: 139 VIRENTEGEFSGLEHESVPGVVESLKIMTQDNIERIARFAFDYAKKNDRKQVVAVHKANI 198

Query: 208 QRLADGLFVDVAKELSQ-EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXX 266
            ++ DGLF ++ +E+ + EYP++Q+   ++DN  +  V+NP  +   V V P++YG I  
Sbjct: 199 MKMGDGLFKNLVQEVGEKEYPELQVGNIIVDNASMQTVANPHQFD--VLVTPSMYGTI-L 255

Query: 267 XXXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMG 325
                           AN G +V++FE        DI GQN ANPTA++LSSV++LNH+G
Sbjct: 256 GNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMILSSVLLLNHLG 315

Query: 326 LNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           LN  AD+I KAV + IA G +  T D+ G A+T+ FT+AVI +L
Sbjct: 316 LNTSADRISKAVHAVIAEG-KSVTRDIGGTASTTEFTEAVINKL 358

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  263 bits (671), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 159/377 (42%), Positives = 226/377 (59%), Gaps = 23/377 (6%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNP----STGKFTVSFIEGDGIGPEISQSVK 56
           MF+ ++ +   R   +V   P+ G F G  NP      G++TV+ I GDG+G E++ SV 
Sbjct: 1   MFKTVLAK---RGLATV---PATG-FRGFLNPLPKEYGGRYTVTLIPGDGVGKEVTDSVV 53

Query: 57  QIFDAAKVPIDWEPCDVSPL-FINGLTTIPEPAVQSINKNLVALKGPLATPIGKG-HRSL 114
            IF+A  +PIDWE  D+S L    G+    E AV S+ +N + LKG   T  G+  H SL
Sbjct: 54  SIFNAENLPIDWERVDISGLDHEEGV----EAAVNSLKRNKIGLKGIWHTSAGQSDHGSL 109

Query: 115 NLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKL 174
           N+ LRK   ++ANV   K++ G KT   +VDLVIIRENTEGEYSG+EH   PGVV+S+K+
Sbjct: 110 NVALRKQLDIYANVAHFKTLPGVKTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKI 169

Query: 175 ITRDASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQ-EYPDIQLET 233
           IT++ SER+ R+A+++A+   R  V  VHK+ I +L DGLF +    + + EYPDI++ +
Sbjct: 170 ITKEKSERIARFAFDFAKRFDRKLVTAVHKANIMKLGDGLFRNSVTSIGETEYPDIKVSS 229

Query: 234 ELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFE 293
            ++DN  +  V+ P  +   V V P++YG I                  AN G E ++FE
Sbjct: 230 IIVDNASMQSVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVPGANYGTECAVFE 286

Query: 294 -AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDL 352
                   DI GQN ANPTA++LSS ++L H+GLNN A KIE AV  TIA G +  T D+
Sbjct: 287 PGSRHVGLDIKGQNVANPTAMILSSTLLLKHLGLNNEAKKIEDAVYKTIAEG-KVTTRDI 345

Query: 353 AGKATTSSFTDAVIGRL 369
            G A+T+ FT+ +I +L
Sbjct: 346 GGSASTTEFTNEIIKKL 362

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  261 bits (667), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 147/345 (42%), Positives = 210/345 (60%), Gaps = 14/345 (4%)

Query: 30  PNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGLTTIP--EP 87
           P    G++TV+ I GDG+G E++ SV  IF++  +PIDWE  ++S     GL      + 
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIPIDWETVEIS-----GLDNQEGVQK 77

Query: 88  AVQSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDL 146
           AV+S+ +N V LKG   TP  + GH SLN+ LRK   +FANV   KS+ G  + + NVD+
Sbjct: 78  AVESLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDM 137

Query: 147 VIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIVVHKST 206
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+A+++A    R  V  VHK+ 
Sbjct: 138 VVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIGRFAFDFAVKNNRKSVCAVHKAN 197

Query: 207 IQRLADGLFVDVAKEL-SQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIX 265
           I +L DGLF +   E+ ++EYP+I ++  ++DN  +  V+ P  +   V V PNLYG I 
Sbjct: 198 IMKLGDGLFRNCINEVGAKEYPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 254

Query: 266 XXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 324
                            AN G E ++FE        DI GQN ANPTA++LSS +ML H+
Sbjct: 255 LGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHL 314

Query: 325 GLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           GLN +AD+I KA    IA   +  T D+ G A+T+ FT+A+I +L
Sbjct: 315 GLNAYADRISKATYDVIAEA-KTTTQDIGGSASTTEFTEAIISKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  261 bits (667), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 147/345 (42%), Positives = 210/345 (60%), Gaps = 14/345 (4%)

Query: 30  PNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGLTTIP--EP 87
           P    G++TV+ I GDG+G E++ SV  IF++  VPIDWE  ++S     GL      + 
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENVPIDWETVEIS-----GLDNEEGVQK 76

Query: 88  AVQSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDL 146
           AV S+ +N V LKG   TP  + GH SLN+ LRK   +FANV   K++ G  + + NVDL
Sbjct: 77  AVDSLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDL 136

Query: 147 VIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIVVHKST 206
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  S+R+ R+A+++A    R  V  VHK+ 
Sbjct: 137 VVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSDRIGRFAFDFALKNNRKSVCAVHKAN 196

Query: 207 IQRLADGLFVDVAKEL-SQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIX 265
           I +L DGLF +   E+ ++EYP+I+++  ++DN  +  V+ P  +   V V PNLYG I 
Sbjct: 197 IMKLGDGLFRNCINEIGAKEYPEIEVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 253

Query: 266 XXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 324
                            AN G E ++FE        DI GQN ANPTA++LSS +ML H+
Sbjct: 254 LGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHL 313

Query: 325 GLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           GLN++AD+I KA    IA   +  T D+ G A+T+ FT A+I +L
Sbjct: 314 GLNSYADRISKATYDVIAEA-KNTTKDIGGSASTTDFTQAIIEKL 357

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  260 bits (665), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 152/374 (40%), Positives = 217/374 (58%), Gaps = 21/374 (5%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFRN     + R   +V  +  +      P    G++TV+ I GDG+G E++ SV  IF+
Sbjct: 1   MFRNTFAV-SKRSLATVATEQLL------PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFE 53

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIP--EPAVQSINKNLVALKGPLATPIGK-GHRSLNLT 117
           A  VPIDWE  +     I G+ +    + AV+S+ +N + LKG   TP  + GH SLN+ 
Sbjct: 54  AENVPIDWETIN-----ITGVDSEEGVQKAVESLKRNKIGLKGIWHTPADQTGHGSLNVA 108

Query: 118 LRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITR 177
            RK   +FANV   K++ G KT   N+DLV+IRENTEGEYSG+EH   PGVV+S+K+IT+
Sbjct: 109 FRKQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESVPGVVESLKIITK 168

Query: 178 DASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKEL-SQEYPDIQLETELI 236
             SER+ R+A+++A    R  V  VHK+ I +L DGLF +   E+ + EYP+I ++  ++
Sbjct: 169 AKSERIARFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNTVNEVGASEYPEIDVKNIIV 228

Query: 237 DNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFE-AV 295
           DN  +  V+ P  +   V V PNLYG I                  AN G E ++FE   
Sbjct: 229 DNASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGS 285

Query: 296 HGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGK 355
                DI G++ ANPTA++LSS +ML H+GLN +AD+I KA    IA G    T D+ G 
Sbjct: 286 RHVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEGKH-TTKDIGGS 344

Query: 356 ATTSSFTDAVIGRL 369
           ++T+ FT +VI +L
Sbjct: 345 SSTTEFTKSVIDKL 358

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  259 bits (662), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 152/372 (40%), Positives = 220/372 (59%), Gaps = 19/372 (5%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFRN+I   + R F S+ ++ +I      P    G++TV+ + GDG+G EI+ SV  IF+
Sbjct: 1   MFRNLI---SKRAFTSIASRENI-----IPKKYGGRYTVTLLPGDGVGREITDSVVSIFE 52

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGK-GHRSLNLTLR 119
           A  +PIDWE  ++S L    + T    AV+S+ +N + LKG   T     GH S N+ LR
Sbjct: 53  AENLPIDWERVELSGLEQEDVHT----AVESLKRNKIGLKGIWHTSADHDGHTSWNVALR 108

Query: 120 KTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDA 179
           K   ++ANV   KS +G  T   +VDLVIIRENTEGEYSG+EH   PGVV+S+K++T   
Sbjct: 109 KELDIYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTAQK 168

Query: 180 SERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKEL-SQEYPDIQLETELIDN 238
           +ER+ R+A++YA    R  V  VHK+ I +L DGLF ++  E+ ++EYP++ + + ++DN
Sbjct: 169 TERIARFAFDYAMKYNRKSVTAVHKANIMKLGDGLFRNLVTEIGAKEYPEVGVSSIIVDN 228

Query: 239 TVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHG 297
             +  V+ P  +   V V P++YG I                  AN G + ++FE     
Sbjct: 229 ASMQAVAKPHQFD--VMVAPSMYGTI-LGNIGAALIGGPGLVPGANYGRDYAVFEPGSRH 285

Query: 298 SAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKAT 357
              DI  QN ANPTA++LS+ +MLNH+G  N A +I KAV   IA G +  T D+ G AT
Sbjct: 286 VGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEG-KTTTRDIGGSAT 344

Query: 358 TSSFTDAVIGRL 369
           T+ FT+AVI +L
Sbjct: 345 TTEFTNAVIAKL 356

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  258 bits (658), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 212/372 (56%), Gaps = 19/372 (5%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFR  I + T   F        I K T  P    G+ TV+ + GDG+G EI+ SV  IF 
Sbjct: 1   MFRQTIAKRTLATF--------IPKETILPKKYGGRMTVTLLPGDGVGKEITDSVVSIFQ 52

Query: 61  AAKVPIDWEPCDVSPL-FINGLTTIPEPAVQSINKNLVALKGPLATPIGK-GHRSLNLTL 118
           A  VPIDWE  D+S L   +G+      AV+S+ +N + LKG   T   + GH SLN+  
Sbjct: 53  AENVPIDWETVDISQLDHEDGVNA----AVESLKRNKIGLKGIWHTSADQVGHGSLNVAF 108

Query: 119 RKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRD 178
           RK   ++ANV   KSI G KT   NVDLVIIRENTEGEYSG+EH   PGVV+S+K++T+ 
Sbjct: 109 RKQLDIYANVAFCKSIPGVKTKIPNVDLVIIRENTEGEYSGLEHESVPGVVESLKIVTKV 168

Query: 179 ASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDN 238
            SER+ ++A+++A    R  V  VHK+ I +L+DGLF +    + + YP I+ ++ ++DN
Sbjct: 169 NSERIAKFAFDFAMRHDRKMVTAVHKANIMKLSDGLFRNTVARVGEAYPQIKNDSIIVDN 228

Query: 239 TVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHG 297
             +  V+ P  +   V V P++YG I                   N G E ++FE     
Sbjct: 229 ASMQAVAKPHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLVPGVNYGREYAVFEPGSRH 285

Query: 298 SAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKAT 357
              DI GQN ANPTA++LSS ++L H+GLN+ A +I KAV   I  G    T D+ G A+
Sbjct: 286 VGLDIKGQNVANPTAMILSSTLLLQHLGLNDTASRISKAVYDVIKEG-NATTKDIGGNAS 344

Query: 358 TSSFTDAVIGRL 369
           T+ FT AVI +L
Sbjct: 345 TTEFTKAVIDKL 356

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  254 bits (648), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 150/363 (41%), Positives = 213/363 (58%), Gaps = 14/363 (3%)

Query: 12  RRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPC 71
           RR +S ++  ++ + T  PN   G++TV+ + GDG+G E + SV  +F+A  +PIDWE  
Sbjct: 3   RRLVSKRSLATLPE-TLFPNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIPIDWEIV 61

Query: 72  DVSPL-FINGLTTIPEPAVQSINKNLVALKGPLATPIG--KGHRSLNLTLRKTFGLFANV 128
           ++S L    G+      AVQS+ +N + LKG   T      GH SLN+  RK   ++ANV
Sbjct: 62  NISGLDHKEGVAA----AVQSLRRNKIGLKGLWHTSNADQSGHGSLNVAFRKQLDIYANV 117

Query: 129 RPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAY 188
              KS++G KT+  +VDLV+IRENTEGE+SG+EH    GVV+S+K+ T   +ER+ R+A+
Sbjct: 118 AVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEGVVESLKVTTLPKTERIARFAF 177

Query: 189 EYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQ-EYPDIQLETELIDNTVLNVVSNP 247
            YA+  GR  V  VHK+ I +L DGLF +    + + EYPDI+  + ++DN  +  V+ P
Sbjct: 178 NYAQKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGEKEYPDIETSSIIVDNASMQAVAKP 237

Query: 248 SSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQN 306
             +   V V P++YG I                  AN G E ++FE        DI GQN
Sbjct: 238 HQFD--VLVTPSMYGTI-IGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQN 294

Query: 307 KANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVI 366
            ANPTA+LLSS +MLNH+GL     +I  AV   IA G + RT D+ G ATT+ FT AVI
Sbjct: 295 IANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEG-DVRTKDIGGDATTTEFTQAVI 353

Query: 367 GRL 369
            +L
Sbjct: 354 EKL 356

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  253 bits (647), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 214/367 (58%), Gaps = 15/367 (4%)

Query: 6   ILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVP 65
           + R   RR ++     S+ K    P    G++TV+ I GDG+G EI+ SV  IF+A  +P
Sbjct: 1   MFRTVQRRGMA-----SMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIP 55

Query: 66  IDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIG-KGHRSLNLTLRKTFGL 124
           +DWE  D+S    + +  + + AV+S+ +N + LKG   T      H S N+ LRK   +
Sbjct: 56  VDWERVDISTS--DNIQDVSQ-AVESLKRNKIGLKGIWHTSADIADHGSFNVALRKQLDM 112

Query: 125 FANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVI 184
           FA+V   KS+ G KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ 
Sbjct: 113 FAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIA 172

Query: 185 RYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKEL-SQEYPDIQLETELIDNTVLNV 243
           R+A+++A+   R  V  VHK+ I ++ DGLF +   E+ + EYPDIQ  + ++DN  +  
Sbjct: 173 RFAFDFAKKYNRKSVCAVHKANIMKMGDGLFRNTVTEIGANEYPDIQTSSIIVDNASMQA 232

Query: 244 VSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDI 302
           V+ P  +   V V P++YG I                  A+ G E ++FE        DI
Sbjct: 233 VAKPHQFD--VMVTPSMYGTI-IGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDI 289

Query: 303 AGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFT 362
            G+N ANPTA++LSS +ML H+GL   A +I KA    I+ G +  T D+ G A+T+ FT
Sbjct: 290 KGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLG-QVTTKDIGGSASTTEFT 348

Query: 363 DAVIGRL 369
           +A+I RL
Sbjct: 349 EAIIKRL 355

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  250 bits (638), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 150/362 (41%), Positives = 215/362 (59%), Gaps = 18/362 (4%)

Query: 17  VKNQPSIGKFTGK----PNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCD 72
           V ++ SI  FT      P    G++TV+ I GDGIG E++ SV +IF +  +PIDWE  D
Sbjct: 5   VVSKRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDSVVKIFASQGLPIDWERID 64

Query: 73  VSPLFINGLTTIPE--PAVQSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVR 129
           V      G++   E   AV+S+ +N + LKG   T   + G+ SLN+ LRK   +FANV 
Sbjct: 65  VP-----GMSNENEVKKAVESLKRNKIGLKGIWHTSADQTGYGSLNVALRKQLDIFANVA 119

Query: 130 PAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYE 189
             KS++G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  +ER+ R+A++
Sbjct: 120 IFKSLKGVKTKIPDVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKPKTERIARFAFD 179

Query: 190 YARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQ-EYPDIQLETELIDNTVLNVVSNPS 248
           +A    R  V  VHK+ I +L+DGLF +   E+ + EYPDI++ T ++DN  +  V+ P 
Sbjct: 180 FALENNRSTVTAVHKANIMKLSDGLFKNTVAEVGEKEYPDIKVNTIIVDNASMQAVAKPH 239

Query: 249 SYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQNK 307
            +   V V P++YG I                  AN G E ++FE        DI  QN 
Sbjct: 240 QFD--VMVTPSMYGTI-LGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNI 296

Query: 308 ANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIG 367
           ANPTA++LS+ +MLN +GL   + +I  AV + I  G +  T D+ G A+T+ FTDAVI 
Sbjct: 297 ANPTAMILSATLMLNQLGLREESKRISNAVYAVIEEG-KTTTKDIGGNASTTEFTDAVID 355

Query: 368 RL 369
           +L
Sbjct: 356 KL 357

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  249 bits (637), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 146/347 (42%), Positives = 207/347 (59%), Gaps = 17/347 (4%)

Query: 30  PNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPL-FINGLTTIPEPA 88
           P    G+F V+ I GDG+G E++ SV  IF+A  +PIDW+  D+S L    G+    + A
Sbjct: 22  PKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLPIDWDRVDISGLDHEEGV----QAA 77

Query: 89  VQSINKNLVALKG----PLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNV 144
           V S+ +N + LKG      A   GKG  SLN+ LRK   ++ANV   KS+ G KT   NV
Sbjct: 78  VDSLKRNKIGLKGIWHTSAADQAGKG--SLNVALRKELDIYANVALFKSVPGVKTKIPNV 135

Query: 145 DLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIVVHK 204
           DLV+IRENTEGEYSG+EH   PGVV+S+K++T D +ER+ R+A+++A+   R  V  VHK
Sbjct: 136 DLVVIRENTEGEYSGLEHESVPGVVESLKIMTEDKTERIARFAFDFAKKYNRHAVTAVHK 195

Query: 205 STIQRLADGLFVDVAKEL-SQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGD 263
           + I +L DGLF +V   +  QEYPD+++ + ++DN  +  V+ P  +   V V P++YG 
Sbjct: 196 ANIMKLGDGLFRNVVTRVGEQEYPDVKVGSIIVDNASMQTVAKPHQFD--VLVTPSMYGT 253

Query: 264 IXXXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLN 322
           I                  AN G E ++FE        DI  +N ANPTA++LS+ +ML+
Sbjct: 254 I-LGNIGAALIGGPGLVAGANYGREYAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLD 312

Query: 323 HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           H+GL+  A KI  AV   IA G +  T D+ G A+T+ FT AVI +L
Sbjct: 313 HLGLSTSATKISNAVHQVIAEG-KSTTPDIGGSASTTEFTQAVIEKL 358

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  236 bits (601), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 144/371 (38%), Positives = 209/371 (56%), Gaps = 27/371 (7%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M RN +LR +                T  P    G+F ++ I G+GIG E++ SV+ IF 
Sbjct: 1   MLRNTLLRRSIS--------------TISPKKYGGRFQITLIPGNGIGKEVTDSVRSIFQ 46

Query: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120
           A  +PIDWE  ++     +G+ T    AV SI +N +ALKG  ++    G  SLN+ LRK
Sbjct: 47  AENLPIDWEIVNIES-HRDGIKT----AVDSIKRNKIALKGIWSSDPIDG--SLNVALRK 99

Query: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180
              +FANV   KS +   T   NVDLV+IRENTEGE+SG+EH    GVV+S+K++T+  +
Sbjct: 100 QLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDGVVESLKIVTKPKT 159

Query: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKEL-SQEYPDIQLETELIDNT 239
           ER+ R+A+++A+   R  V  VHK+ I +L DGLF ++   + + EYP+I+  + ++DN 
Sbjct: 160 ERIARFAFDFAKKHNRNHVTAVHKANIMKLGDGLFKNIVAHIGNNEYPEIKNSSIIVDNA 219

Query: 240 VLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFE-AVHGS 298
            +  V+ P  +   V V P++YG I                  AN G + ++FE      
Sbjct: 220 SMQAVAKPHQFD--VLVSPSMYGTI-LGNIGAALIGGPGLVPGANFGRDYAVFEPGSRHV 276

Query: 299 APDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATT 358
             DI GQN ANPTA++LS+  ML H+GL + A++I  AV   IA G    T D+ G A+T
Sbjct: 277 GLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTT-VTKDIGGTAST 335

Query: 359 SSFTDAVIGRL 369
           + FTDAVI  L
Sbjct: 336 TEFTDAVINEL 346

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  211 bits (538), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 172/285 (60%), Gaps = 9/285 (3%)

Query: 30  PNPSTGKFTVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAV 89
           P    G+FTV+ I GDG+G E++ SVK IF+A  +PIDWE  ++     +    + E AV
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAENIPIDWETINIKQ--TDHKEGVNE-AV 78

Query: 90  QSINKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148
           +S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL++
Sbjct: 79  ESLRRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 149 IRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIVVHKSTIQ 208
           IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+A+++A+   R  V  VHK+ I 
Sbjct: 139 IRENTEGEFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFAKKYNRKAVTAVHKANIM 198

Query: 209 RLADGLFVDVAKELSQ-EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXX 267
           +L DGLF ++  E+ Q EYPDI + + ++DN  +  V+ P  +   V V P++YG I   
Sbjct: 199 KLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LG 255

Query: 268 XXXXXXXXXXXXXXXANIGHEVSIFE-AVHGSAPDIAGQNKANPT 311
                          AN G + ++FE        DI GQN ANPT
Sbjct: 256 NIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPT 300

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  168 bits (426), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 130/386 (33%), Positives = 192/386 (49%), Gaps = 39/386 (10%)

Query: 6   ILRNTTRRF-LSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDA--A 62
           +LR + R+F +S +N  S+   T           +  I GDGIG E+  + KQ+      
Sbjct: 1   MLRTSVRQFSVSARNASSLKTLT-----------IGLIPGDGIGKEVIPAGKQVLQNLNK 49

Query: 63  KVPIDWEPCDVSP---LFINGLTTIPEPAVQSI-NKNLVALKGPLATPIGK--GHRSLNL 116
           K  + +E  D+      F++    +P   V  + NK   AL G + +P  K  G+ S  +
Sbjct: 50  KHGLAFEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIV 109

Query: 117 TLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVT-----PGVVQS 171
            LRK  GLFANVRP K++EG  T    +DLVI+RENTE  Y  IE   T       + ++
Sbjct: 110 QLRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEA 167

Query: 172 IKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQE-- 225
            K IT  A++R+ + A + A    +  G   + V HKS +   +DGLF +V KE+ +   
Sbjct: 168 TKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNK 227

Query: 226 --YPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXA 283
             Y  +    +++D+ V  +   P  +   V V PNLYGDI                  A
Sbjct: 228 SLYSGVAYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGLVPS-A 284

Query: 284 NIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIAS 343
           N+G  + I E  HGSAPDIAG+  ANP A + S+  ML ++G +N A  I KAV + I  
Sbjct: 285 NVGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRD 344

Query: 344 GPEGRTGDLAGKATTSSFTDAVIGRL 369
             + +T DL G +TT    D ++G+L
Sbjct: 345 N-KIKTADLGGDSTTQQVIDDILGKL 369

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  166 bits (421), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 183/354 (51%), Gaps = 27/354 (7%)

Query: 37  FTVSFIEGDGIGPEISQSVKQIFDAA--KVPIDWEPCDVSP---LFINGLTTIPEPAVQS 91
            T+  I GDGIG E+  + KQI +    K  +D++  D+      F N    +P+  V+ 
Sbjct: 25  LTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEV 84

Query: 92  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148
           + ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K++EG  T    VD+VI
Sbjct: 85  LRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVI 142

Query: 149 IRENTEGEYSGIEHVVT-PG----VVQSIKLITRDASERVIRYAYEYA----RAIGRPRV 199
           +RENTE  Y  IE   T P     V ++ K I+  A+ R+   A + A    ++ G   +
Sbjct: 143 VRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATL 202

Query: 200 IVVHKSTIQRLADGLFVDVAKELSQ----EYPDIQLETELIDNTVLNVVSNPSSYSNAVS 255
            V HKS +   +DGLF ++ K++ +    +Y  IQ   +++D+ V  +   P  +   V 
Sbjct: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VV 260

Query: 256 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315
           V PNLYGDI                  AN+G E+ I E  HGSAPDIAG+  ANP A + 
Sbjct: 261 VAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGRGIANPIATIR 319

Query: 316 SSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           S+ +ML  +G    A  I KAV S I    + +T DL GK+TT    D ++ ++
Sbjct: 320 STALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  164 bits (416), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 129/390 (33%), Positives = 191/390 (48%), Gaps = 40/390 (10%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFR++  R +  R L+              N +    T+  I GDGIG E+  + KQ+ +
Sbjct: 1   MFRSVATRLSACRGLA-------------SNAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47

Query: 61  A--AKVPIDWEPCDVSPLFINGLTT---IPEPAVQSINKNLV-ALKGPLATPIGK--GHR 112
              +K  + +   D+   F     T   +P+  V+ + +    AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG----- 167
           S  + LR+  GLFANVRP KS+EG K     +D+VI+RENTE  Y  IE           
Sbjct: 108 SPIVALRREMGLFANVRPVKSVEGEKG--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 168 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELS 223
           V  + K I+  A+ R+   A + A    +  G+  + V HKS +   +DGLF ++ KE+ 
Sbjct: 166 VADATKRISEIATRRIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVY 225

Query: 224 Q----EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
           +    +Y  I+   +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 280 XXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLS 339
              AN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML  +G N  A  I KAV +
Sbjct: 284 PS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDA 342

Query: 340 TIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
            +  G   +T DL GKA+T    D V+ RL
Sbjct: 343 NLREGSI-KTPDLGGKASTQQVVDDVLSRL 371

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 129/390 (33%), Positives = 191/390 (48%), Gaps = 40/390 (10%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M R++  R +T R L+              N +    T+  I GDGIG E+  + KQ+ +
Sbjct: 1   MLRSVATRLSTCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47

Query: 61  A--AKVPIDWEPCDVSPLFINGLTT---IPEPAVQSINKNLV-ALKGPLATPIGK--GHR 112
              +K  + +   D+   F     T   +P+  V+ + +    AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG----- 167
           S  + LR+  GLFANVRP KS+EG K     +D+VI+RENTE  Y  IE           
Sbjct: 108 SPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 168 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELS 223
           V  + K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF ++ KE+ 
Sbjct: 166 VADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY 225

Query: 224 Q----EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
           +    +Y  I+   +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 280 XXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLS 339
              AN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML  +G NN A  I KAV +
Sbjct: 284 PS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDA 342

Query: 340 TIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
            +  G   +T DL GKA+T    + V+ RL
Sbjct: 343 NLREGAI-KTPDLGGKASTQQVVEDVLSRL 371

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  164 bits (414), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 121/360 (33%), Positives = 182/360 (50%), Gaps = 27/360 (7%)

Query: 31  NPSTGKFTVSFIEGDGIGPEISQSVKQIFDAA--KVPIDWEPCDVSPLFINGLTT---IP 85
           N +    T+  I GDGIG E+  + KQ+  +   K  ++++  D+   F     T   +P
Sbjct: 19  NAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFIDLQAGFQTFQDTGKALP 78

Query: 86  EPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYD 142
           +  VQ + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+EG      
Sbjct: 79  DETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLYANIRPVKSVEGSNE--R 136

Query: 143 NVDLVIIRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRYAYEYA----RA 193
            VD++I+RENTE  Y  IE           V ++ K I+  A++R+   A + A    + 
Sbjct: 137 PVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQRIATIALDIALQRLQN 196

Query: 194 IGRPRVIVVHKSTIQRLADGLFVDVAKELSQ----EYPDIQLETELIDNTVLNVVSNPSS 249
            G+  + V HKS +   +DGLF +V +E+ +    +Y  I    +++D+ V  +   P  
Sbjct: 197 NGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQIVDSMVYRMFREPEC 256

Query: 250 YSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKAN 309
           +   V V PNLYGDI                  AN+G E+ I E  HGSAPDIAG+  AN
Sbjct: 257 FD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIAN 313

Query: 310 PTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           P A + S+ +ML  +G N  A  I KAV + +  G   +T DL G ATT +  D ++ RL
Sbjct: 314 PIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLV-KTADLGGNATTQNVVDDILARL 372

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  162 bits (411), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 120/390 (30%), Positives = 194/390 (49%), Gaps = 41/390 (10%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M RN + R   RR +               N +    T+  I GDGIG E+  + K++ +
Sbjct: 1   MLRNGVYRACARRTVV--------------NGARSNLTIGLIPGDGIGKEVIPAGKKVLE 46

Query: 61  --AAKVPIDWEPCDVSP---LFINGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHR 112
               K  ID++  D+      F++    +P+  V  + +    AL G + +P  K  G+ 
Sbjct: 47  TIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYS 106

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEY-----SGIEHVVTPG 167
           S  + LRK  GL+AN+RP KS+ G  T    VD+VI+RENTE  Y     + I+      
Sbjct: 107 SPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTK 164

Query: 168 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELS 223
           V ++ K I+  A+ ++ + A + A    +  G+  + V HKS +   +DGLF +V +++ 
Sbjct: 165 VAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY 224

Query: 224 QE----YPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
           ++    Y ++    +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 225 EKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAALVGSLGVV 282

Query: 280 XXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLS 339
              AN+G ++ I E  HGSAPDI+GQ  +NP A + S+ +ML  +G N  A  I+ AV  
Sbjct: 283 PS-ANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDE 341

Query: 340 TIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
            I SG + +T DL G ++T+  TD ++ +L
Sbjct: 342 NIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  162 bits (411), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 129/390 (33%), Positives = 187/390 (47%), Gaps = 40/390 (10%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFR++  R +  R L+              N +    T+  I GDGIG E+  + KQ+ +
Sbjct: 1   MFRSVATRVSACRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47

Query: 61  A--AKVPIDWEPCDVSPLFINGLTT---IPEPAVQSINKNLV-ALKGPLATPIGK--GHR 112
              +K  + +   D+   F     T   +P+  V  + K    AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG----- 167
           S  + LR+  GLFANVRP KS+EG +     +D+VI+RENTE  Y  IE           
Sbjct: 108 SPIVALRREMGLFANVRPVKSVEGSRN--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 168 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELS 223
           V  + K I+  A+ R+   A + A    +  G   + V HKS +    DGLF ++ KE+ 
Sbjct: 166 VADATKRISEIATRRIATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVY 225

Query: 224 Q----EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
           +    +Y  I+   +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 280 XXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLS 339
              AN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML  +G N  A  I KAV +
Sbjct: 284 PS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDA 342

Query: 340 TIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
            +  G    T DL GKA+T    D V+ RL
Sbjct: 343 NLREGAI-TTPDLGGKASTQQVVDDVLSRL 371

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  162 bits (411), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 127/390 (32%), Positives = 191/390 (48%), Gaps = 40/390 (10%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFR++  R +  R L+              N +    T+  I GDGIG E+  + KQI +
Sbjct: 1   MFRSVATRISACRGLA-------------SNAARKSLTIGLIPGDGIGKEVIPAGKQILE 47

Query: 61  A--AKVPIDWEPCDVSPLFINGLTT---IPEPAVQSINKNLV-ALKGPLATPIGK--GHR 112
              +K  + +   D+   F     T   +P+  ++ +      AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG----- 167
           S  + LR+  GL+ANVRP KS+EG K     +D+VI+RENTE  Y  IE           
Sbjct: 108 SPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 168 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELS 223
           V  +IK I+  A+ R+ + A + A    +  G   + V HKS +   +DGLF ++ K++ 
Sbjct: 166 VADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY 225

Query: 224 Q----EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
           +    +Y  I+   +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 280 XXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLS 339
              AN+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G N+ A  I KAV +
Sbjct: 284 PS-ANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDA 342

Query: 340 TIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
            +  G    T DL GKA+T    D V+ RL
Sbjct: 343 NLREGAI-TTPDLGGKASTQQVVDDVLSRL 371

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  162 bits (410), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 127/385 (32%), Positives = 189/385 (49%), Gaps = 33/385 (8%)

Query: 6   ILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDA--AK 63
           +LR    RF +   +      T   N      T+  I GDGIG E+  + KQ+ +   +K
Sbjct: 1   MLRTAASRFATSTCR------TYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSK 54

Query: 64  VPIDWEPCDVSPLFINGLTT---IPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLT 117
             + ++  D+   F   L T   +P+  VQ +      AL G + +P  K  G+ S  + 
Sbjct: 55  HGLKFDFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVA 114

Query: 118 LRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG-----VVQSI 172
           LRK  GLFANVRP KS+ G K     VD+VI+RENTE  Y  IE           V ++ 
Sbjct: 115 LRKEMGLFANVRPVKSVSGTKD--RPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEAT 172

Query: 173 KLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQ---- 224
           K I+  A+ R+   A + A    +  G+  + V HKS +   +DGLF ++ K++ +    
Sbjct: 173 KRISEIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKD 232

Query: 225 EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXAN 284
           +Y  I    +++D+ V  +   P  +   V V PNLYGDI                  AN
Sbjct: 233 KYGSITYNEQIVDSMVYRMFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-AN 289

Query: 285 IGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASG 344
           +G E+ I E  HGSAPDIAG+  ANP A + S+ +ML  +G N+ A  I +AV + +   
Sbjct: 290 VGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMREN 349

Query: 345 PEGRTGDLAGKATTSSFTDAVIGRL 369
            + +T DL G +TT   T+ V+ RL
Sbjct: 350 -KIKTPDLGGNSTTQQVTEDVLARL 373

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  162 bits (410), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 192/386 (49%), Gaps = 36/386 (9%)

Query: 6   ILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDA--AK 63
           +LR T  R  + +   +        N      T+  I GDGIG E+  + KQ+     +K
Sbjct: 1   MLRTTASRLATCRGYAT--------NAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSK 52

Query: 64  VPIDWEPCDVSPLFINGLTT---IPEPAVQSI-NKNLVALKGPLATPIGK--GHRSLNLT 117
             ++++  D+   F   L T   +P+  +Q + N+   AL G + +P  K  G+ S  + 
Sbjct: 53  HGLNFDFIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVA 112

Query: 118 LRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEG------EYSGIEHVVTPGVVQS 171
           LRK  GL+ANVRP KS+EG  T    VD+VI+RENT        E + I+      V ++
Sbjct: 113 LRKEMGLYANVRPVKSVEG--TTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEA 170

Query: 172 IKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQ--- 224
            K I+  A+ R+   A + A    +  G+  + V HKS +   +DGLF ++ K++ +   
Sbjct: 171 TKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNK 230

Query: 225 -EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXA 283
            +Y  I    +++D+ V  +   P  +   V V PNLYGDI                  A
Sbjct: 231 DKYGQINYNEQIVDSMVYRMFREPQCFD--VVVAPNLYGDILSDGAAALVGSLGVVPS-A 287

Query: 284 NIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIAS 343
           N+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML  +G N  A  I +AV + +  
Sbjct: 288 NVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKE 347

Query: 344 GPEGRTGDLAGKATTSSFTDAVIGRL 369
             + +T DL GK+TT   T+ V+ RL
Sbjct: 348 N-KVKTPDLGGKSTTQEVTEDVLARL 372

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  156 bits (395), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 188/372 (50%), Gaps = 28/372 (7%)

Query: 20  QPSIGKFTGKPNPSTGK-FTVSFIEGDGIGPEISQSVKQIFD--AAKVPIDWEPCDVSP- 75
           + ++ +F  +   S  K  T+  I GDGIG E+  + K + +  ++K  + +   D+   
Sbjct: 3   RSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAG 62

Query: 76  --LFINGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRP 130
              F++    +P+  ++ +  +   AL G + +P  K  G+ S  + LRK  GL+ANVRP
Sbjct: 63  WQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRP 122

Query: 131 AKSIEGFKTIYDNVDLVIIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIR 185
            KS++G  T    VD++I+RENTE  Y     + I+      V ++IK I+  A+  + +
Sbjct: 123 VKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180

Query: 186 YAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKEL----SQEYPDIQLETELID 237
            A E +    +A G+  + V HKS +   +DGLF +V K +     + Y  I    +++D
Sbjct: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240

Query: 238 NTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHG 297
           + V  +   P  +   V V PNLYGDI                  AN+GH+  + E  HG
Sbjct: 241 SMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGHDFIVGEPCHG 297

Query: 298 SAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKAT 357
           SAPDIAG+  +NP A + S+ +ML  MG    A  I KAV + I    + +T DL GK+T
Sbjct: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGGKST 356

Query: 358 TSSFTDAVIGRL 369
           T    D ++ ++
Sbjct: 357 TQQVVDDILSKM 368

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  155 bits (393), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 125/379 (32%), Positives = 186/379 (49%), Gaps = 48/379 (12%)

Query: 20  QPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQI-----------FDAAKVPIDW 68
           Q +IG  + K N      T+  I GDGIG E+  S +Q+           F+   +   W
Sbjct: 12  QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGW 66

Query: 69  EPCDVSPLFINGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLF 125
           +       F++    +P   V+++ +N   AL G + +P  K  G+ S  + LRK  GL+
Sbjct: 67  QT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 126 ANVRPAKSIE--GFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG-----VVQSIKLITRD 178
           AN+RP KS++  G K     VD+VI+RENTE  Y  +E           V  + K I+  
Sbjct: 121 ANIRPVKSVDTPGNK----KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEV 176

Query: 179 ASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQE----YPDIQ 230
           A+ R+ + A + A    +  G  ++ V HKS +   +DGLF +V KE+ +     Y DIQ
Sbjct: 177 ATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQ 236

Query: 231 LETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVS 290
              ++ID+ V  +   P  +   V V PNLYGDI                  AN+G  + 
Sbjct: 237 YNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPGIV 293

Query: 291 IFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTG 350
           I E  HGSAPDIAG+  +NP A + S+ +ML  +G +  A  I+ AV S +    + +T 
Sbjct: 294 IGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE-DKIKTP 352

Query: 351 DLAGKATTSSFTDAVIGRL 369
           DL GK +TS   + VI RL
Sbjct: 353 DLGGKNSTSDVVNDVIRRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  155 bits (392), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 120/390 (30%), Positives = 192/390 (49%), Gaps = 43/390 (11%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           MFR+ + +   RR  S      IG                 I GDGIG E+  + KQ+ +
Sbjct: 1   MFRSSVAKVAARRAYSAPKSMKIG----------------LIPGDGIGKEVIPAGKQVLE 44

Query: 61  A--AKVPIDWEPCDVSP---LFINGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHR 112
           A  +K  + ++  D+      F      +P+  V+ + +    AL G + +P  K  G+ 
Sbjct: 45  ALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYS 104

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEY-----SGIEHVVTPG 167
           S  + LRK  GL+ANVRP KS+E  K    NVD++I+RENTE  Y     + ++      
Sbjct: 105 SPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTR 162

Query: 168 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELS 223
           V ++IK I+  A+ ++   A + +    ++ G   + V HKS +   +DGLF ++ K++ 
Sbjct: 163 VAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVY 222

Query: 224 QE----YPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
           ++    Y +++   +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 223 EKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGSLGVV 280

Query: 280 XXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLS 339
              AN+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  I KAV +
Sbjct: 281 PS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDA 339

Query: 340 TIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
            +  G +  T DL GKATT    D ++ ++
Sbjct: 340 NLIKG-DVNTPDLGGKATTQQVVDDILSKI 368

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  154 bits (389), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 113/354 (31%), Positives = 173/354 (48%), Gaps = 28/354 (7%)

Query: 37  FTVSFIEGDGIGPEISQSVKQIFDA----AKVPIDWEPCDVS-PLFINGLTTIPEPAVQS 91
            T+  I GDGIG E+  + +++ +A      +   +E  D     F+     +P   V++
Sbjct: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80

Query: 92  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148
           + +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G       VDLVI
Sbjct: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG---QPVDLVI 137

Query: 149 IRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERV----IRYAYEYARAIGRPRV 199
           +RENTE  Y   E           V ++IK I+  A+ER+    +R A +  R  GR  +
Sbjct: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197

Query: 200 IVVHKSTIQRLADGLFVDVAKEL----SQEYPDIQLETELIDNTVLNVVSNPSSYSNAVS 255
            V HKS +    DGLF +V +E+     + Y  I+   +++D+ V  +   P  +   V 
Sbjct: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VV 255

Query: 256 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315
           V PNLYGD+                   N+G+ + I E  HGSAPDIAG+  ANP A + 
Sbjct: 256 VAPNLYGDLLSDGAAALVGSLGLVPS-VNVGNNIIIGEPCHGSAPDIAGRGIANPIATIR 314

Query: 316 SSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           S  +ML  +GL   A  I++AV   +    +  + DL GK TT    D ++ R+
Sbjct: 315 SVSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  152 bits (384), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 122/390 (31%), Positives = 188/390 (48%), Gaps = 42/390 (10%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M R+ I R  TRR            +   P        +  I GDGIG E+  + KQ+ +
Sbjct: 1   MLRSAIGRLATRR-----------AYASAPK----SMVIGLIPGDGIGKEVIPAGKQVLE 45

Query: 61  --AAKVPIDWEPCDVSP---LFINGLTTIPEPAVQSI-NKNLVALKGPLATPIGK--GHR 112
             + K  ++++  D+      F      +PE  VQ + N+   AL G + +P  K  G+ 
Sbjct: 46  NLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYS 105

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG----- 167
           S  + LRK  GL+ANVRP KS+EG K     VD+VI+RENTE  Y  +E           
Sbjct: 106 SPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTR 163

Query: 168 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELS 223
           V ++ K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF ++ K++ 
Sbjct: 164 VAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVY 223

Query: 224 Q----EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
           +    +Y  +    +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 224 ESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGSLGVV 281

Query: 280 XXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLS 339
              AN+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML  +G N  A  I +AV +
Sbjct: 282 PS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDA 340

Query: 340 TIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
            +    + +T DL G +TT    + ++ +L
Sbjct: 341 NLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  152 bits (384), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 116/366 (31%), Positives = 181/366 (49%), Gaps = 26/366 (7%)

Query: 24  GKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD--AAKVPIDWEPCDVSP---LFI 78
           G+ + +   ++  FT+  I GDGIG E+    +++ +    K  +D++  D+      F+
Sbjct: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFL 66

Query: 79  NGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIE 135
           +    +P+  V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS++
Sbjct: 67  DTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVD 126

Query: 136 GFKTIYDNVDLVIIRENTEGEYSGIEHVV----TPG-VVQSIKLITRDASERVIRYAYEY 190
           G  T    VDLVI RENTE  Y   E       T G V ++IK I+  A+  +   A E 
Sbjct: 127 G--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184

Query: 191 A----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQ---EYPDIQLETELIDNTVLNV 243
           A    +  G   + V HKS +   +DGLF ++ K + Q   ++ ++Q   +++D+ V  +
Sbjct: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244

Query: 244 VSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAPDIA 303
              P  +   V V PNLYGDI                   N+G  + I E  HGSAPDI 
Sbjct: 245 FKEPQCFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-VNVGPNIVIGEPCHGSAPDIV 301

Query: 304 GQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTD 363
           GQ  ANP A + S+ ++L  +GL   A  IEK V   I    + +T DL G +T     +
Sbjct: 302 GQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIREN-KIKTPDLGGNSTGEQVAN 360

Query: 364 AVIGRL 369
            ++ R+
Sbjct: 361 DILSRI 366

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  152 bits (384), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 119/354 (33%), Positives = 176/354 (49%), Gaps = 27/354 (7%)

Query: 37  FTVSFIEGDGIGPEISQSVKQIFDAA--KVPIDWEPCDVSP---LFINGLTTIPEPAVQS 91
            T+  I GDGIG E+  + K+I ++   K  + ++  D+      F N    +P+  +  
Sbjct: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETIDI 80

Query: 92  I-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148
           + N+   AL G + +P  K  G+ S  + LRK  GLFANVRP KS++G K     VDLVI
Sbjct: 81  LKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVI 138

Query: 149 IRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAI----GRPRV 199
           +RENTE  Y     S I+      V  + K IT  A++ +   A + A+      G   +
Sbjct: 139 VRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATL 198

Query: 200 IVVHKSTIQRLADGLFVDVAKELSQ----EYPDIQLETELIDNTVLNVVSNPSSYSNAVS 255
            V HKS +   +DGLF +V +E  +    +Y  +Q   +++D+ V  +   P  +   V 
Sbjct: 199 TVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VV 256

Query: 256 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315
           V PNLYGDI                  AN+G  + I E  HGSAPDIAG+  +NP A + 
Sbjct: 257 VAPNLYGDILSDGAAALVGSLGVVPS-ANVGPNIVIGEPCHGSAPDIAGKGISNPIATIR 315

Query: 316 SSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           S+ +ML  +G    A  I KAV + I  G +  T DL G +TT    + V+ +L
Sbjct: 316 STALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  148 bits (374), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 120/389 (30%), Positives = 191/389 (49%), Gaps = 38/389 (9%)

Query: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60
           M R+++ ++ T R LS K    I K            T+  I GDGIG E+  + KQ+  
Sbjct: 1   MLRSVVTKSATIRHLSTK---GINK----------SLTIGLIPGDGIGKEVIPAGKQVLQ 47

Query: 61  --AAKVPIDWEPCDVSPLFINGLTT---IPEPAVQSINKNLVA-LKGPLATPIGK--GHR 112
             +++  +++   D+   F   L T   +P+  V+ + +     L G + +P  +   + 
Sbjct: 48  NLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG----V 168
           S  + LRK   L+AN+RP KS+ G  +    VD+VI+RENTE  Y  IE          V
Sbjct: 108 SPIVALRKELQLYANIRPVKSVAGAHS-GKPVDMVIVRENTEDLYIKIEKSYKDQNGMRV 166

Query: 169 VQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQ 224
            ++ K IT  A+ ++ + A + A    +  G+  + V HKS +   +DGLF ++ K++ Q
Sbjct: 167 AEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQ 226

Query: 225 ----EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXXXXXXX 280
               +Y  I    ++ID+ V  +   P  +   V V PNLYGDI                
Sbjct: 227 ANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVAPNLYGDILSDGAAALVGSLGVVP 284

Query: 281 XXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLST 340
             AN+G ++ + E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I KAV S 
Sbjct: 285 S-ANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESN 343

Query: 341 IASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           +    + +T DL G ++T +  D V+ +L
Sbjct: 344 MREN-KIKTPDLGGNSSTQNVVDDVLEKL 371

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  142 bits (358), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 176/358 (49%), Gaps = 28/358 (7%)

Query: 33  STGKFTVSFIEGDGIGPEISQSVKQIFD--AAKVPIDWEPCDVSP---LFINGLTTIPEP 87
           +T   T+  I GDGIG E+  + K + +  ++K  + +   D+      F++    +P+ 
Sbjct: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDE 76

Query: 88  AVQSI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNV 144
            +  + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+   +     +
Sbjct: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQEK---PI 133

Query: 145 DLVIIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAYEYA----RAIG 195
           D+VI+RENTE  Y     + I+      V ++IK I+  A+  +   A E A    +  G
Sbjct: 134 DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNG 193

Query: 196 RPRVIVVHKSTIQRLADGLFVDVAKELSQEYPD----IQLETELIDNTVLNVVSNPSSYS 251
              + V HKS +   +DGLF ++ +++ +   D    I    +++D+ V  +   P  + 
Sbjct: 194 SATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD 253

Query: 252 NAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPT 311
             V V PNLYGDI                  AN+G +  + E  HGSAPDIAG+  +NP 
Sbjct: 254 --VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPV 310

Query: 312 ALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           A + S+ +ML  MG    A  I KAV + +      +T DL GK+TT    D V+ R+
Sbjct: 311 ATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  142 bits (358), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 176/354 (49%), Gaps = 28/354 (7%)

Query: 37  FTVSFIEGDGIGPEISQSVKQIFD--AAKVPIDWEPCDVSP---LFINGLTTIPEPAVQS 91
            T+  I GDGIG E+  + +Q+ +  ++K  + ++  D+      F      +P+  +  
Sbjct: 21  LTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDI 80

Query: 92  I-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148
           + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+   +     VD++I
Sbjct: 81  LRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQER---PVDMII 137

Query: 149 IRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRV 199
           +RENTE  Y     + I+      V ++IK I+  A++ +   A E A    +  G   +
Sbjct: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATL 197

Query: 200 IVVHKSTIQRLADGLFVDVAKELSQEYPD----IQLETELIDNTVLNVVSNPSSYSNAVS 255
            V HKS +   +DGLF +V +++ +   D    I+   +++D+ V  +   P  +   V 
Sbjct: 198 TVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VI 255

Query: 256 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315
           V PNLYGDI                  AN+G +  + E  HGSAPDIAG+  +NP A + 
Sbjct: 256 VAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPVATIR 314

Query: 316 SSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           S+ +ML  MG    A  I KAV + +      +T DL GK+TT    + V+ R+
Sbjct: 315 STALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 95/352 (26%), Positives = 155/352 (44%), Gaps = 34/352 (9%)

Query: 42  IEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGL------TTIPEPAVQSINKN 95
           + GD IG E+ +   ++  A +  +     D     + G       + +P+ A+ +  + 
Sbjct: 10  LPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAAKEA 69

Query: 96  LVALKGPLATPIGKG-----HRSLNLTLRKTFGLFANVRP----AKSIEGFK----TIYD 142
              L G +  P  +G      + L L LR+  G++AN+RP    A S+         I  
Sbjct: 70  DAVLLGAVGGPKWQGGAVRPEQGL-LKLRQELGVYANLRPCNFAADSLLELSPLRPEIAR 128

Query: 143 NVDLVIIRENTEGEYSGIEHVVT-PGVVQSIKLITRDASERVIRYAYEYARAIGRPR-VI 200
           + D++++RE   G Y G  H     GV       T    +R+ R A   A     P  V 
Sbjct: 129 DTDIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAGFLALQHDPPLPVW 188

Query: 201 VVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNL 260
            + K+ +   +      V +    E+P++QL+ +LID+  + +V NP ++ N V V  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETFQSEFPNVQLQHQLIDSAAMILVKNPRAF-NGVVVTSNM 247

Query: 261 YGDIXXXXXXXXXXX-----XXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315
           +GDI                        +      ++E  HGSAPD+    KANP   +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPDLPA-GKANPIGCIL 306

Query: 316 SSVMMLNHMGLNNHA--DKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAV 365
           S+ MML  + LN  A  + +E+AV   + SG   RTGDL G ++TS   DA+
Sbjct: 307 SAAMMLK-LSLNMVAAGEAVEQAVQEVLDSGV--RTGDLLGSSSTSEVGDAI 355

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 121/272 (44%), Gaps = 32/272 (11%)

Query: 116 LTLRKTFGLFANVRP----AKSIEGFK----TIYDNVDLVIIRENTEGEYSG-IEHVVTP 166
           L +RK  GL+AN+RP    +KS+ G       I    D VI+RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 167 GVVQSIKLITRDASERVIRYAYEYARAIGRP-------RVIVVHKSTIQRLADGLFVDVA 219
           GV    +  T    ER+ R     A     P       +  V+  S + R        V 
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRRT------VN 207

Query: 220 KELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXX---- 275
           + + +E+P + ++ +LID+  + ++ NP  + N + +  N++GDI               
Sbjct: 208 ETIKREFPQLSVQHQLIDSAAMIMIKNPRKF-NGIVITSNIFGDIISDAASVIPGSLGLL 266

Query: 276 -XXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLNNHADKI 333
                    +  +   ++E  HGSAPD+  + +ANP A +LS+ MML   + + +    I
Sbjct: 267 PSASLASEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAI 325

Query: 334 EKAVLSTIASGPEGRTGDLAGKATTSSFTDAV 365
           E AV   I SG   RTGDL G  TT+   DAV
Sbjct: 326 ENAVKQVIESGI--RTGDLGGNNTTTEVGDAV 355

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 85.5 bits (210), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 96/362 (26%), Positives = 151/362 (41%), Gaps = 48/362 (13%)

Query: 39  VSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSP--------LFING--LTTIPEP- 87
           ++   GD IG EI +   ++ DA          +VSP          I G  +    EP 
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAI--------AEVSPNVSFKYNYQLIGGAAIDATGEPL 58

Query: 88  ---AVQSINKNLVALKGPLATPIGKGHRSLN-----LTLRKTFGLFANVRPAKSIEGF-- 137
              A+Q    +   L G +  P   GH  +      L +RK  G++AN+RP + +     
Sbjct: 59  TDEALQVAKNSDAILLGAVGGP-KWGHGLVRPEQGLLKIRKELGVYANLRPCQFVSETLL 117

Query: 138 ------KTIYDNVDLVIIRENTEGEYSG-IEHVVTPGVVQSIKLITRDASERVIRYAYEY 190
                 + I    D VI+RE   G Y G  +     GV    +  +    +R+ R A   
Sbjct: 118 DLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDDGVAWDKESYSVPEIQRITRMAAFL 177

Query: 191 ARAIGRPR-VIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSS 249
           A     P  V  + K+ +   +      V + +  E+P + +   LID+  + +V NP+ 
Sbjct: 178 ALQHNPPLPVWSLDKANVLATSRLWRKTVEETIKNEFPTLTINHHLIDSAAMTLVQNPTK 237

Query: 250 YSNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHEVSIFEAVHGSAPDIAG 304
             N V +  N++GDI                        +    + ++E  HGSAPD+  
Sbjct: 238 L-NGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPDLPA 296

Query: 305 QNKANPTALLLSSVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTD 363
            + ANP A +LS+ MM    + L    + IE+AV  TI +G   +TGDL GK TT+   +
Sbjct: 297 -DHANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTIDAGI--KTGDLGGKNTTTEVGN 353

Query: 364 AV 365
           AV
Sbjct: 354 AV 355

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 85.1 bits (209), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 122/272 (44%), Gaps = 22/272 (8%)

Query: 116 LTLRKTFGLFANVRPAKSIE----GFKTIYDNV----DLVIIRENTEGEYSG-IEHVVTP 166
           L +RK  GL+ N+RP K I     G   + + V    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELGLYGNLRPCKFISDKLIGLSPLKEEVCKGTDFVVVRELVGGIYFGERQEDDGS 153

Query: 167 GVVQSIKLITRDASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEY 226
           GV    +  + +  +R+ + A   +     P  I          +  L+     E   E+
Sbjct: 154 GVAWDSEKYSIEEVKRITKMAAFLSLQNDPPLPIWSLDKANVLASSRLWRAAVDETIAEF 213

Query: 227 PDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXX 281
           P+++++ +LID+  + +V NP+   N + +  N++GDI                      
Sbjct: 214 PNLKVQHQLIDSAAMMLVKNPTQL-NGIILTNNMFGDIISDEASVIPGSLGLLPSASLAS 272

Query: 282 XANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLNNHADKIEKAVLST 340
             +      ++E  HGSAPD+A + K NP A +LS+ MML   + +    + IE+AV   
Sbjct: 273 LPDKNKAFGLYEPCHGSAPDLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVV 331

Query: 341 IASGPEGRTGDLAGKATTSSFTDAV---IGRL 369
           +  G   RT DL G +TTS   DAV   +GR+
Sbjct: 332 LDRGI--RTADLGGNSTTSELGDAVAQELGRI 361

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 121/266 (45%), Gaps = 20/266 (7%)

Query: 116 LTLRKTFGLFANVRP----AKSIEGFKTIY----DNVDLVIIRENTEGEYSG-IEHVVTP 166
           L +RK   L+AN+RP    ++S+     +        D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 167 GVVQSIKLITRDASERVIRYAYEYARAIGRPRVIV-VHKSTIQRLADGLFVDVAKELSQE 225
           GV    +  T+   +R+ R A   A     P  I  + K+ +   +      V + +  E
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 211

Query: 226 YPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P ++L  +LID+  + +V +P+   N + +  NL+GDI                     
Sbjct: 212 FPQLKLNHQLIDSAAMILVKSPTQL-NGIVLTSNLFGDIISDEASVIPGSLGLLPSASLA 270

Query: 281 XXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLNNHADKIEKAVLS 339
              +      ++E  HGSAPD+  + K NP A++LS+ MML   + L+   + +EKAV  
Sbjct: 271 SLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQ 329

Query: 340 TIASGPEGRTGDLAGKATTSSFTDAV 365
            + SG   RTGDL G  +TS   DA+
Sbjct: 330 VLDSGV--RTGDLGGSNSTSEVGDAI 353

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 120/266 (45%), Gaps = 20/266 (7%)

Query: 116 LTLRKTFGLFANVRP----AKSIEGFK----TIYDNVDLVIIRENTEGEYSGI-EHVVTP 166
           L +RK  GL+AN+RP    ++S+ G       I    D +++RE   G Y G  +     
Sbjct: 93  LKIRKELGLYANLRPCNFASESLLGLSPLRPEIAKGTDFMVVRELVGGIYFGKRKEDEGD 152

Query: 167 GVVQSIKLITRDASERVIRYAYEYARAIGRPRVIV-VHKSTIQRLADGLFVDVAKELSQE 225
           GV    +  +    +R+ R A   A     P  I  + K+ +   +      V + +  E
Sbjct: 153 GVAWDSEQYSVPEVQRITRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 212

Query: 226 YPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P + ++ +LID+  + +V NP+   N + +  N++GDI                     
Sbjct: 213 FPTLTVQNQLIDSAAMILVKNPTQL-NGIIITSNMFGDIISDEASVIPGSLGLLPSASLA 271

Query: 281 XXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLNNHADKIEKAVLS 339
              +      ++E  HGSAPD+  + K NP A +LS+ MML   + L    D IE+AV  
Sbjct: 272 SLPDTNTAFGLYEPCHGSAPDLP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKK 330

Query: 340 TIASGPEGRTGDLAGKATTSSFTDAV 365
            + +G   RTGDL G  +T+   DA+
Sbjct: 331 VLDAGI--RTGDLGGSNSTTEVGDAI 354

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 82.4 bits (202), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 93/354 (26%), Positives = 155/354 (43%), Gaps = 32/354 (9%)

Query: 39  VSFIEGDGIGPEISQSVKQIFDA-----AKVPIDWEPCDVSPLFINGL-TTIPEPAVQSI 92
           +  + GD +G EI+    ++  A     + V  D+E   +    I+     +P+ A+++ 
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 93  NKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEGFKTIY-- 141
            K    L G +  P  G G     + L L +RK   L+AN+RP    ++S+     I   
Sbjct: 67  KKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPIKPQ 125

Query: 142 --DNVDLVIIRENTEGEYSG-IEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPR 198
                D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P 
Sbjct: 126 FAKGTDFVVVRELVGGIYFGERKEDDGDGVAWDCEQYTVPEVQRITRMAAFMALQHEPPL 185

Query: 199 VIV-VHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVC 257
            I  + K+ +   +      V + +  E+P ++++ +LID+  + +V NP ++ N + + 
Sbjct: 186 PIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNP-THLNGIIIT 244

Query: 258 PNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTA 312
            N++GDI                        +      ++E  HGSAPD+  +NK NP A
Sbjct: 245 SNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPVA 303

Query: 313 LLLSSVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAV 365
            +LS+ MML   + L      IE AV   + +G   RTGDL G  +T+   DAV
Sbjct: 304 TILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAGI--RTGDLGGSNSTTEVGDAV 355

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 131/303 (43%), Gaps = 26/303 (8%)

Query: 84  IPEPAVQSINKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK------ 132
           +P+ A+++  K    L G +  P  G G     + L L +RK   L+AN+RP        
Sbjct: 56  LPDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSL 114

Query: 133 -SIEGFKTIY-DNVDLVIIRENTEGEYSG-IEHVVTPGVVQSIKLITRDASERVIRYAYE 189
             +   K  Y    D V++RE   G Y G  +     GV    +  +    +R+ R A  
Sbjct: 115 LELSPLKAQYAQGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEQYSVPEVQRITRMAAF 174

Query: 190 YARAIGRPRVIV-VHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPS 248
            A     P  I  + K+ +   +      V K + +E+P + +  +LID+  + +V NP+
Sbjct: 175 LALQHNPPLPIWSLDKANVLASSRLWRKTVEKTIKEEFPTLSVNHQLIDSAAMILVKNPT 234

Query: 249 SYSNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHEVSIFEAVHGSAPDIA 303
              N + +  N++GDI                        +      ++E  HGSAPD+A
Sbjct: 235 QL-NGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLA 293

Query: 304 GQNKANPTALLLSSVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFT 362
            + K NP A +LS+ MML   + +      IEKAV   +  G   RTGDL G  +TS   
Sbjct: 294 -KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVLDDGI--RTGDLGGSNSTSEVG 350

Query: 363 DAV 365
           DAV
Sbjct: 351 DAV 353

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 93/351 (26%), Positives = 153/351 (43%), Gaps = 32/351 (9%)

Query: 42  IEGDGIGPEISQSVKQIFDA-----AKVPIDWEPCDVSPLFINGL-TTIPEPAVQSINKN 95
           + GD +G EI+    ++  A     + V  D+E   +    I+     +P+ A+++  K 
Sbjct: 10  LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEASKKA 69

Query: 96  LVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEGFKTIY----D 142
              L G +  P  G G     + L L +RK   L+AN+RP    + S+     I      
Sbjct: 70  DAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAK 128

Query: 143 NVDLVIIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIV 201
             D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P  I 
Sbjct: 129 GTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPIW 188

Query: 202 -VHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNL 260
            + K+ +   +      V + +  E+P ++++ +LID+  + +V NP ++ N + +  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNP-THLNGIIITSNM 247

Query: 261 YGDIXXXXXXXXXXX-----XXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315
           +GDI                        +      ++E  HGSAPD+  +NK NP A +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATIL 306

Query: 316 SSVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAV 365
           S+ MML   + L      IE AV   + +G   RTGDL G  +T+   DAV
Sbjct: 307 SAAMMLKLSLNLPEEGKAIEDAVKKVLDAGI--RTGDLGGSNSTTEVGDAV 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 93/351 (26%), Positives = 153/351 (43%), Gaps = 32/351 (9%)

Query: 42  IEGDGIGPEISQSVKQIFDA-----AKVPIDWEPCDVSPLFINGL-TTIPEPAVQSINKN 95
           + GD +G EI+    ++  A     + V  D+E   +    I+     +P+ A+++  K 
Sbjct: 10  LPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEASKKA 69

Query: 96  LVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEGFKTIY----D 142
              L G +  P  G G     + L L +RK   L+AN+RP    + S+     I      
Sbjct: 70  DAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAK 128

Query: 143 NVDLVIIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIV 201
             D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P  I 
Sbjct: 129 GTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPIW 188

Query: 202 -VHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNL 260
            + K+ +   +      V + +  E+P ++++ +LID+  + +V NP ++ N + +  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNP-THLNGIIITSNM 247

Query: 261 YGDIXXXXXXXXXXX-----XXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315
           +GDI                        +      ++E  HGSAPD+  +NK NP A +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATIL 306

Query: 316 SSVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAV 365
           S+ MML   + L      IE AV   + +G   RTGDL G  +T+   DAV
Sbjct: 307 SAAMMLKLSLNLPEEGKAIEDAVKKVLDAGI--RTGDLGGSNSTTEVGDAV 355

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 155/355 (43%), Gaps = 33/355 (9%)

Query: 39  VSFIEGDGIGPEISQSVKQIFDA------AKVPIDWEPCDVSPLFINGL-TTIPEPAVQS 91
           +  + GD +G EI++   ++  A      +KV  D++   +    I+     + + A+++
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEA 66

Query: 92  INKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEGFK---- 138
             K    L G +  P  G G     + L L +RK  GL+AN+RP    ++ + G      
Sbjct: 67  SKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASEPLLGLSPLRP 125

Query: 139 TIYDNVDLVIIRENTEGEYSG-IEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRP 197
            I    D +++RE   G Y G  +     GV    +  +    ER+ R A   A     P
Sbjct: 126 EIAKGTDFMVVRELVGGIYFGERKEDDGDGVAWDSEKYSVPEVERITRMAAFLALQHNPP 185

Query: 198 RVIV-VHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSV 256
             I  + K+ +   +      V   +  E+P + ++ +LID+  + +V NP+   N + +
Sbjct: 186 LPIWSLDKANVLASSRLWRKTVEATIKNEFPTLTVQNQLIDSAAMILVKNPTQL-NGIII 244

Query: 257 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPT 311
             N++GDI                        +      ++E  HGSAPD+  +NK NP 
Sbjct: 245 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPV 303

Query: 312 ALLLSSVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAV 365
           A +LS+ MML   + +    + +E+AV   + +G   RTGDL G  +T    DA+
Sbjct: 304 ATILSAAMMLKLSLNMVKEGEAVEEAVRRVLDAGV--RTGDLGGSNSTQEVGDAI 356

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 134/305 (43%), Gaps = 26/305 (8%)

Query: 82  TTIPEPAVQSINKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK---- 132
           T +P+ A+++  K    L G +  P  G G     + L L +RK  GL+AN+RP      
Sbjct: 54  TPLPDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASD 112

Query: 133 ---SIEGFKTIY-DNVDLVIIRENTEGEYSG-IEHVVTPGVVQSIKLITRDASERVIRYA 187
               +   K  Y    D V++RE   G Y G  +     GV    +  +    +R+ R A
Sbjct: 113 SLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMA 172

Query: 188 YEYARAIGRPRVIV-VHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSN 246
              A     P  I  + K+ +   +      V + +  E+P + ++ +LID+  + +V +
Sbjct: 173 AFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKTEFPQLTVQHQLIDSAAMILVKS 232

Query: 247 PSSYSNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHEVSIFEAVHGSAPD 301
           P+   N V +  N++GDI                        +      ++E  HGSAPD
Sbjct: 233 PTKL-NGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPD 291

Query: 302 IAGQNKANPTALLLSSVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           +   NK NP A +LS+ MML   + L      +E+AV + + +G   RTGDL G  +T+ 
Sbjct: 292 LPA-NKVNPIATILSAAMMLKLSLDLVEEGRALEEAVRNVLDAGV--RTGDLGGSNSTTE 348

Query: 361 FTDAV 365
             DA+
Sbjct: 349 VGDAI 353

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 96/393 (24%), Positives = 167/393 (42%), Gaps = 34/393 (8%)

Query: 2   FRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFT--VSFIEGDGIGPEISQSVKQIF 59
            R+++ R++ R +    +Q +    T     +  + T  +  + GD +G EI++   ++ 
Sbjct: 51  LRSVLFRSSNRSYPLHSHQFNFIISTHHSTTAMAQTTKHIVVLPGDHVGQEITEEAIKVL 110

Query: 60  DA-----AKVPIDWEPCDVSPLFINGL-TTIPEPAVQSINKNLVALKGPLATP-IGKG-- 110
           +A       V  D++   +    I+     +P+ A+++  K    L G +  P  G G  
Sbjct: 111 NAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDEALEASKKADAVLLGAVGGPKWGTGSV 170

Query: 111 --HRSLNLTLRKTFGLFANVRPAK-------SIEGFK-TIYDNVDLVIIRENTEGEYSG- 159
              + L L +RK   L+AN+RP          +   K  I    D+ I+RE   G Y G 
Sbjct: 171 RPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKPEIVKGTDICIVRELVGGIYFGE 229

Query: 160 IEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPR-VIVVHKSTIQRLADGLFVDV 218
            +     GV    +  +    +R+ R A   A     P  V  + K+ +   +      V
Sbjct: 230 RKEDEGDGVAWDSEKYSVSEVQRITRMAGFLALQHNPPLPVWSLDKANVLASSRLWRKTV 289

Query: 219 AKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXXXXX--- 275
            + +  E+P + ++ +LID+  + +V NP+ + N V +  N++GDI              
Sbjct: 290 EETIKNEFPTLTVQHQLIDSAAMILVKNPT-HLNGVVIANNMFGDIISDEASVIPGSLGL 348

Query: 276 --XXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLNNHADK 332
                     +      ++E  HGSAPD+  + K NP A +LS  MML   + +      
Sbjct: 349 LPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIA 407

Query: 333 IEKAVLSTIASGPEGRTGDLAGKATTSSFTDAV 365
           +EKAV   + SG   RT DL G  +TS   DA+
Sbjct: 408 VEKAVKQVLDSGV--RTADLRGSNSTSEVGDAI 438

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 92/359 (25%), Positives = 155/359 (43%), Gaps = 39/359 (10%)

Query: 38  TVSFIEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGL----------TTIPEP 87
           T+  + GD +G EI++   ++ +A +   +  P  V+  F + L            +P+ 
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQ---ECRPDKVNFKFDHHLIGGAAIDATGVPLPDE 62

Query: 88  AVQSINKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIE 135
           A+++  K    L G +  P  G G     + L L +RK   L+AN+RP          + 
Sbjct: 63  ALEASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLS 121

Query: 136 GFK-TIYDNVDLVIIRENTEGEYSG-IEHVVTPGVVQSIKLITRDASERVIRYAYEYARA 193
             K  I    D V++RE   G Y G  +     GV    +  +    +R+ R A   A  
Sbjct: 122 PLKPEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQ 181

Query: 194 IGRPRVIV-VHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSN 252
              P  I  + K+ +   +      V + +  E+P + ++ +LID+  + +V NP ++ N
Sbjct: 182 HNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQHQLIDSAAMILVKNP-THLN 240

Query: 253 AVSVCPNLYGDIXXXXXXXX-----XXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQNK 307
            + +  N++GDI                        +      ++E  HGSAPD+  + K
Sbjct: 241 GIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KGK 299

Query: 308 ANPTALLLSSVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAV 365
            NP A +LS+ MML   + L    + IE+AV   + SG   RT DL G  +T+   DAV
Sbjct: 300 VNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSGI--RTADLKGTNSTTEVGDAV 356

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 93/352 (26%), Positives = 153/352 (43%), Gaps = 34/352 (9%)

Query: 42  IEGDGIGPEISQSVKQIFDA-----AKVPIDWEPCDVSPLFINGLTTIP--EPAVQSINK 94
           + GD +G EI++   ++  A       V  D+E   +    I+  T +P  + A+++  K
Sbjct: 10  LPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDA-TGVPLTDEALEASKK 68

Query: 95  NLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEGFKTIYDN-- 143
               L G +  P  G G     + L L +RK   L+AN+RP    ++S+     I     
Sbjct: 69  ADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLELSPIKPQFA 127

Query: 144 --VDLVIIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVI 200
              D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P  I
Sbjct: 128 RGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHQPPLPI 187

Query: 201 V-VHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPN 259
             + K+ +   +      V + +  E+P ++++ +LID+  + +V NP+   N + +  N
Sbjct: 188 WSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPTQL-NGIIITSN 246

Query: 260 LYGDIXXXXXXXXXXX-----XXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALL 314
           ++GDI                        +      ++E  HGSAPD+  +NK NP A +
Sbjct: 247 MFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATI 305

Query: 315 LSSVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAV 365
           LS+ MML   + +      IE AV   + +G   RTGDL G  +T    DAV
Sbjct: 306 LSAAMMLKLSLNMTAEGQAIEDAVKKVLDAGI--RTGDLGGSNSTIEVGDAV 355

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 152/355 (42%), Gaps = 32/355 (9%)

Query: 42  IEGDGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGLTT------IPEPAVQSINKN 95
           + GD +G EI++   ++  A       +  +     I G         +P+ ++++  K+
Sbjct: 10  LPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAAKKS 69

Query: 96  LVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEGFKTIYDNV-- 144
              L G +  P  G G     + L L +RK   L+AN+RP    ++S+     +      
Sbjct: 70  DAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKPECAR 128

Query: 145 --DLVIIRENTEGEYSGIEHVVT-PGVVQSIKLITRDASERVIRYAYEYARAIGRPR-VI 200
             D V++RE   G Y G     T  GV    +  +    +R+ R A   A     P  V 
Sbjct: 129 GTDFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMAAFLALQHSPPLPVW 188

Query: 201 VVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNL 260
            + K+ +   +      V + +  E+P + ++ +LID+  + +V NP+   N V +  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPTQL-NGVIITNNM 247

Query: 261 YGDIXXXXXXXX-----XXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315
           +GDI                        +      ++E  HGSAPD+  + K NP A +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KGKVNPIATIL 306

Query: 316 SSVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           S+ MML   + +      +E+AV   + SG   RT DL G +TTS   +AV+  L
Sbjct: 307 SAAMMLKLSLDMFEEGAAVEEAVRKVLDSGV--RTADLKGTSTTSEVGEAVVKAL 359

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 118/267 (44%), Gaps = 20/267 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SIEGFKTIY-DNVDLVIIRENTEGEYSG-IEHVVTP 166
           L +RK   L+AN+RP          +   K  Y    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 167 GVVQSIKLITRDASERVIRYAYEYARAIGRPRVIV-VHKSTIQRLADGLFVDVAKELSQE 225
           GV    +  +    +R+ R A   A     P  I  + K+ +   +      V + +  E
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 226 YPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDIXXXXXXXX-----XXXXXXXX 280
           +P + ++ +LID+  + +V +P+   N + +  N++GDI                     
Sbjct: 214 FPTLTVQHQLIDSAAMILVKSPTKL-NGIVITSNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 281 XXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLNNHADKIEKAVLS 339
              +      ++E  HGSAPD+  +NK NP A +LS+ MML   + L    + +E+AV  
Sbjct: 273 SLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRR 331

Query: 340 TIASGPEGRTGDLAGKATTSSFTDAVI 366
            + +G   RT DL G+ +TS   DAV+
Sbjct: 332 VLDAGI--RTADLRGENSTSEVGDAVV 356

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 134/305 (43%), Gaps = 26/305 (8%)

Query: 82  TTIPEPAVQSINKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AK 132
           T +P+ A+ +   +   L G +  P  G G     + L L +RK   L+AN+RP    + 
Sbjct: 56  TPLPDEALDAAKNSDAVLLGAVGGPKWGTGDVRPEQGL-LKIRKELQLYANLRPCNFVSD 114

Query: 133 SIEGFKTIYDNV----DLVIIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYA 187
           S+ G   + + +    D  ++RE   G Y G  +     G     +  T    +R+ R A
Sbjct: 115 SLLGLSPLKEEIAKGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMA 174

Query: 188 YEYARAIGRPRVIV-VHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSN 246
              A     P  I  + K+ +   +      V + +  E+P+++++ +LID+  + +V +
Sbjct: 175 AFLALQHDPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPNLKVQHQLIDSAAMILVKS 234

Query: 247 PSSYSNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHEVSIFEAVHGSAPD 301
           P    N + +  N++GDI                        +      ++E  HGSAPD
Sbjct: 235 PRQL-NGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 302 IAGQNKANPTALLLSSVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360
           +  + K NP A +LS+ MML   + L +    IE+AV   + +G   RT DL G  +TS 
Sbjct: 294 LP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAGI--RTADLKGSNSTSE 350

Query: 361 FTDAV 365
             DAV
Sbjct: 351 VGDAV 355

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 87/349 (24%), Positives = 148/349 (42%), Gaps = 32/349 (9%)

Query: 44  GDGIGPEISQSVKQIFDA-----AKVPIDWEPCDVSPLFINGL-TTIPEPAVQSINKNLV 97
           GD +G EI+    ++  A     + V  +++   +    I+     +P+ ++++  K   
Sbjct: 12  GDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAAKKADA 71

Query: 98  ALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKTIY-DNV 144
            L G +  P  G G     + L L +RK   L+AN+RP          +   K  +    
Sbjct: 72  VLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKAEHARGT 130

Query: 145 DLVIIRENTEGEYSG-IEHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPR-VIVV 202
           D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V  +
Sbjct: 131 DFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQHNPPLPVWSL 190

Query: 203 HKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYG 262
            K+ +   +      V + +  E+P + ++ +LID+  + +V NP+   N V +  N++G
Sbjct: 191 DKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMIMVKNPTQL-NGVIITNNMFG 249

Query: 263 DIXXXXXXXXXXX-----XXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSS 317
           DI                        +      ++E  HGSAPD+  + K NP A +LS+
Sbjct: 250 DIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE-KGKVNPIATILSA 308

Query: 318 VMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAV 365
            MML   + +      +E+AV   + SG   RTGDL G  +T    DAV
Sbjct: 309 AMMLELSLDMFEEGTAVEEAVRRVLDSGI--RTGDLRGSNSTQEVGDAV 355

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 85/350 (24%), Positives = 145/350 (41%), Gaps = 33/350 (9%)

Query: 44  GDGIGPEISQSVKQIFDAA------KVPIDWEPCDVSPLFINGL-TTIPEPAVQSINKNL 96
           GD +G E+++   +I  A       KV  ++E   +    I+     +P+ ++++  +  
Sbjct: 12  GDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLEASKRAD 71

Query: 97  VALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKTIY-DN 143
             L G +  P  G G     + L L +RK   L+AN+RP          +   K  Y   
Sbjct: 72  AVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKEKYAKG 130

Query: 144 VDLVIIRENTEGEYSGI-EHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIV- 201
            D  ++RE   G Y G  +     GV    +  +    +R+ R A   A     P  I  
Sbjct: 131 TDFTVVRELVGGIYFGKRKEDDGDGVAWDSEQYSVPEVQRITRMAAFLAMQHNPPLPIWS 190

Query: 202 VHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLY 261
           + K+ +   +      V + +  E+P +++  +LID+  + +V NP+   N + +  N++
Sbjct: 191 LDKANVLASSRLWRKTVEETIQNEFPSLKVSHQLIDSAAMILVKNPTQL-NGIIITNNMF 249

Query: 262 GDIXXXXXX-----XXXXXXXXXXXXANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLS 316
           GDI                        +      ++E  HGSAPD+  + K NP   +LS
Sbjct: 250 GDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLYEPCHGSAPDLP-KGKVNPIGTILS 308

Query: 317 SVMMLN-HMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAV 365
             MML   + L      +E+AV   + +    RT DL G  +TS   DAV
Sbjct: 309 VAMMLKLSLNLKEEGIAVEEAVRRVLDNNI--RTADLGGSNSTSDIGDAV 356

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 48.1 bits (113), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 319 MMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           +MLNH+GLN  A +I KAV  TIA G    T D+ G ++T+ FT+ +I +L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKH-TTRDIGGSSSTTDFTNEIINKL 50

>NCAS0A05250 Chr1 (1038189..1038776) [588 bp, 195 aa] {ON} Anc_4.152
           YGR016W
          Length = 195

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 225 EYP-DIQLETELIDNTVLNVVSNPSSYSNAVSVC 257
           EYP D + + ELI N  LN  S    Y NAVSVC
Sbjct: 36  EYPMDSEEQEELIQNFALNNYSRNQQYVNAVSVC 69

>KNAG0H01030 Chr8 complement(172427..173758) [1332 bp, 443 aa] {ON} 
          Length = 443

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 51/116 (43%), Gaps = 10/116 (8%)

Query: 73  VSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAK 132
           +S L +N LT++ +    + N +L  L+    T +G G    N T  K+   FAN++   
Sbjct: 242 ISELKLNNLTSVGQTFTITFNNDLTHLEFSNLTKVGGGFVVANNTNLKSIDAFANLQTVN 301

Query: 133 SIEGFKTIYDNVDLVIIR--------ENTEGEYSG--IEHVVTPGVVQSIKLITRD 178
                   +D++DL  ++        E     +S   ++ + + G +Q  K I ++
Sbjct: 302 GALDVIGNFDSLDLTALKSVRGGADVETKSANFSCSPLKKLQSKGAIQGDKFICKN 357

>TDEL0A04220 Chr1 complement(748109..752113) [4005 bp, 1334 aa] {ON}
           Anc_5.559 YDR443C
          Length = 1334

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 55/135 (40%), Gaps = 25/135 (18%)

Query: 77  FINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTL-RKTFGLFANVRPAKSIE 135
            I+ L+TI EP++                 + K H  +N++   + F  F NV+PAK I+
Sbjct: 869 LISSLSTIKEPSIY----------------VKKHHSMMNMSADSQVFSKFLNVKPAKGIK 912

Query: 136 GFKTIYDNV----DLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAYEYA 191
            F+ +        D +         Y G E     G  + +KL + D+   +    ++ +
Sbjct: 913 NFRFLMLTTSYAEDCLSFVSTLCQTYIGYEF----GFCELLKLTSDDSQGLMQLPDFDKS 968

Query: 192 RAIGRPRVIVVHKST 206
           R +     IV + ST
Sbjct: 969 RLLLLAAQIVTYCST 983

>ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR089W
          Length = 832

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%)

Query: 312 ALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369
           AL L    ML   G ++    +E   +S +AS      G+L   ATT S T AV  R+
Sbjct: 121 ALELFMAWMLQRFGRHHFKVPVENLAMSIVASSLVNDRGELLSYATTCSVTYAVTTRI 178

>KLTH0G12474g Chr7 (1059087..1059776) [690 bp, 229 aa] {ON} similar
           to uniprot|Q12354 Saccharomyces cerevisiae YLR118C
          Length = 229

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 39/92 (42%), Gaps = 19/92 (20%)

Query: 92  INKNLVALKGPL--ATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVII 149
           IN  L+ LK P    TPI  GH   +  +   +G         S+E F T Y       I
Sbjct: 149 INDKLLELKSPANSDTPIFHGHGDQDTVIPLKYG--------HSVEQFFTKYCG-----I 195

Query: 150 RENTEGEYSGIEHVVTP----GVVQSIKLITR 177
              T   YSG+EH  +P     +V+ +K I R
Sbjct: 196 SNYTMNVYSGMEHSASPEEIEDLVKFLKSILR 227

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,853,602
Number of extensions: 1374155
Number of successful extensions: 4194
Number of sequences better than 10.0: 95
Number of HSP's gapped: 3993
Number of HSP's successfully gapped: 95
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)