Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C013905.475ON70970935290.0
Skud_15.3025.475ON67872211691e-150
NCAS0H022705.475ON69672110931e-139
Suva_8.1905.475ON66654410901e-139
TPHA0J027805.475ON63171110831e-138
YOR138C (RUP1)5.475ON67154810801e-137
Smik_15.3185.475ON67255710631e-135
Kpol_543.95.475ON64268910591e-134
TDEL0A033905.475ON62269610331e-131
KAFR0E025405.475ON6595429621e-120
SAKL0G03564g5.475ON6055478911e-110
Kwal_55.212675.475ON6046968431e-103
TBLA0A025405.475ON6785448154e-98
KLTH0F15004g5.475ON5975348061e-97
ZYRO0D11264g5.475ON5475207262e-86
TBLA0B022305.475ON7905517422e-86
CAGL0I07205g5.475ON6036996933e-81
KNAG0B040505.475ON6735186582e-75
KLLA0E03169g5.475ON5445334871e-52
Skud_5.2808.185ON42834830.19
KAFR0C004103.270ON76948840.20
YER143W (DDI1)8.185ON42834830.21
NDAI0C058908.185ON46235810.43
Suva_7.688.155ON267281790.76
NCAS0I016203.270ON79583780.91
Smik_5.3088.185ON42834780.96
Suva_5.2718.185ON42834761.7
Suva_4.2953.270ON78263761.9
CAGL0D01826g8.155ON2666100762.2
CAGL0I06787g8.185ON42634742.4
Skud_7.778.155ON267281752.6
NCAS0J016604.276ON116234734.5
Kpol_219.1singletonON24971696.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C01390
         (709 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...  1363   0.0  
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...   454   e-150
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...   425   e-139
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...   424   e-139
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   421   e-138
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...   420   e-137
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...   414   e-135
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   412   e-134
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   402   e-131
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   375   e-120
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   347   e-110
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   329   e-103
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   318   4e-98
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   315   1e-97
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   284   2e-86
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   290   2e-86
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   271   3e-81
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   258   2e-75
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   192   1e-52
Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W ...    37   0.19 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    37   0.20 
YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA da...    37   0.21 
NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON} Anc_8...    36   0.43 
Suva_7.68 Chr7 (126915..134933) [8019 bp, 2672 aa] {ON} YGL195W ...    35   0.76 
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    35   0.91 
Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W ...    35   0.96 
Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W ...    34   1.7  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    34   1.9  
CAGL0D01826g Chr4 (189933..197933) [8001 bp, 2666 aa] {ON} simil...    34   2.2  
CAGL0I06787g Chr9 complement(658666..659946) [1281 bp, 426 aa] {...    33   2.4  
Skud_7.77 Chr7 (137226..145244) [8019 bp, 2672 aa] {ON} YGL195W ...    33   2.6  
NCAS0J01660 Chr10 (297346..300834) [3489 bp, 1162 aa] {ON} Anc_4...    33   4.5  
Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,...    31   6.9  

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score = 1363 bits (3529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/709 (93%), Positives = 666/709 (93%)

Query: 1   MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTG 60
           MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTG
Sbjct: 1   MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTG 60

Query: 61  QQEPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQENVTSQ 120
           QQEPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQENVTSQ
Sbjct: 61  QQEPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQENVTSQ 120

Query: 121 HGEDRDDDGDNIQENDEXXXXXXXXXXXXXXXXXXNYNVVTYTQLKARVTDPTIILPVPM 180
           HGEDRDDDGDNIQENDE                  NYNVVTYTQLKARVTDPTIILPVPM
Sbjct: 121 HGEDRDDDGDNIQENDESTFSSSSTSSQSPAPSPPNYNVVTYTQLKARVTDPTIILPVPM 180

Query: 181 NSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHDADD 240
           NSLLENY          NIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHDADD
Sbjct: 181 NSLLENYLALIMLAIAINIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHDADD 240

Query: 241 EGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFSLGL 300
           EGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFSLGL
Sbjct: 241 EGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFSLGL 300

Query: 301 TPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEXXXXXXXXXXXXXXXSEE 360
           TPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITE               SEE
Sbjct: 301 TPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITENDKVDNADNDNNNGNSEE 360

Query: 361 RMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPEIDNPSK 420
           RMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPEIDNPSK
Sbjct: 361 RMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPEIDNPSK 420

Query: 421 TAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCRDAL 480
           TAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCRDAL
Sbjct: 421 TAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCRDAL 480

Query: 481 VRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEEMKI 540
           VRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEEMKI
Sbjct: 481 VRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEEMKI 540

Query: 541 LETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEPYLLTMAVISP 600
           LETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEPYLLTMAVISP
Sbjct: 541 LETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEPYLLTMAVISP 600

Query: 601 LAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQTAIKQCTIHANEEPLMFIYCRKSA 660
           LAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQTAIKQCTIHANEEPLMFIYCRKSA
Sbjct: 601 LAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQTAIKQCTIHANEEPLMFIYCRKSA 660

Query: 661 ILDDLIIQKYLEDNKGCLQFSKDDQIALDVLRQQIFSSDDIQDVQEERK 709
           ILDDLIIQKYLEDNKGCLQFSKDDQIALDVLRQQIFSSDDIQDVQEERK
Sbjct: 661 ILDDLIIQKYLEDNKGCLQFSKDDQIALDVLRQQIFSSDDIQDVQEERK 709

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score =  454 bits (1169), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 276/722 (38%), Positives = 402/722 (55%), Gaps = 87/722 (12%)

Query: 1   MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTG 60
           M  N +V SL+EMGIP EVA++AL R  GNLEAAV FIFSNE+P +           DTG
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQA----------DTG 50

Query: 61  QQEPSQLPPRSE---ASGADPYQT-HSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQEN 116
            +  +  P  SE    +G++ Y   +S   E   M D     +    E  E I T N   
Sbjct: 51  GEGGAGQPRISENRMMAGSNSYDVPNSGDQEDIDMADVAGGEADYDDEDDEDI-TENHSG 109

Query: 117 VTSQHGED---RDDDGDNIQENDEXXXXXXXXXXXXXXXXXXNYNVVTYTQLKARVTDPT 173
            +S +      RD D  +I E                     +YN+V   + K  V DPT
Sbjct: 110 SSSSNERGPAARDYDHYSISETS---------------IAPPSYNIVQQNEFKCAVDDPT 154

Query: 174 IILPVPMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQ 233
           ++LP+P+NSL+E+Y            P  FL+PDF+DLNY  DW+KG+S + P Y L  +
Sbjct: 155 VVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYR 214

Query: 234 NDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYIST 293
              +ADD   +    + I+   G      +DD+QP+LLWQLQKLISV+N+ + ER+++S 
Sbjct: 215 ---EADDGSAT----SEIVLASGS-----SDDLQPRLLWQLQKLISVINTRMCERAFVSA 262

Query: 294 KVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEXXXXXXXXXXX 353
           ++F+L L P ++  LA+ E+L +VLP F KSLA ++E C  I                  
Sbjct: 263 RLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEMCPGI------------------ 304

Query: 354 XXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFP 413
                  R R E  +LF+S+A +        ++T ++   F PEEY+SNLYKMFN LL+P
Sbjct: 305 -------RDR-ETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP 356

Query: 414 EIDNPSKTAVSEGDVPGTG-----------CLDYIAPIFTVVFHAMDSTTDEVDLPGGVD 462
           E +N  + A   G   G G            L  +AP+ T++F+ +++ T+ + LP GVD
Sbjct: 357 EEENDEEDATRNG---GGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVD 413

Query: 463 MPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMD 522
           +P+EFYPQLYT  C+D L+R V  +RK+A   S+ LLQ+ N L+S+QGK+I+  L+ST+ 
Sbjct: 414 IPLEFYPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLA 473

Query: 523 YLTKDCG-SETKALEEMKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAK 581
           YL      +  KA  ++  L+  +N+ ++  ME+YK L++ + G  ++SHPE  II  AK
Sbjct: 474 YLQASPNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAK 533

Query: 582 ASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQTAIKQ 641
              LI++ PY+LT+A +SP +YF+RNR G W  V+ N + TEF+I  C S   VQ AIK 
Sbjct: 534 QLRLIEN-PYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKH 592

Query: 642 CTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVLRQQIFSSDDI 701
            T +A+E PLMFIYC +  I  +  + K L++N GC +F+KDD+ +L  LR      +D 
Sbjct: 593 GTKYASETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSHFNDDNDN 652

Query: 702 QD 703
            D
Sbjct: 653 TD 654

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score =  425 bits (1093), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 268/721 (37%), Positives = 394/721 (54%), Gaps = 76/721 (10%)

Query: 1   MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTV-ANDNDT 59
           ME+N++V +L+EMGIPREVAV+AL+R  GNLE AVAFIFSNE+P    E   +  N ND 
Sbjct: 1   MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIPININD- 59

Query: 60  GQQEPSQLPPRSEASGADPYQTHSPTP---EHYYMKDERNAPSSQSYEQQEY------IP 110
             Q+P  LP   + +  D   +++P+     +   ++  N    +  E QE       + 
Sbjct: 60  --QDP--LPSEQDLANQDYRSSNTPSSVPGSNNPFRESNNYLGDEYVEGQEVQRELIDVD 115

Query: 111 TSNQENVTSQHGED--RDDDGDNIQEND---EXXXXXXXXXXXXXXXXXXNYNVVTYTQL 165
           +S+ E+     G D  R +     Q+N    E                   YN+V    L
Sbjct: 116 SSDDEDEDEDDGMDGYRSESRSISQQNGNVPESFHIESATNSMSQEMIPPKYNLVAKGPL 175

Query: 166 KARVTDPTIILPVPMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYENDWYKGNSLSI 225
           K  +  PTIILP+P+NS++ENY          NIP  FL+ DFKDLNY  +WYKG S  +
Sbjct: 176 KDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNYNKNWYKGTSFEM 235

Query: 226 PNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDI--------------QPKLL 271
           P + L+  + +D           T  ++   E+ +Q    +              QP LL
Sbjct: 236 PKFILEFDSSND-----------TTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLL 284

Query: 272 WQLQKLISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEK 331
           WQLQKL ++ + ++SER+Y S ++FSL     VR  L+  +NL DVLP+F KS+ T+++ 
Sbjct: 285 WQLQKLAAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQL 344

Query: 332 CVAIFGSDITEXXXXXXXXXXXXXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTT 391
           C +   SD                           + LF+++A +    +   ++T +  
Sbjct: 345 CPS--NSDDESP-----------------------QDLFITSAFHLPEKSQSLVETKLAF 379

Query: 392 LSFSPEEYESNLYKMFNTLLFPEIDNPSKTAVSEGDVPGT--GCLDYIAPIFTVVFHAMD 449
             F PEEY  NLYKMFN LL+P  D+PS+     G+        L+  A I TV+F+  D
Sbjct: 380 FHFMPEEYNENLYKMFNVLLYP--DDPSENNEDNGEQEEVYNNSLNKAAHIITVIFNEAD 437

Query: 450 STTDEVDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQ 509
           + T E+    GV++P+ FYPQLY   C+D L++ +  +R++A   SK+LL +  QL+SF+
Sbjct: 438 AYTPEMTSNSGVEIPLTFYPQLYFKKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFE 497

Query: 510 GKDITMFLKSTMDYLTKDCGSETKALEE-MKILETLINNAKNTIMEDYKALSADLQGPLN 568
           GKDI+M L+S  +YL K+     K L E +  +E +I   KN+ ME+YK LS+ L    N
Sbjct: 498 GKDISMTLESAKEYLQKEENPMGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWN 557

Query: 569 VSHPEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITE 628
           +SHPE+ II+ AK   LI DEPYLLT  +ISP  Y+IR + G WY V+ N + T+FQ+++
Sbjct: 558 LSHPELQIIETAKTLGLI-DEPYLLTTVIISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQ 616

Query: 629 CESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIAL 688
            ES   VQ  IK  T   NE PLMF++CR+S I D+  ++K +E+N GCLQF+K DQ++L
Sbjct: 617 LESGAAVQEIIKAQTSRPNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSL 676

Query: 689 D 689
           +
Sbjct: 677 E 677

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score =  424 bits (1090), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 223/544 (40%), Positives = 333/544 (61%), Gaps = 43/544 (7%)

Query: 156 NYNVVTYTQLKARVTDPTIILPVPMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYEN 215
           +Y++V + Q K+ V DPT++LP+P+NSL+E+Y            P  FL+PDF+DLNY  
Sbjct: 127 SYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNYRP 186

Query: 216 DWYKGNSLSIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQ 275
           DW+KG+S + P Y L  +   D      S  S+  +  G  +       D+QP LLWQLQ
Sbjct: 187 DWFKGSSFAEPRYRLAYRESSDG-----STTSEIVVASGPSK-------DVQPHLLWQLQ 234

Query: 276 KLISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAI 335
           KLISVVN+ + ER+++S K+F+L L P ++  LA+ E+L +VLP F KSLA ++E C  I
Sbjct: 235 KLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGI 294

Query: 336 FGSDITEXXXXXXXXXXXXXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFS 395
                                    R R E  +LF+S+A +        ++T ++   F 
Sbjct: 295 -------------------------RDR-ETRNLFISSALHTPDKNEPPMETFLSLFHFL 328

Query: 396 PEEYESNLYKMFNTLLFPEIDNPSKTAVSEGDVPGT---GCLDYIAPIFTVVFHAMDSTT 452
           PEEY+SNLYKMFN LL+PE +      V  GD         L  +AP+ T++F+ +++ T
Sbjct: 329 PEEYDSNLYKMFNVLLYPEEEEEEGEVVYGGDGAHQEPENTLKEVAPVLTILFNELETNT 388

Query: 453 DEVDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKD 512
           + V LP GVD+P+EFYPQLYT  C+D L+R +  +RK+A   S+ LLQ+ N L+S+QGK+
Sbjct: 389 ESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKN 448

Query: 513 ITMFLKSTMDYLTKDCG-SETKALEEMKILETLINNAKNTIMEDYKALSADLQGPLNVSH 571
           I+  L+ST+ YL  D   ++ +A +++  L+  +N+++   ME+YK L++ L G  N+SH
Sbjct: 449 ISTILESTLAYLQADTKDADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSH 508

Query: 572 PEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITECES 631
           PE+ II+ AK   LI++ PY+L+MAV+SP +YF R+R G+W  ++ N + TEF+I +C S
Sbjct: 509 PEIHIINTAKQLGLIEN-PYILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSS 567

Query: 632 IRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVL 691
              VQ AI+  T +A+E PLMFIYC +  I  D  + K LE+N GC++F+KDDQ  L+ L
Sbjct: 568 PSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNTL 627

Query: 692 RQQI 695
           R Q 
Sbjct: 628 RAQF 631

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (79%)

Query: 1  MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIP 44
          M  N +V SL+EMGIP EVAV+AL R  GNLEAAV FIFSNE+P
Sbjct: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELP 44

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  421 bits (1083), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 265/711 (37%), Positives = 385/711 (54%), Gaps = 93/711 (13%)

Query: 2   ESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTGQ 61
           ++ +SV S+++MGIP +VA++AL R NG+LEAAV FIFSNE+P           DN+ G 
Sbjct: 3   DNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELP-----------DNNMG- 50

Query: 62  QEPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQENVTSQH 121
                     E+ G + Y T     EH  + ++ N    Q+ +  E +  SN       +
Sbjct: 51  ----------ESVGNEKYTT----SEHVNISNDNNF---QAGDLSEVMNVSN-------Y 86

Query: 122 GED---RDDDGDNIQENDEXXXXXXXXXXXXXXXXXXNYNVVTYTQLKARVTDPTIILPV 178
           G D     D GD    +DE                   YN+V +   K  ++DPT+++P+
Sbjct: 87  GYDNRFETDSGD--LSSDEVSDPEIVENDISNNLKLPAYNIVKHEVEKTSLSDPTVVMPL 144

Query: 179 PMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHDA 238
           P NS++E+Y           +P   L+PDFKDLNY+N+WY G     P +G+K+ N+   
Sbjct: 145 PHNSIIESYFGLFSMFISIYLPHLLLKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESL 204

Query: 239 DDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFSL 298
            D+  +       +D        R+ D QPKLLWQLQKL +++NST+SERSY+S+K+FSL
Sbjct: 205 KDDLHTSIEPLTCVD--------RDLDDQPKLLWQLQKLSTIMNSTMSERSYVSSKLFSL 256

Query: 299 GLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEXXXXXXXXXXXXXXXS 358
            L  + +  L + E+L +VLP F K L + +E C                          
Sbjct: 257 CLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDF----------------------R 294

Query: 359 EERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPEIDNP 418
            + +R E+    +S+A Y  +     +KT +T   F P+EYESNLYKMFN LL+ + D  
Sbjct: 295 PDEIRNEL----ISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYAD-DED 349

Query: 419 SKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCRD 478
              A+ EG+      L+Y+AP  T++F  +D  +    LP GV +P+EFYPQLYT  C+D
Sbjct: 350 GDGAIDEGN-----SLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTKECKD 404

Query: 479 ALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEE- 537
            L++ +  +R++A + S++ L+  N L+SFQGKDI  FL ST+D+L +D G     L E 
Sbjct: 405 QLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRD-GQRQNGLTEG 463

Query: 538 -MKILETL------INNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEP 590
             K++E L      +   K   M  YK L+  L    N+S+PEVSII  AK   LI DEP
Sbjct: 464 NGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLI-DEP 522

Query: 591 YLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQTAIKQCTIHANEEP 650
           Y L+MAV+SP  Y+I+ R G WYLV+      +F I +C S   +Q  ++Q T H +E P
Sbjct: 523 YHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSETP 582

Query: 651 LMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVLRQQIFSSDDI 701
           LMF+Y ++ +I DD  +QK LE N GCLQF KDDQ  L+ +      SDD+
Sbjct: 583 LMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEMVMN--ESDDV 631

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score =  420 bits (1080), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 223/548 (40%), Positives = 331/548 (60%), Gaps = 46/548 (8%)

Query: 156 NYNVVTYTQLKARVTDPTIILPVPMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYEN 215
           +Y++V + + K+ V DPT++LP+P+NSL+E+Y            P  FL+PDFKDLNY  
Sbjct: 134 SYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFPHVFLKPDFKDLNYRA 193

Query: 216 DWYKGNSLSIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQ 275
           DW+KG+S + P Y L      D         + + I+   G      N+ +QP LLWQLQ
Sbjct: 194 DWFKGSSFTEPKYRLAYCEAEDGS-------TTSEIVLASGP-----NEGLQPHLLWQLQ 241

Query: 276 KLISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAI 335
           KLISVVN+   ER+++S KVF+  L P +R  LA+ E+L +VLP F KSLA ++E C  I
Sbjct: 242 KLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPGI 301

Query: 336 FGSDITEXXXXXXXXXXXXXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFS 395
                                    R R E  SLF+S+A +        ++T ++   F 
Sbjct: 302 -------------------------RDR-ETRSLFISSALHTPNKNEPPMETFLSLFHFL 335

Query: 396 PEEYESNLYKMFNTLLFPEIDNPSKTAVSEGD------VPGTGCLDYIAPIFTVVFHAMD 449
           PEEY+SNLYKMFN LL+PE +   +  +  G+      V     L  +AP+ T++F+ ++
Sbjct: 336 PEEYDSNLYKMFNVLLYPEEEEEEEDVIRGGEQEEARYVEPENTLKEVAPVLTILFNELE 395

Query: 450 STTDEVDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQ 509
           + T+ V LP GVD+P+EFYPQLYT  C+D L+R +  +RK+A   S+ LLQ+ N+L+S+Q
Sbjct: 396 TNTESVSLPNGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQ 455

Query: 510 GKDITMFLKSTMDYL-TKDCGSETKALEEMKILETLINNAKNTIMEDYKALSADLQGPLN 568
           GK+I+  L+ST+ YL T    +  +A +++  L+  +N+A+   ME+YK L++ L G  N
Sbjct: 456 GKNISTILESTLAYLQTIPDDANNEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWN 515

Query: 569 VSHPEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITE 628
           +SHPE  II+ AK   LI++ PY+LTMA +SP +YFIR+R G W  ++ N + TEF++ +
Sbjct: 516 LSHPETHIINTAKQLGLIEN-PYILTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKK 574

Query: 629 CESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIAL 688
           C S   VQ AIK  T +A+E PLMFIYC +  I  + ++ + L+ N GCL+F++DDQ +L
Sbjct: 575 CSSPSVVQEAIKHGTKYASETPLMFIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSL 634

Query: 689 DVLRQQIF 696
             LR Q F
Sbjct: 635 KTLRSQFF 642

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 42/61 (68%), Gaps = 4/61 (6%)

Query: 1  MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTG 60
          M  N +V SL+EMGIP EVAV+AL R  GNLEAAV FIFSNE+P    E + +  +ND  
Sbjct: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELP----EQAEMGEENDGS 56

Query: 61 Q 61
          Q
Sbjct: 57 Q 57

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score =  414 bits (1063), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 219/557 (39%), Positives = 331/557 (59%), Gaps = 54/557 (9%)

Query: 156 NYNVVTYTQLKARVTDPTIILPVPMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYEN 215
           +YN+V + + K+ + DPT++LP+P+NSL+E+Y            P  FL+PDF+DLN+  
Sbjct: 133 SYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFPHVFLKPDFQDLNFRP 192

Query: 216 DWYKGNSLSIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQ 275
           DW+KG S + P Y +  +   +ADD   +  SD  +  G        +D++QP LLWQLQ
Sbjct: 193 DWFKGTSFTEPKYRIAYR---EADDGSTT--SDIVLASGP-------SDELQPHLLWQLQ 240

Query: 276 KLISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAI 335
           KLISVVN+ + ER+++S K+F+L L P ++  LAN E+L +VLP F KSLA ++E C  I
Sbjct: 241 KLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGI 300

Query: 336 FGSDITEXXXXXXXXXXXXXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFS 395
                                        E  +LF+S+A +        ++T ++   F 
Sbjct: 301 RDQ--------------------------ETRNLFISSALHTPNKNEPPMETFLSLFHFL 334

Query: 396 PEEYESNLYKMFNTLLFPEIDNPSKTAVSEGDVPGTG-----------CLDYIAPIFTVV 444
           PEEY+SNLYKMFN LL+PE +   +  +  G   GTG            L  +AP+ T++
Sbjct: 335 PEEYDSNLYKMFNVLLYPEEEEEEEEVIRRG---GTGQEEERYVEPENTLKEVAPVLTIL 391

Query: 445 FHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQ 504
           F+ +++ T+ V LP GVDMP+EFYPQLYT  C+D L+R +  +RK+A   S+ LL++ + 
Sbjct: 392 FNELETNTESVTLPNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQARVRSRYLLEEISA 451

Query: 505 LRSFQGKDITMFLKSTMDYLTKDCG-SETKALEEMKILETLINNAKNTIMEDYKALSADL 563
           L+S+QGK+    L+ST+ YL +    +  +A  ++  L+  +N+ ++  ME+YK L++ L
Sbjct: 452 LKSYQGKNTFTILESTLAYLQESPDDANNEAASQIASLKDTLNSMRSAKMEEYKDLASKL 511

Query: 564 QGPLNVSHPEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTE 623
            G  N+SHPE  II+ AK   LI++ PY+LTMA ISP +YFIRNR G W  ++ N + TE
Sbjct: 512 HGEWNLSHPETHIINTAKQLGLIEN-PYVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTE 570

Query: 624 FQITECESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKD 683
           F++ +C S   VQ AI+  T +A+E PLMFIYC +  I  + +++K L+ N GC +F+KD
Sbjct: 571 FKVNKCSSASVVQEAIRHGTKYASEMPLMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKD 630

Query: 684 DQIALDVLRQQIFSSDD 700
           DQ +L  L  Q     D
Sbjct: 631 DQSSLRTLHSQFIDGID 647

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%)

Query: 1  MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIP 44
          M  N +V SL+EMGIP EVAV AL R  GNLEAAV FIFSNE+P
Sbjct: 1  MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELP 44

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  412 bits (1059), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 251/689 (36%), Positives = 376/689 (54%), Gaps = 66/689 (9%)

Query: 5   DSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPE--NNETSTVANDNDTGQQ 62
           +S++SL+EMGIPR++A++AL RANGNLEAAV FIFSNE+P E  N++   ++        
Sbjct: 7   NSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEIISYKEKANHV 66

Query: 63  EPSQLPPRSEASGADPYQTHSPTPEHY--YMKDERNAPSSQSYEQQEYIPTSNQENVTSQ 120
           E S           +      P    +  Y+ D     +S++ +   Y+     +N+   
Sbjct: 67  EISNKESFQPGDLTEVIANQQPLQPEFQNYVND-----NSENIDSNCYVSDKIVDNM-DY 120

Query: 121 HGEDRDDDGDNIQENDEXXXXXXXXXXXXXXXXXXNYNVVTYTQLKARVTDPTIILPVPM 180
           +  D D   +++ +N                    +Y +V ++  K+R+ DPT+ILP+P 
Sbjct: 121 YSSDSDYITNSVTDN----------------LLPPSYQIVKHSDHKSRLRDPTVILPLPP 164

Query: 181 NSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHDADD 240
           NS++ENY           +P   +RPDFKDL++  DW+KG+S S P   LK        D
Sbjct: 165 NSMIENYFALYSLCITNYLPHIIMRPDFKDLSFTEDWFKGSSFSKPKNVLK-----SVTD 219

Query: 241 EGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFSLGL 300
           E  S+ S   I   E    +   DD QP+LLWQLQKL S+VNST+SER+Y+  K+FS+ L
Sbjct: 220 ETTSK-STMKICPIE----DMNQDDDQPELLWQLQKLSSIVNSTMSERAYVCAKIFSVIL 274

Query: 301 TPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEXXXXXXXXXXXXXXXSEE 360
               +  LA  ++L +VLP F K L   +E C   F  D                     
Sbjct: 275 DQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPG-FEED--------------------- 312

Query: 361 RMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPEIDNPSK 420
               E+  LF+S+A Y  +     + T ++   F P+EY+SNLYKMFN LL+P+ +N S 
Sbjct: 313 ----EIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLYPD-ENDSD 367

Query: 421 TAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCRDAL 480
               +    G    D I+PI ++VF   +  +  + LP GV++P+EF+PQ+YT  C++ L
Sbjct: 368 YESGDESEQGNSLGD-ISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTKDCKNKL 426

Query: 481 VRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEEMKI 540
           ++ +  +RK+A   SKE+L   N ++SFQGKDI  F+ S+++YL +D  S+    E +KI
Sbjct: 427 IKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNKSDNITEELLKI 486

Query: 541 LETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEPYLLTMAVISP 600
              +    K   M +Y+ L+  LQ   N+S+PE  I++  +   LI  EPYLL MAV+SP
Sbjct: 487 KNDMA-IVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLI-GEPYLLVMAVLSP 544

Query: 601 LAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQTAIKQCTIHANEEPLMFIYCRKSA 660
            +Y+IR R GKW LV+ +    +F + EC S   V+  IKQ T HA+E PLMF+YCR+  
Sbjct: 545 YSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFMYCRRDV 604

Query: 661 ILDDLIIQKYLEDNKGCLQFSKDDQIALD 689
           I ++  I+K  E N GCL F K+DQ+ L+
Sbjct: 605 IPEEYEIRKSFESNSGCLNFFKEDQLVLN 633

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  402 bits (1033), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 245/696 (35%), Positives = 372/696 (53%), Gaps = 96/696 (13%)

Query: 1   MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTG 60
           M   D+V SL+EMGI ++VA +AL R NG++EAA  FIF N+ P + +E        +  
Sbjct: 1   MNDTDAVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAPAQISE--------NVE 52

Query: 61  QQEPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQENVTSQ 120
           Q+   +LP  S ASG  P   +                        EYI  SN  +  S+
Sbjct: 53  QRAHIELPAGS-ASGFQPGDLN------------------------EYI--SNAPDTESE 85

Query: 121 HGEDRDDDGDNIQENDEXXXXXXXXXXXXXXXXXXNYNVVTYTQLKARVTDPTIILPVPM 180
             E+ D + D+++                          +  +  K +++DPT++LP+P 
Sbjct: 86  DFEEIDVEEDSVETGPS----------------------LECSGRKGQISDPTVVLPLPP 123

Query: 181 NSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHDADD 240
           N L E Y           +P    RPDF DLNY+ +WY+G+S +   Y LK  + + +DD
Sbjct: 124 NFLFEGYFALFCLFVANYMPHLLARPDFIDLNYDKNWYRGDSYTNAEYRLKYLSKNGSDD 183

Query: 241 EGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFSLGL 300
           E +       +   +G+        +Q +LLWQLQKL SV NS +S+R+Y+  K+F++ +
Sbjct: 184 EQIEIVPKDELTQEDGDYT------LQSELLWQLQKLASVANSRMSDRAYVRAKMFAIAV 237

Query: 301 TPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEXXXXXXXXXXXXXXXSEE 360
            P V+  +A  E+L +VLP F KS+A ++E C     +++ E                  
Sbjct: 238 EPQVQRNMAEAEHLHEVLPSFIKSVAVDLEMCPNFQDNEVRE------------------ 279

Query: 361 RMRGEMESLFVSTASYEDAATGER----LKTPVTTLSFSPEEYESNLYKMFNTLLFPEID 416
                    F+S+A +  + +  +    +KT ++   F PEEYE+NLY+MFN LLF + D
Sbjct: 280 --------CFISSAFHTPSNSAPQEESTMKTWLSLFHFLPEEYETNLYRMFNALLFAD-D 330

Query: 417 NPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTC 476
           +         D  G   L  IAP+FT+VF  M+ TT+ V L  GV+MP+EFYPQLYT  C
Sbjct: 331 SVESDQSDSPDGEGENSLSEIAPVFTIVFDEMEETTEAVPLAEGVEMPLEFYPQLYTKEC 390

Query: 477 RDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALE 536
           +D L++ +  +R+++   S+ +LQ+   L+SFQGKD++ F+ S++DYL KD  S  + ++
Sbjct: 391 KDKLIKHIIAKRRQSQTDSRAILQEITDLKSFQGKDLSKFINSSLDYLQKDEKS-PELIK 449

Query: 537 EMKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEPYLLTMA 596
            +  L+  I N K   M +YK ++  LQ   N+S PE+ I+  AK   LIDD  YLLTMA
Sbjct: 450 GLLDLKDQITNKKTKKMNEYKEIAHRLQSEWNLSLPEIQIVKTAKELGLIDDS-YLLTMA 508

Query: 597 VISPLAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQTAIKQCTIHANEEPLMFIYC 656
           VISP  Y+ RNR G+W+ V+       + +  C S   +Q AIKQ T   +E PLMFIYC
Sbjct: 509 VISPYMYYTRNRDGQWFFVQSTPYEASYNVRACSSPLEIQDAIKQHTRRPSEAPLMFIYC 568

Query: 657 RKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVLR 692
           +K  I DD  + K LE+N+GC +F+KDDQ+ L+ ++
Sbjct: 569 KKGFIPDDDTVLKALENNQGCHRFAKDDQLQLNKMQ 604

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  375 bits (962), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 217/542 (40%), Positives = 308/542 (56%), Gaps = 51/542 (9%)

Query: 157 YNVVTYTQLKARVTDPTIILPVPMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYEND 216
           Y+ V +++ K+ + DPTI+LP+P NSL+ENY               FL+PDFKDLNY  +
Sbjct: 157 YSTVQHSERKSDIADPTIVLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNYRKE 216

Query: 217 WYKGNSLSIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQK 276
           WY+ +S+  P Y +K     + ++E V     T              D  QPKLLWQLQK
Sbjct: 217 WYRSSSIDEPFYRVKFNKADETENEIVPAAELT------------ETDHPQPKLLWQLQK 264

Query: 277 LISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIF 336
           LI+VVNS LSER+Y+S K+F+      ++  L + E+L +VLP F K+LA ++E C    
Sbjct: 265 LIAVVNSDLSERAYVSAKIFNSSSNQQLQSKLGDAEHLNEVLPYFIKALAVDLESCYGDK 324

Query: 337 GSDITEXXXXXXXXXXXXXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSP 396
            SDI                          + LF+S+A Y+ +      +T ++   F P
Sbjct: 325 SSDI--------------------------KKLFISSAFYKPSQNEPLQETYLSFFHFLP 358

Query: 397 EEYESNLYKMFNTLLFPEIDNPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVD 456
           EEY++NLYKMFN LL P+ D+  ++  S+ D P    L+ I+P  T+VF+ MD +TD+  
Sbjct: 359 EEYDTNLYKMFNVLLIPDEDD-EESGESDEDQPD-NSLNIISPFLTIVFNEMDESTDDNM 416

Query: 457 LPG----GVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKD 512
                  GVD+P EFYPQLYT  C+D L++ +  +RKE+    K +LQ+ N L+S+ GKD
Sbjct: 417 TTSASFQGVDIPFEFYPQLYTKKCKDELIKHILSKRKESKSKLKVILQEINALKSYHGKD 476

Query: 513 ITMFLKSTMDYLTKDCGSET----KALEEMKILETLINNAKNTIMEDYKALSADLQGPLN 568
           I MFL ST+D+L KD  +E+    +  +E+  L   IN  K  + ++YK LS  L    N
Sbjct: 477 ILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLRAQINGRKAGLKDEYKELSQKLHNEWN 536

Query: 569 VSHPEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQG--KWYLVRFNMISTEFQI 626
           +S+P++ II  AK   LI D PYLLT  VISP  YF+R+R+   +W LV+ N + T+F I
Sbjct: 537 LSYPDLHIIQTAKTLGLI-DTPYLLTTVVISPYFYFMRDRKKVDQWCLVQSNGLGTDFHI 595

Query: 627 TECESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQI 686
           T      NV T IKQ T   NE PLMFIYC+++ I     I K +E+N+GC  F K DQ+
Sbjct: 596 TNFLDKENVSTTIKQYTKVPNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQL 655

Query: 687 AL 688
            L
Sbjct: 656 HL 657

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  347 bits (891), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 209/547 (38%), Positives = 308/547 (56%), Gaps = 57/547 (10%)

Query: 165 LKARVTDPTIILPVPMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYENDWYKGNSLS 224
           LK  + DPT++LP+P N+LLENY          + P  FL+PDF+DLNY  +W+KG   S
Sbjct: 109 LKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDFQDLNYNRNWFKG-YYS 167

Query: 225 IPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNST 284
            P Y L+  ++++              +  + +   Q +  +QP+LLWQ QK I+V+NS+
Sbjct: 168 KPEYRLQFSSNNNVS------------IVPKAQLTIQDSLTLQPELLWQFQKFIAVLNSS 215

Query: 285 LSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEXX 344
           +S+R ++S K+F   L P V   L + ++L +VLP F KSLA ++E C+           
Sbjct: 216 ISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLL---------- 265

Query: 345 XXXXXXXXXXXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLY 404
                         +E  R ++  LF+STA ++ +   + ++T V+ L F PEEY++NLY
Sbjct: 266 --------------KEDAR-DIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLY 310

Query: 405 KMFNTLLFPEIDNPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMP 464
           +MFNTLL+PE D   +             L  +AP+ TVVF  MD +T+ V L  GVD+P
Sbjct: 311 RMFNTLLYPEEDEDGEEV--------ENSLGNLAPMLTVVFDEMDESTENVSLQQGVDVP 362

Query: 465 MEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYL 524
           ++FYPQ+YT + +D+L+  V  +RKEA   S  +LQ  N L+SFQGK I  FL ST+D+ 
Sbjct: 363 LKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFA 422

Query: 525 TKDCGSET-----KALEEMKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQ 579
            KD   +      + L+ +  ++  I   K   ME+YK +S  +    N+SHP++ ++D 
Sbjct: 423 AKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDA 482

Query: 580 AKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLV--RFNMISTEFQITECESIRNVQT 637
           AK   LI DEPYLLT A++SP  Y+IR R G WY V    N    E  ITE      V  
Sbjct: 483 AKKMGLI-DEPYLLTSAILSPYHYYIRKRDGIWYRVISEANGSDLEASITEP---HEVSE 538

Query: 638 AIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVLRQQIFS 697
           +IK  T HA+E PLMF YC++S I ++  I+K LEDN+G  +F K DQ  L+ L+    S
Sbjct: 539 SIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQNNKVS 598

Query: 698 SDDIQDV 704
            D + D+
Sbjct: 599 DDILIDL 605

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 2  ESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDT 59
          ++N S+  L++MGI  EVAV+AL R NG+LEA+V +IFS E+           +D+D+
Sbjct: 3  QANQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDS 60

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  329 bits (843), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 225/696 (32%), Positives = 342/696 (49%), Gaps = 113/696 (16%)

Query: 3   SNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTGQQ 62
           S  ++ SL++MGI R+VA+ AL + NG++E +V +IFS E+P +  E+  +   +   +Q
Sbjct: 2   SESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQPLHADAEQ 61

Query: 63  EPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQENVTSQHG 122
            P +   R +          S   EH       N P  +    ++Y  ++ +E       
Sbjct: 62  GPQKEEDRED----------SALLEHTEYASVSNGPLEEPERYRDYTLSTQEE------- 104

Query: 123 EDRDDDGDNIQENDEXXXXXXXXXXXXXXXXXXNYNVVTYTQLKARVTDPTIILPVPMNS 182
                   N  +ND+                                 DP ++ P   N+
Sbjct: 105 ------AANEVKNDQE--------------------------------DPLVVKPESSNA 126

Query: 183 LLENYXXXXXXXXXXNIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHDADDEG 242
           L ENY            P  FL PDFKDLNY  DW +G  L  P + +K + + D     
Sbjct: 127 LFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQFLK-PQFRIKFETNEDV---- 181

Query: 243 VSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFSLGLTP 302
              P +T          +Q N  +QP+LLWQ QK ++V +S  S R  +S +  +  L P
Sbjct: 182 TIVPRET--------LTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEP 233

Query: 303 DVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEXXXXXXXXXXXXXXXSEERM 362
            V   L N E+L DVLP F +SLA ++E C    GS                        
Sbjct: 234 QVVEKLNNAEHLHDVLPSFIRSLANDVELCP---GSQ----------------------- 267

Query: 363 RGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPEIDNPSKTA 422
              ++ LF+STA Y+ A+    ++T V+ L F PEEY+SN+YKMFN LL+P   +     
Sbjct: 268 --SIKELFISTAYYKPASEPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNDAD-DDDD 324

Query: 423 VSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCRDALVR 482
           V E        L  +A + T+VF  MD +TD++ LP GV++PM+FYPQLYT   + +L++
Sbjct: 325 VEETQ----NSLGNLASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSLIK 380

Query: 483 DVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEEMKILE 542
           DV     E  + +  +L+  N+L+SFQGK I  FL ST+D++ +D  + T+  +   +++
Sbjct: 381 DVTKHAGEGQQRAHSILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDLVD 440

Query: 543 TL------INNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEPYLLTMA 596
           TL      ++  K   M +YKA+S  L    N+SHPE+ II+Q +   LI DEPY+LT A
Sbjct: 441 TLQHIKQDLSKKKTDGMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLI-DEPYILTTA 499

Query: 597 VISPLAYFIRNRQGKWYLVRFNMISTEFQI--TECESIRNVQTAIKQCTIHANEEPLMFI 654
           VISP  YFIR R  +WY V     +    +  T+ E++ N    I+  T  A+E PLMF 
Sbjct: 500 VISPFNYFIRKRDSQWYHVLGKQHNDALNVAKTDAETVTNT---IRLNTRTASETPLMFT 556

Query: 655 YCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDV 690
           Y ++SAI  +  + + +E N G   F++ DQ +L +
Sbjct: 557 YFKESAIDTNETLTEAIEKNTGVTSFAEQDQSSLKI 592

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  318 bits (815), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 190/544 (34%), Positives = 298/544 (54%), Gaps = 46/544 (8%)

Query: 157 YNVVTYTQLKARVTDPTIILPVPMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYEND 216
           Y+  TY   K+   DPT++L +  + LL NY            P  F+ PDF +LN+ ++
Sbjct: 163 YSKGTYKVQKSLPDDPTVLLSLEPSKLLSNYFGLFSMSLALFAPDLFMGPDFVNLNFNDN 222

Query: 217 WYKGNSLSIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQK 276
           W KG  +  P Y +K  ++ +   E   E     I++       +R    QP +LWQLQK
Sbjct: 223 WNKGLQIDTPEYEVKYTHNLEPGLEDRIE-----IVNAINLSEKERELTYQPYILWQLQK 277

Query: 277 LISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIF 336
           +IS++NS +S R+YIS+ ++SL L  + +  L    +L D+LP F +SL   M  C  + 
Sbjct: 278 VISIMNSQISSRAYISSGIYSLCLDDNTQKKLMETSHLYDILPTFIRSL---MNDCKHVP 334

Query: 337 GSDITEXXXXXXXXXXXXXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSP 396
             D                       +  M+++FVS A ++     E  K  +    F P
Sbjct: 335 DLD-----------------------QNRMKNMFVSKAFHQIPIHKEPTKVSLFLFHFLP 371

Query: 397 EEYESNLYKMFNTLLFPEIDNPSKTAVSEGDVPGT-----------GCLDYIAPIFTVVF 445
           EEY+SNLYKMFN+LL+   D P     ++     +             LD I+ I TV+F
Sbjct: 372 EEYDSNLYKMFNSLLYRSYDEPIYPRTNQNSADSSSSDDEISNEEESSLDEISTILTVIF 431

Query: 446 HAMDSTTDEVDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQL 505
             +D  T+ +  P GV++P EFYP+LYT  C++ L+  +   R +     KE+L   N L
Sbjct: 432 DELDQDTELITQPDGVEIPFEFYPELYTKKCKEKLINGILHTRYQNKLKMKEVLNDLNSL 491

Query: 506 RSFQGKDITMFLKSTMDYLTKDCGSETKALEEMKILETLINNAKNTIMEDYKALSADLQG 565
           +SF+GKDI  FL ST++YL +D G E   + ++  ++  ++ AK   M +YK +S  LQ 
Sbjct: 492 KSFEGKDILRFLNSTLEYLQRD-GKEGPMVNKLSYVKEQLSRAKTEKMLEYKTISRSLQN 550

Query: 566 PLNVSHPEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQ 625
             N+  PE+SII+QA+   LI D P+LL MAV+SP  YF R+R+ +W+  + +++ T+F+
Sbjct: 551 EWNIDKPELSIIEQAQDLGLIGD-PHLLVMAVLSPYLYFFRDRRNRWFKFQSSIMGTDFE 609

Query: 626 ITECESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDD-LIIQKYLEDNKGCLQFSKDD 684
           IT+ ES + VQ  IK  T  A+E P+MF+YC+K AI +D L++QK+ + N+GC  F++ D
Sbjct: 610 ITKYESDKTVQDEIKLNTKSASETPIMFVYCKKDAIPNDSLVLQKFAK-NQGCSAFAQAD 668

Query: 685 QIAL 688
           +++L
Sbjct: 669 EMSL 672

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 13 MGIPREVAVNALIRANGNLEAAVAFIF 39
          MGI ++VA + L +  GNLEAA+  IF
Sbjct: 1  MGIAKDVATSTLNKVGGNLEAAINHIF 27

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  315 bits (806), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 195/534 (36%), Positives = 287/534 (53%), Gaps = 55/534 (10%)

Query: 164 QLKARVTDPTIILPVPMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYENDWYKGNSL 223
           QLK R  DP ++ P   N+L ENY            P  FL PDF+DL Y  DWYKG  L
Sbjct: 102 QLKNRPEDPLVVRPASGNALFENYFALFCLAVGLGFPHHFLEPDFQDLTYGQDWYKGQFL 161

Query: 224 SIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNS 283
             P Y +K +N+   DD  +  P +T          +Q N  +QP+LLWQ QK ++V NS
Sbjct: 162 K-PAYRVKFENN---DDVSIV-PQET--------LTSQDNLILQPELLWQFQKFLAVQNS 208

Query: 284 TLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEX 343
               R Y++ +  +  L P V   L N ++L + LP F KSLA ++E C           
Sbjct: 209 PQCRRKYVTARYLTKVLEPQVVEKLNNSDHLHEALPSFIKSLANDVELCPGAHS------ 262

Query: 344 XXXXXXXXXXXXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNL 403
                                 ++ LF+STA Y+  +  E ++T V+ L F PEEY++N+
Sbjct: 263 ----------------------VKELFISTAYYKPVSEPEPIETLVSLLHFMPEEYDTNI 300

Query: 404 YKMFNTLLFPEIDNPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDM 463
           YKMFN LL+P+    S       D+  +  L  +AP+ T+VF  MD +T++  LP GVD+
Sbjct: 301 YKMFNALLYPD----SNEDAEMDDIQNS--LGNLAPMITIVFDEMDESTEQATLPHGVDV 354

Query: 464 PMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDY 523
           P+EFYPQLYT   ++ L+++V     ++   ++ +L+  N L+SFQGK I  FL S +D+
Sbjct: 355 PLEFYPQLYTEEAKNLLIKEVTKLSADSQTQARSILRNLNDLKSFQGKQIHSFLNSALDF 414

Query: 524 LTKDCG--SETKALEE----MKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSII 577
           +TKD    SE   ++E    ++ ++  + + K   M  YKA+S  L   LN+SHPE+ II
Sbjct: 415 ITKDMSGVSEQSGVQELVDSLQEVKQQLGSKKTEKMAQYKAVSHRLNNELNLSHPELGII 474

Query: 578 DQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQT 637
            +AK   LI DEPYLLT AVIS   YFIR   G+W+ V     S    +T+ ++   V +
Sbjct: 475 QRAKDLGLI-DEPYLLTSAVISASNYFIRQNNGQWFHVVGRSNSEHMDVTKTDA-STVSS 532

Query: 638 AIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVL 691
           AI+  T  A+E PLMF Y + SAI  +  +++ +  NKG   F++ DQ  ++ L
Sbjct: 533 AIRFHTRCASESPLMFTYFKPSAIDTEAQVKEAVGHNKGAKLFAEQDQKHINTL 586

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 33/42 (78%)

Query: 3  SNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIP 44
          S +++ SL++MGI REVA+ AL + NG++E +V +IFS E+P
Sbjct: 2  SENAIQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELP 43

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  284 bits (726), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 182/520 (35%), Positives = 275/520 (52%), Gaps = 91/520 (17%)

Query: 166 KARVTDPTIILPVPMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYENDWYKGNSLSI 225
           K+ VTDPT+++P+P +SL ENY           +P    +P+  DL Y   W +G+S   
Sbjct: 113 KSLVTDPTVVIPLP-HSLFENYFALFSLSMCQYLPHLMAKPELGDLMYNPKWAQGSS--- 168

Query: 226 PNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTL 285
                              +PS +                     + QLQ+L SVVN++ 
Sbjct: 169 -------------------DPSTS--------------------FIQQLQRLCSVVNASF 189

Query: 286 SERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEXXX 345
           S+R Y+S K+F+  L   ++  LA  E+L +VLP F +SL   +E+C   +  D      
Sbjct: 190 SDRCYVSAKLFAAVLDAPLKRKLAEAEHLHEVLPSFIRSLIHALEEC-GCYAED------ 242

Query: 346 XXXXXXXXXXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYK 405
                              ++ SLFVS+      A     K+ ++ L F PEEYES+LY 
Sbjct: 243 -------------------QIRSLFVSS------ALSSECKSLLSVLQFMPEEYESSLYA 277

Query: 406 MFNTLLFPEIDNPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPM 465
           MFN LL+PE++        EG+  G   LD +AP+ T+VF  MD+ T EV    GVD+P+
Sbjct: 278 MFNALLYPELE--------EGEESGNSLLD-LAPVLTIVFDEMDADT-EVTSNRGVDVPL 327

Query: 466 EFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLT 525
           EFYPQLYT + +DA+VR +  +RK A   S+++L + N L+S+QGKD   F+ ST+DYL 
Sbjct: 328 EFYPQLYTKSVKDAIVRPLQQQRKAAQERSRQVLAEMNGLKSYQGKDTLKFINSTLDYLQ 387

Query: 526 KDCGSETKALEEMKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNL 585
           +D  S+ + +++++ L+  I + K     +YK LS  L G  N+SHP   +I++A    L
Sbjct: 388 RDNQSK-EIIDKLESLKNSIADHKTQRKNEYKELSQKLHGEWNLSHP-TYLINEAMERGL 445

Query: 586 IDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITECESIRNVQTAIKQCTIH 645
           I DEPYLL M V+SP  Y  R+R G+W ++R +  S   +I++C +   VQ  I+Q T  
Sbjct: 446 I-DEPYLLAMVVLSPGHYLQRSRSGQWKMIRTD--SNMIRISDC-APSQVQATIRQHTTF 501

Query: 646 ANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQ 685
            ++ PLM +Y + S +  D I+ K LE N+G   F + DQ
Sbjct: 502 PSKTPLMLLYVKSSHVSVDTIVSKSLESNEGITNFLRIDQ 541

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/35 (62%), Positives = 27/35 (77%)

Query: 9  SLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEI 43
          SL+EMGI  EVA  AL + +GNLEAAV +IFS E+
Sbjct: 6  SLIEMGITPEVAQRALQQTHGNLEAAVNYIFSGEV 40

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  290 bits (742), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 186/551 (33%), Positives = 275/551 (49%), Gaps = 98/551 (17%)

Query: 166 KARVTDPTIILPVPMNSLLENYXXXXXXXXXXNIPTP-FLRPDFKDLNYENDWYKGNSLS 224
           K +++DPT++LP+  N LLENY            P   F    F DL Y   WY     S
Sbjct: 178 KLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWY-----S 232

Query: 225 IPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNST 284
           I N           ++E  +  S                      L  QLQ++ S++NS 
Sbjct: 233 ISN-----------NNENTTTDS----------------------LFLQLQRVTSIINSR 259

Query: 285 LSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEXX 344
           +SER++ISTK+FS     D+ Y L+  ++L ++   F +SL T +     IF        
Sbjct: 260 MSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV--LPPIF-------- 309

Query: 345 XXXXXXXXXXXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLY 404
                                 + + V+TA  +D+ T E  ++P++ ++F PEEYESNLY
Sbjct: 310 ----------------------KDILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLY 347

Query: 405 KMFNTLLFP---------EIDNPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMD-STTDE 454
           KMFN L++P         + D   +T   + D      L+ I+PIFT++F   D S +  
Sbjct: 348 KMFNNLVYPNEYGRNDDEQSDESLQTDDDDNDDANDSALEEISPIFTILFEEYDESDSSS 407

Query: 455 VDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDIT 514
             LP GV++P++FYPQLY+    D L++ +  +RKEA   S+ LL + N L+SFQGKDI 
Sbjct: 408 TTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIM 467

Query: 515 MFLKSTMDYLTKDCGSETKALEEMKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEV 574
             L+ST+DY+ KD   ETK+   +  + T + N KN  M+ YK L+  L    N+SHPE 
Sbjct: 468 KILQSTIDYIEKDSQRETKSANNLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEG 527

Query: 575 SIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTE----------- 623
           SII+ AK  NLI D PY L+M + SP  Y I+     WYL+    I+             
Sbjct: 528 SIIETAKQLNLI-DSPYNLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQNKNRNNNNNN 586

Query: 624 -----FQITECESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCL 678
                F + +C S   +Q  IKQ T + +E PLMFIYC++S + ++  + K  E N  C 
Sbjct: 587 NNPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACT 646

Query: 679 QFSKDDQIALD 689
           +F K+DQ+ L+
Sbjct: 647 KFLKEDQLTLN 657

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 61/113 (53%), Gaps = 28/113 (24%)

Query: 1   MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPE-------------- 46
           ME  + + +L++MGIP +VA NAL  ANGN+EAAV +IFSNE+PP+              
Sbjct: 1   MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRIDEN 60

Query: 47  --NNETSTVANDNDTGQQEPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNA 97
             NN  + V NDN TG   P         SG++ +Q   P   + Y+ D+ NA
Sbjct: 61  SDNNTNTNVYNDN-TGNTIP--------ISGSNGFQ---PGDLNKYLTDKNNA 101

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  271 bits (693), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 209/699 (29%), Positives = 321/699 (45%), Gaps = 121/699 (17%)

Query: 1   MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTG 60
           M+   +V SL+EMGI R+VA  AL   NG++EAA+ +IF        N  + + ND   G
Sbjct: 1   MDFEGNVQSLLEMGIARDVAEQALRECNGDVEAALNYIF--------NTPNEIDNDAMAG 52

Query: 61  QQEPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNAPSSQSYEQQEYIPTSNQENVTSQ 120
           QQ            G+ P  T     +  +   E N P SQSY +Q+ +    QEN+   
Sbjct: 53  QQ-----------MGSVPVGTQGIFDDSAFKIQENNPPQSQSYSEQQLV----QENLP-- 95

Query: 121 HGEDRDDDGDNIQENDEXXXXXXXXXXXXXXXXXXNYNVVTYTQLKARVTDPTIILPVPM 180
                    DN   +D                   + + +   Q K  +  PT+++P P 
Sbjct: 96  ---------DNTFRSDSDTNSDSDSSSSLEQSQYTSIDDLIPQQFKNTMDYPTVVIPAPA 146

Query: 181 NSLLENYXXXXXXXXXXNIPTPFLRPDFKD--LNYENDWYKGNSLSIPNYGLKIQNDHDA 238
                 Y          ++P  F++ D  D  L +  DW+               ND D 
Sbjct: 147 VPNHIYYCALFALFISIHLPHYFVKADHDDMPLLFSPDWF---------------NDID- 190

Query: 239 DDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNST-LSERSYISTKVFS 297
                 EP D  +L                 L  QL KLI+V NS   S R+++++K+F 
Sbjct: 191 -----REPEDEPLL----------------VLRDQLHKLIAVQNSNDHSARAFVTSKMFD 229

Query: 298 LGLTPDVR-----YTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEXXXXXXXXXX 352
           + L   ++      T  NY +L  +LP F K++A                          
Sbjct: 230 VDLQSVIQSNEPMLTNPNYFHLYQILPSFIKTIAN------------------------- 264

Query: 353 XXXXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLF 412
                    +    ++LF+S+A           ++ ++   F PEEYESNLYKMFN LL+
Sbjct: 265 ---------LSYTEKNLFISSAIQGGEEASSSKESLLSLFHFLPEEYESNLYKMFNVLLY 315

Query: 413 PEIDNPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLY 472
           P  D+       E +V     L  +AP+ T++F+  ++  +   +  GV++P++FYPQLY
Sbjct: 316 P--DDDHDIGEDEDEV-SENSLKELAPVMTIIFNEAENIDENAPVTNGVEVPLKFYPQLY 372

Query: 473 TSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSET 532
           T  C+D L+  V  +RK+  +  K++L+    L+S+QGKDI  F+ S++DYLTKD   ++
Sbjct: 373 TKKCKDQLISHVLSKRKDGRKELKQILKDIGNLKSYQGKDILSFINSSLDYLTKD-KDDS 431

Query: 533 KALEEMKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEPYL 592
              EE+  L+  +   K   M  YK +S  +    N+ +PE+ I++ A    LI DEPY 
Sbjct: 432 GIAEELHKLKDELTAKKTEKMNSYKQISEKMHTEWNIQNPELKIVETATKLGLI-DEPYF 490

Query: 593 LTMAVISPLAYFIRNRQGKWYLVRFNMIST---EFQITECESIRNVQTAIKQCTIHANEE 649
           L +AV+SP  YF+RNR+ +WY VRFN  +T   +  + +C+    V   +K  T   N  
Sbjct: 491 LNLAVVSPFFYFVRNRKDEWYEVRFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVPNST 550

Query: 650 PLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIAL 688
           PLMF+Y + S + DD  +Q+ L  NK  L F K DQI L
Sbjct: 551 PLMFVYSKDSYMADDTEMQELLSQNKTLLDFFKQDQIYL 589

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  258 bits (658), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 166/518 (32%), Positives = 270/518 (52%), Gaps = 62/518 (11%)

Query: 200 PTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKN 259
           P  F++ DFK+LNY+ +WY G+++  P   L I +D  AD           I+    E+ 
Sbjct: 190 PLQFVQQDFKNLNYDAEWYAGDAIQQP---LCIVSDVGADG------GSRQIVP---EEE 237

Query: 260 NQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLP 319
              +  +QP++LWQLQ++ISV +S LSERSY+S KVF+     +V   + + ++L + LP
Sbjct: 238 VTSDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYEALP 297

Query: 320 VFYKSLATEMEKCVAIFGSDITEXXXXXXXXXXXXXXXSEERMRGEMESLFVSTASYEDA 379
            F KS+  + E C A                         +    +++S+F+S+A  +  
Sbjct: 298 SFIKSIIRDAEMCPA-------------------------QHSNTDVKSMFLSSAIQDAE 332

Query: 380 ATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPEIDN-----PSKTAVSEGDVPGTGCL 434
              E  +T +    F PEEY +NLYKMFN LL+PE D          + ++ DV   G L
Sbjct: 333 QGAEPEETFLFLFHFPPEEYNANLYKMFNALLYPEDDTIDDNSSDTDSSNDTDVQVEGSL 392

Query: 435 DYIAPIFTVVFHAMD-------STTDEVDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPR 487
             +AP+ T++F+  D       +    ++ P GV++P  FYPQLYT   ++ +V+ +  +
Sbjct: 393 KELAPLLTIIFNEADPGQLSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQ 452

Query: 488 RKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLT-KDCGSETKA---------LEE 537
           RK A    ++ L + NQL+S++GK    FL+   + L  + C S  ++         +++
Sbjct: 453 RKAARAELRQCLARMNQLKSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQK 512

Query: 538 MKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEPYLLTMAV 597
           +  ++  +N  +  + + Y  LS  LQ   N+S+PE  +I +AK   L+ D+P+LL+M V
Sbjct: 513 VTSIKLQLNEERAKLKKQYVDLSNKLQNEWNISNPERKVIGEAKRLGLL-DKPHLLSMVV 571

Query: 598 ISPLAYFIRNRQGK--WYLVRFNMISTEFQITECESIRNVQTAIKQCTIHANEEPLMFIY 655
           +SP  Y +R+  G   W LV+ N   T+  IT+  +   VQ  I+ CT  AN+ PLMFIY
Sbjct: 572 LSPYFYLMRDSSGGSDWTLVQSNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIY 631

Query: 656 CRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVLRQ 693
           CR+   +        +E N GC +F+K DQ+ L   R+
Sbjct: 632 CREDFFVSQEETWSAIEKNMGCSEFNKADQLYLLTHRE 669

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (83%)

Query: 2  ESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIP 44
          E  D+V+SL EMGIP +VA++AL RANGNL AAV +IFSN++P
Sbjct: 3  EEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP 45

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  192 bits (487), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 158/533 (29%), Positives = 250/533 (46%), Gaps = 77/533 (14%)

Query: 175 ILPVPMNSLLENYXXXXXXXXXXNIPTPFLRPDFKDLNYENDWYKGNSLSIPNYGLKIQN 234
           ILP   ++LLE+Y          N+PT FL  DFK+L Y   W+KG  L   +Y L  +N
Sbjct: 57  ILPKGSSALLESYFPLFALCMAVNVPTKFLNVDFKELVYNPHWFKG-ELVQSDYRLVHRN 115

Query: 235 DHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNSTLSERSYISTK 294
                    + P    +L  + E       ++QP+L+ ++Q LI + N   S R +++++
Sbjct: 116 ---------AGP----LLIHKRELTGSEYLEMQPELIPRMQLLIGIANDPESMRRFVASE 162

Query: 295 VFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEXXXXXXXXXXXX 354
           + + G   +V   L+  ++L++V P F K+L  +M+ C+                     
Sbjct: 163 LINKGTDFNVSRALSECDHLSEVFPQFIKNLHNDMDLCL--------------------- 201

Query: 355 XXXSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLYKMFNTLLFPE 414
                 +       LF+S A +          T ++ L+FSPE Y   LY+MFN +L PE
Sbjct: 202 ------KDDKSTSKLFLSKALHRPNVLEPFQPTSLSVLNFSPENYAYTLYEMFNPMLLPE 255

Query: 415 IDNPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDEVDLPGGVDMPMEFYPQLYTS 474
            D+     +           D++AP+FT++F  MD TT+EV+L  GV +P+EFYPQLYT 
Sbjct: 256 -DSGRGYEIE-------NAFDFLAPVFTIIFDDMDDTTEEVNLSHGVQIPIEFYPQLYTK 307

Query: 475 TCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTK-DCGSETK 533
              + +V  V          +K  + + + L+SFQGK I+ FL S+++YL +   G E K
Sbjct: 308 NALEKVVVPVLEETDALRNTNKLKVDQMSSLQSFQGKQISSFLNSSINYLEEIPLGDEDK 367

Query: 534 ALEEMKILETL---INNAKNTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDEP 590
           + E +  LE +   ++N K  +M DY      +   L+   P   IID AK   +I DEP
Sbjct: 368 SKELVDTLEKIKYQLSNKKREMMADYTETQRQIDL-LSFEGPSEKIIDLAKQVGII-DEP 425

Query: 591 YLLTMAVISPLAYFI-----------------RNRQGKWYLVRFNMIS-TEFQITECESI 632
           YLL + V SP  Y I                  N Q    ++ F   S T+ ++T  E+ 
Sbjct: 426 YLLRLVVFSPNDYIIARGISADDGNTGMETGNNNLQYIRNIIEFGSSSLTQEELTAQET- 484

Query: 633 RNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQ 685
              Q   K  T HA+E P++F+Y +K  I     I   + +N+    F K++ 
Sbjct: 485 ---QDITKSHTRHASETPILFVYIKKDHIDAPQDILASISENETLTNFLKEEH 534

>Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 6   SVSSLMEMGIPREVAVNALIRANGNLEAAVAFIF 39
           ++  LM++G PR+  V AL + NGN E A + +F
Sbjct: 394 TIKQLMDLGFPRDAVVTALKQTNGNAEFAASLLF 427

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 33/48 (68%), Gaps = 5/48 (10%)

Query: 5   DSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSN-----EIPPEN 47
           +S++S++ MG+ + ++  ALI  NG++ A++ ++F+N     E+P EN
Sbjct: 643 ESLNSMISMGLAQNLSRKALILNNGDINASIEWVFNNMDDNGELPEEN 690

>YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA
           damage-inducible v-SNARE binding protein with a role in
           suppression of protein secretion; may play a role in
           S-phase checkpoint control; has ubiquitin-associated
           (UBA), ubiquitin-like (UBL), and retroviral-like
           proteinase (RVP) domains
          Length = 428

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 6   SVSSLMEMGIPREVAVNALIRANGNLEAAVAFIF 39
           ++  LM++G PR+  V AL + NGN E A + +F
Sbjct: 394 TIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLF 427

>NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON}
           Anc_8.185 YER143W
          Length = 462

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 5   DSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIF 39
           +++  LM++G PR   + AL R  GN E A A +F
Sbjct: 427 NTIKQLMDLGFPRNQVITALNRTGGNAEYAAALLF 461

>Suva_7.68 Chr7 (126915..134933) [8019 bp, 2672 aa] {ON} YGL195W
           (REAL)
          Length = 2672

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 44/81 (54%)

Query: 495 SKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEEMKILETLINNAKNTIME 554
           SK L Q F+  +S +    ++ L S +  L K   S T + + MK+++ +  N K+ +  
Sbjct: 332 SKLLNQSFSAFKSSKETVRSISLHSVITLLRKVSKSGTSSEDLMKVVDEIFKNIKSNLNA 391

Query: 555 DYKALSADLQGPLNVSHPEVS 575
           DYK++ + +   + ++H EVS
Sbjct: 392 DYKSMISKILIEIPLTHREVS 412

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 44/83 (53%), Gaps = 22/83 (26%)

Query: 5   DSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTGQQEP 64
           +S+S++++MG+  ++++ AL+   G++ A++ ++F+N  P +N E              P
Sbjct: 668 ESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNN--PDDNGEL-------------P 712

Query: 65  SQLPPRSEASG-------ADPYQ 80
           S+  P+ +  G       A PY+
Sbjct: 713 SETTPKRDEEGIIYGNLDAKPYR 735

>Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 6   SVSSLMEMGIPREVAVNALIRANGNLEAAVAFIF 39
           ++  LM++G PR+  V AL +  GN E A + +F
Sbjct: 394 TIKQLMDLGFPRDTVVKALKQTGGNAEFAASLLF 427

>Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 6   SVSSLMEMGIPREVAVNALIRANGNLEAAVAFIF 39
           ++  LM++G PR+  V AL + NGN + A + +F
Sbjct: 394 TIKQLMDLGFPRDDVVKALKQTNGNADFAASLLF 427

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 5   DSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSN-----EIP-PENNETSTVANDND 58
           DS++S++ MG+  ++   ALI  NG++  +V ++F+N     E+P PE           D
Sbjct: 653 DSLASMLSMGLSPKLCRKALIINNGDVNRSVEWVFNNMDDNGELPDPEGQSEQQQQQQKD 712

Query: 59  TGQ 61
            G 
Sbjct: 713 LGH 715

>CAGL0D01826g Chr4 (189933..197933) [8001 bp, 2666 aa] {ON} similar
           to uniprot|P33892 Saccharomyces cerevisiae YGL195w GCN1
           translational activator
          Length = 2666

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 45/100 (45%)

Query: 490 EAHRLSKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEEMKILETLINNAK 549
           E +  +K + Q F+  +S +    T  +  T+  L   C   T+    +KI+E +  N K
Sbjct: 328 ELYASTKLMSQAFSSFKSSREGTKTAAISFTVSVLRSLCVETTEESALLKIVENIFTNLK 387

Query: 550 NTIMEDYKALSADLQGPLNVSHPEVSIIDQAKASNLIDDE 589
             +  DYKA+ + L   +   H  VS+    K S L+  E
Sbjct: 388 TNMNADYKAIVSTLLQAIPTFHENVSLDIAEKLSPLLVKE 427

>CAGL0I06787g Chr9 complement(658666..659946) [1281 bp, 426 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143w DDI1 induced in response to DNA alkylation
           damage
          Length = 426

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 6   SVSSLMEMGIPREVAVNALIRANGNLEAAVAFIF 39
           ++  LM++G  R+  + AL+  NGN E A + +F
Sbjct: 392 TIKQLMDLGFSRQEVIQALVSTNGNAEFAASLLF 425

>Skud_7.77 Chr7 (137226..145244) [8019 bp, 2672 aa] {ON} YGL195W
           (REAL)
          Length = 2672

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 43/81 (53%)

Query: 495 SKELLQKFNQLRSFQGKDITMFLKSTMDYLTKDCGSETKALEEMKILETLINNAKNTIME 554
           SK L Q F+ L+S +     + L S      K   S+T + + MK+++ +  N K+ +  
Sbjct: 332 SKLLNQSFSALKSSKDVVRAISLHSVKILFRKISKSDTNSEDLMKVVDEIFRNIKSNLNA 391

Query: 555 DYKALSADLQGPLNVSHPEVS 575
           DYK++ + +   + ++H EVS
Sbjct: 392 DYKSMISKILIEIPLTHREVS 412

>NCAS0J01660 Chr10 (297346..300834) [3489 bp, 1162 aa] {ON}
           Anc_4.276 YLR410W
          Length = 1162

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 23/34 (67%)

Query: 653 FIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQI 686
           ++  RK  I++DLI+QK L D + CLQ  ++ ++
Sbjct: 250 YVKLRKPFIINDLIMQKVLWDRRLCLQILENSKV 283

>Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,
           250 aa]
          Length = 249

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 15/71 (21%)

Query: 5   DSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSN-----EIP----PENNETSTVAN 55
           +S+S+++ MG+  +++  ALI   G+L  +V ++F+N     E+P    P N E  T   
Sbjct: 122 ESLSNMVAMGLDMKLSKKALILNKGDLNRSVEWVFNNMDDDGELPQADSPSNTENKTC-- 179

Query: 56  DNDTGQQEPSQ 66
               G  EP +
Sbjct: 180 ----GYNEPGK 186

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,224,500
Number of extensions: 3565762
Number of successful extensions: 14673
Number of sequences better than 10.0: 145
Number of HSP's gapped: 15188
Number of HSP's successfully gapped: 173
Length of query: 709
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 592
Effective length of database: 40,065,477
Effective search space: 23718762384
Effective search space used: 23718762384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)