Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C010705.526ON75775732150.0
NCAS0H025505.526ON7433428571e-103
YML006C (GIS4)5.526ON7743446074e-67
Suva_13.1565.526ON7723555961e-65
Smik_13.1455.526ON7741585592e-60
Skud_13.1485.526ON7791585573e-60
KNAG0B037105.526ON7111484953e-52
TDEL0A039005.526ON6711534924e-52
CAGL0K07271g5.526ON7761574523e-46
SAKL0G04906g5.526ON6083624295e-44
Kwal_47.186465.526ON6351484243e-43
KLTH0G03740g5.526ON6311564192e-42
KAFR0C053905.526ON4551494003e-41
KLLA0A01782g5.526ON5281493842e-38
ZYRO0D12540g5.526ON5481543814e-38
TBLA0D016605.526ON8661563682e-35
Kpol_1023.995.526ON5512102601e-22
Ecym_40615.526ON663802556e-22
NCAS0F010805.526ON379802222e-18
TPHA0K005405.526ON6752172227e-18
NDAI0H015905.526ON371792033e-16
ADR198C5.526ON549811975e-15
TBLA0G009405.526ON782671030.001
KNAG0C032405.526ON32439810.38
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C01070
         (757 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...  1243   0.0  
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...   334   e-103
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...   238   4e-67
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...   234   1e-65
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...   219   2e-60
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...   219   3e-60
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...   195   3e-52
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...   194   4e-52
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...   178   3e-46
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   169   5e-44
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   167   3e-43
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   166   2e-42
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...   158   3e-41
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...   152   2e-38
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   151   4e-38
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...   146   2e-35
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...   104   1e-22
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...   102   6e-22
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    90   2e-18
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    90   7e-18
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               83   3e-16
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...    80   5e-15
TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...    44   0.001
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      36   0.38 

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score = 1243 bits (3215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/757 (82%), Positives = 627/757 (82%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYS      
Sbjct: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTD 60

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120
                     SVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT
Sbjct: 61  TAIDDNNNTNSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120

Query: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPNLHLNNLDSXXXXXXXXXXXXXX 180
           QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPNLHLNNLDS              
Sbjct: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPNLHLNNLDSLQLQEQNDDEEEKQ 180

Query: 181 XXXXXXXXYIHKESRDPNEDSSIDNDTDEILITQPITTTTSLSHNNQAYTPDENEQLNQT 240
                   YIHKESRDPNEDSSIDNDTDEILITQPITTTTSLSHNNQAYTPDENEQLNQT
Sbjct: 181 REEREEKQYIHKESRDPNEDSSIDNDTDEILITQPITTTTSLSHNNQAYTPDENEQLNQT 240

Query: 241 EKHTGNAYDNSSIVLNFPHLRKHSKDPKQTIINEQQEEPLANNQYYTPPQSELVSINSFG 300
           EKHTGNAYDNSSIVLNFPHLRKHSKDPKQTIINEQQEEPLANNQYYTPPQSELVSINSFG
Sbjct: 241 EKHTGNAYDNSSIVLNFPHLRKHSKDPKQTIINEQQEEPLANNQYYTPPQSELVSINSFG 300

Query: 301 DDDTNSMAYQGHPLHLVLTRQDEESSTQLEEDELGAKNLSNTALGLNNNDNHMDDQSSGL 360
           DDDTNSMAYQGHPLHLVLTRQDEESSTQLEEDELGAKNLSNTALGLNNNDNHMDDQSSGL
Sbjct: 301 DDDTNSMAYQGHPLHLVLTRQDEESSTQLEEDELGAKNLSNTALGLNNNDNHMDDQSSGL 360

Query: 361 EPSYENSEISIQNSGFDSYSNQLQRFDDDTNEEIKKPVECVRSIDEDDESDYNIIQGTRN 420
           EPSYENSEISIQNSGFDSYSNQLQRFDDDTNEEIKKPVECVRSIDEDDESDYNIIQGTRN
Sbjct: 361 EPSYENSEISIQNSGFDSYSNQLQRFDDDTNEEIKKPVECVRSIDEDDESDYNIIQGTRN 420

Query: 421 MHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRNEGHFRLVLQ 480
           MH                                              DRNEGHFRLVLQ
Sbjct: 421 MHVGDQNDSDEGDDEEEVHGDDDDDDDDLDDLSSDYSVLSILPSISISDRNEGHFRLVLQ 480

Query: 481 STLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDLLDSNRTFP 540
           STLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDLLDSNRTFP
Sbjct: 481 STLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDLLDSNRTFP 540

Query: 541 KILFYSMVIVNESSPPINDDQHNYNGMTALNSEYXXXXXXXXXXXXXXXXXXINRYKYYP 600
           KILFYSMVIVNESSPPINDDQHNYNGMTALNSEY                  INRYKYYP
Sbjct: 541 KILFYSMVIVNESSPPINDDQHNYNGMTALNSEYLSNKLESLEKTSSEEGKSINRYKYYP 600

Query: 601 TLPKAGITAKNGEMIADVPEQFFPGPPSXXXXXXXXXXXXXXXXXSLMEQHGPEMYLPTR 660
           TLPKAGITAKNGEMIADVPEQFFPGPPS                 SLMEQHGPEMYLPTR
Sbjct: 601 TLPKAGITAKNGEMIADVPEQFFPGPPSDDENGKGEDYDDDYDDESLMEQHGPEMYLPTR 660

Query: 661 MQTNVTTAHRSIRTANSIGEWAFNRXXXXXXXXXXXVDDENKDPDYMEDTSNDKYETSRT 720
           MQTNVTTAHRSIRTANSIGEWAFNR           VDDENKDPDYMEDTSNDKYETSRT
Sbjct: 661 MQTNVTTAHRSIRTANSIGEWAFNRMNSNTTSNNMNVDDENKDPDYMEDTSNDKYETSRT 720

Query: 721 NDVHINIDEKDLNLNQAKLKNKSDYKSKETNGKHKLI 757
           NDVHINIDEKDLNLNQAKLKNKSDYKSKETNGKHKLI
Sbjct: 721 NDVHINIDEKDLNLNQAKLKNKSDYKSKETNGKHKLI 757

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score =  334 bits (857), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/342 (54%), Positives = 220/342 (64%), Gaps = 43/342 (12%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           MQ SVRV DY++NDDNGLWSWYL NIRLGDFEE+TGNQLKYTLLKRFLNSHFYS      
Sbjct: 1   MQKSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTA 60

Query: 61  XXX------XXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENI 114
                           +   +KP  +KILLVSIPDKVH D+S+LE FLRDYFHLE LE I
Sbjct: 61  TESPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGI 120

Query: 115 QITKLTQSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPNLHLNN-LDSXXXXXXX 173
           QI +LTQS+CYNHENHYLLTD +NNFDDP+FLEFAGS WQ R NLHLNN LD        
Sbjct: 121 QIQRLTQSKCYNHENHYLLTDTINNFDDPVFLEFAGSNWQARKNLHLNNHLDHRDDDR-- 178

Query: 174 XXXXXXXXXXXXXXXYIHKESRDPNEDSSIDNDTDEILITQPITTTTSLSHNNQAYTPDE 233
                           I  +S D +  S+++ + D+IL+TQPI +T          TP+ 
Sbjct: 179 ----------------ISPQSIDTH--SALNKNDDQILVTQPIDST--------LVTPET 212

Query: 234 NEQLNQTEKHTGNAYDNSSIVLNFPHLRKHS--KDPKQTIINEQQEEPLANNQYYTPPQS 291
            E+ N  +   G     SSIVLNF H R+H   KDP   +  E+Q    + N  +TPPQS
Sbjct: 213 REKENLDDIDVG----GSSIVLNFSHTREHRKDKDPLNMVKQEEQSNKFSPNMMFTPPQS 268

Query: 292 ELVSINSFGDDDTNSMAYQGHPLHLVLTRQDEESSTQLEEDE 333
           ELVSINSF  DD +SM Y GHPL L LTRQDEES  QLE+D+
Sbjct: 269 ELVSINSF--DDGDSMNYNGHPLKLTLTRQDEESIAQLEQDK 308

 Score =  212 bits (540), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 136/220 (61%), Gaps = 25/220 (11%)

Query: 469 DRNEGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILT 528
           D  EGHFRLVLQS LIQ+P+TKEI+TAIRQSNNEPTIA I DDWLLYDS+F+MDNLQILT
Sbjct: 430 DAIEGHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDSQFSMDNLQILT 489

Query: 529 LQDLLDSNRTFPKILFYSMVIVNES-SPPINDDQHNYNGMTALNSEYXXXXXXXXXXXXX 587
           LQDLLD+NR+FPKILFYSMVIV ++   PI        G T+                  
Sbjct: 490 LQDLLDTNRSFPKILFYSMVIVTDAHHQPI-------QGPTSTAGPDLTTSYLSNKLESI 542

Query: 588 XXXXXINRY--KYYPTLPKAGITAKNGEMIADVPEQFFPGPPSXXXXXXXXXXXXXXXXX 645
                  R+  +YYP            + + D P+QFFP                     
Sbjct: 543 AGDETNQRFENRYYPMA---------DDQVEDQPQQFFP------QEDDHDDDNMYDTDD 587

Query: 646 SLMEQHGPEMYLPTRMQTNVTTAHRSIRTANSIGEWAFNR 685
           SLME+ GPEMYLPTRM+TN TTAHRSIRT NSIGEWAFNR
Sbjct: 588 SLMEEAGPEMYLPTRMETNNTTAHRSIRTVNSIGEWAFNR 627

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score =  238 bits (607), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 156/344 (45%), Positives = 193/344 (56%), Gaps = 45/344 (13%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           MQ SVRV DY++NDDNGLWSWYL N+RLGDFEEL GNQLKYTLLKRFLNSHFY       
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISA 60

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120
                          +P  KKILLVSIP+ VH DIS+LE+FL+DYFHLE LE+IQI+KLT
Sbjct: 61  ---------------RPN-KKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLT 104

Query: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPN---LHLNNLDS----XXXXXXX 173
            S CYNHENHYLLTD +NNF DP FLEFA ++WQ + N   L+ NN +S           
Sbjct: 105 HSHCYNHENHYLLTDNLNNFQDPTFLEFASTSWQVQKNSKALNNNNRNSIPPPTISSSKA 164

Query: 174 XXXXXXXXXXXXXXXYIHKESRDPNEDSSIDN-----DTDEILITQPITTTTSLSHNNQA 228
                           I+ ++      ++        DT +I +T    +  S S+NN  
Sbjct: 165 SNGKLESNVSDDQWSNINTQTSTATRTNTNTRTLTSPDTVDINVT----SVNSQSNNND- 219

Query: 229 YTPDENEQLNQTEKHTGNAYDNSSIVLNFPHLRKHSKDPKQTIINEQQEEPLANNQYYTP 288
            TP +NE     E  T      SSIVLNF H R     P +      +  P   N+ YTP
Sbjct: 220 -TPQDNENEVDEEDAT------SSIVLNFSHSRTVDSKPNRL----PKIFPSYTNEDYTP 268

Query: 289 PQSELVSINSFGDDDTNSMAYQGHPLHLVLTRQDEESSTQLEED 332
             SE++SI+SF  +D +S  Y G  L L   R+++ES     ED
Sbjct: 269 SHSEIMSIDSFAGEDVSS-TYPGQDLSLTTARREDESGQDEVED 311

 Score =  189 bits (481), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 106/217 (48%), Positives = 130/217 (59%), Gaps = 37/217 (17%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           G+FRLVLQS LIQ+P TKEIFTAIRQSNN+PT+A +TDDWLLYDS F+M+NLQILTLQDL
Sbjct: 447 GYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDL 506

Query: 533 LDSNRTFPKILFYSMVIVNESSPPINDD--QHNYNGMTALNSEYXXXXXXXXXXXXXXXX 590
           LD  R+FPKILFY+MVIV  S   + ++    NY+    ++ E                 
Sbjct: 507 LDIKRSFPKILFYTMVIVTNSGKQVEEEFKNPNYDNREGISKE----------------- 549

Query: 591 XXINRYKYYPTLPKAGITAKNGEMIADVPEQFFPGP--PSXXXXXXXXXXXXXXXXXSLM 648
                    P   +  +T        + P+Q+FP                       SL 
Sbjct: 550 --------QPLDSELSLT--------NDPQQYFPTAYNNGYNDYIDDEDDEDDGDDASLS 593

Query: 649 EQHGPEMYLPTRMQTNVTTAHRSIRTANSIGEWAFNR 685
           EQ GP+MY+PTRM++NVTTAHRSIRT NSIGEWAFNR
Sbjct: 594 EQSGPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNR 630

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score =  234 bits (596), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 151/355 (42%), Positives = 187/355 (52%), Gaps = 77/355 (21%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           MQ SVRV DY++NDDNGLWSWYL N+RLGDFEEL GNQLKYTLLKRFLNSHFY       
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTS- 59

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120
                         I+P  KKILLVSIP+ VH DIS+LE+FL+DYFHLE LE+IQI+KLT
Sbjct: 60  --------------IRPN-KKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLT 104

Query: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPNLHLNNLDSXXXXXXXXXXXXXX 180
            S CYNHENHYLLTD +NNF DP FLEFA ++WQ + N                      
Sbjct: 105 HSHCYNHENHYLLTDYLNNFQDPSFLEFASTSWQVQKN-------------------PKS 145

Query: 181 XXXXXXXXYIHKESRDPNEDS-------SIDNDTDEILITQPITTTTSLSHNNQAYTPDE 233
                    IH  +   ++ S       ++D+   +I     +T  T+ +     YT   
Sbjct: 146 LNNNNNRHLIHASTASSSKPSNAQLKPNTLDDQLLDINTQTSMTARTNTNTKTLTYTDTA 205

Query: 234 NEQLNQTEKHTGNAYDN--------------------SSIVLNFPHLR----KHSKDPKQ 269
           +  L Q E    N  DN                    SSIVLNF H R    K ++ PK 
Sbjct: 206 DPSLTQPE--CNNKGDNDMPQNNENENEEEDAGDDAASSIVLNFSHPRTLASKANRAPKI 263

Query: 270 TIINEQQEEPLANNQYYTPPQSELVSINSFGDDDTNSMAYQGHPLHLVLTRQDEE 324
                    P   N+ Y P  SE+VSI+SF  +D +S  Y G  L L   R++++
Sbjct: 264 F--------PSYTNEDYNPSHSEIVSIDSFAGEDVSS-TYPGQDLSLTTARREDK 309

 Score =  190 bits (483), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 108/213 (50%), Positives = 132/213 (61%), Gaps = 30/213 (14%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           G+FRLVLQS LIQNP TKEIFTAIRQSNNEPT+A +TDDWLLYDS F+M+NLQILTLQDL
Sbjct: 446 GYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMNNLQILTLQDL 505

Query: 533 LDSNRTFPKILFYSMVIVNESSPPINDDQHNYNGMTALNSEYXXXXXXXXXXXXXXXXXX 592
           LD  R+FPKIL Y+MVIV  S     ++++     T LN ++                  
Sbjct: 506 LDIKRSFPKILLYTMVIVTNSGQQQIEEEN-----TNLNQQH----------------RE 544

Query: 593 INRYKYYPTLPKAGITAKNGEMIADVPEQFFPGPPSXXXXXXXXXXXXXXXXXSLMEQHG 652
           ++  +  P  P + ++  N       P+++FP                     SL EQ G
Sbjct: 545 VDLTEEKP--PNSELSLSND------PQRYFPS-TFDDDYDEYIDDDDGGDDASLSEQSG 595

Query: 653 PEMYLPTRMQTNVTTAHRSIRTANSIGEWAFNR 685
           P+MYLPTRM +NVTTAHRSIRT NSIGEWAFNR
Sbjct: 596 PQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNR 628

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score =  219 bits (559), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 104/158 (65%), Positives = 117/158 (74%), Gaps = 16/158 (10%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           MQ SVRV DY++NDDNGLWSWYL N+RLGDFEEL GNQLKYTLLKRFLNSHFY       
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120
                              KKILLVSIP+ VH DIS+LE+FL+DYFHLE LE+IQI+KLT
Sbjct: 61  RSN----------------KKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLT 104

Query: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPN 158
            S CYNHENHYLLTD +NNF DP FLEFA ++WQ + N
Sbjct: 105 HSHCYNHENHYLLTDNLNNFQDPTFLEFASTSWQVQKN 142

 Score =  195 bits (496), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 158/287 (55%), Gaps = 46/287 (16%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           G+FRLVLQS LIQ+P TKEIFTAIRQSNN PTIA +TDDWLLYDS F+M+NLQILTLQDL
Sbjct: 450 GYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMNNLQILTLQDL 509

Query: 533 LDSNRTFPKILFYSMVIVNESSPPINDDQHNYNGMTALNSEYXXXXXXXXXXXXXXXXXX 592
           LD  R+FPKILFY+MVIV ES   I ++  N N  T                        
Sbjct: 510 LDIKRSFPKILFYTMVIVTESGQQIEEEPKNPNYGT------------------------ 545

Query: 593 INRYKYYPTLPKAGITAKNGEMIADVPEQFFPGPPSXXXXXXXXXXXXXXXXXSLMEQHG 652
             R       P       +  +++  P+Q+FP                     SL EQ G
Sbjct: 546 --REDMLKEQP-----LNSDLLLSHDPKQYFPN-AYNNDYDEYIDDEDDDDDASLSEQSG 597

Query: 653 PEMYLPTRMQTNVTTAHRSIRTANSIGEWAFNRXXXXXXXXXXXV----DDENKD----- 703
           P+MY+PTRM++NVTTAHRSIRT NSIGEWAFNR                D EN D     
Sbjct: 598 PQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSNSNESDDSENNDDRLSS 657

Query: 704 --PDYMEDTSNDKYETSRTNDVHINIDEKDLNLNQAKLKNKSDYKSK 748
             P  M   SN  + TS +N  H ++ +K+ +   +K+ N+S+ KS+
Sbjct: 658 DEPYPMTQISN--FNTSSSNFSH-SLKKKNTSKVNSKINNESNSKSE 701

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 57/112 (50%), Gaps = 7/112 (6%)

Query: 213 TQPITTTTSLSHNNQAYTPDENEQLNQTEKHTGNAYDNSSIVLNFPHLRKHSKDPKQTII 272
           T  I  T++   +N    P ++E  N  E    +    SSIVLNF H R  + +PK + +
Sbjct: 203 TADICLTSANRQSNNYAVPQDSENRNDGEDAADDT--TSSIVLNFSHSR--ALEPKTSRL 258

Query: 273 NEQQEEPLANNQYYTPPQSELVSINSFGDDDTNSMAYQGHPLHLVLTRQDEE 324
              +  P   N+ YTP  SE+VSI+SF  +D +S  Y G  L L   R +++
Sbjct: 259 --PKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSS-TYPGQDLSLTTARCEDD 307

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score =  219 bits (557), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 119/158 (75%), Gaps = 16/158 (10%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           MQ SVRV DY++NDDNGLWSWYL N+RLGDFEEL GNQLKYTLLKRFLNSHFY       
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120
                          +P  KKILLVSIP+ VH DIS+LE+FL+DYFHLE LE+IQI+KLT
Sbjct: 61  ---------------RPN-KKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLT 104

Query: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPN 158
            S CYNHENHYLLTD +NNF DP FLEFA ++WQ + N
Sbjct: 105 HSHCYNHENHYLLTDNLNNFQDPTFLEFASTSWQVQKN 142

 Score =  191 bits (486), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/214 (49%), Positives = 130/214 (60%), Gaps = 33/214 (15%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           G+FRLVLQS LIQ+P TKEIFTAIRQSNN+PT+A +TDDWLLYDS F+M+NLQILTLQDL
Sbjct: 454 GYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDL 513

Query: 533 LDSNRTFPKILFYSMVIVNESSPPINDDQHNYNGMTALNSEYXXXXXXXXXXXXXXXXXX 592
           LD  R+FPKILFY+MVIV +S     +++H  +                           
Sbjct: 514 LDIKRSFPKILFYTMVIVTDSGHQQIEEEHKSSS-------------------------- 547

Query: 593 INRYKYYPTLPKAGITAKNGEM-IADVPEQFFPGPPSXXXXXXXXXXXXXXXXXSLMEQH 651
                +  T+  +     N E+ ++  P+Q+FP                     SL EQ 
Sbjct: 548 -----HRGTVDTSKEEPLNSELSLSHDPQQYFP-TAYNIDYDEYTDDEDEGDDASLSEQS 601

Query: 652 GPEMYLPTRMQTNVTTAHRSIRTANSIGEWAFNR 685
           GP+MYLPTRM +NVTTAHRSIRT NSIGEWAFNR
Sbjct: 602 GPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNR 635

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score =  195 bits (495), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 94/148 (63%), Positives = 109/148 (73%), Gaps = 20/148 (13%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           MQ S+RV DYY+NDDNGLWSWYL+NIR GDFEELT N+LKYTLLKRFL +HF S      
Sbjct: 1   MQKSIRVNDYYDNDDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHFTS------ 54

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120
                         ++    KIL +SIPDKVHSDIS+LE FL+DYFHLEDL+NI+I KLT
Sbjct: 55  --------------LEGINSKILFISIPDKVHSDISVLETFLKDYFHLEDLQNIKIQKLT 100

Query: 121 QSECYNHENHYLLTDKVNNFDDPMFLEF 148
            S CYNHENHYLLTD +NNF+D  FL +
Sbjct: 101 TSNCYNHENHYLLTDTLNNFNDRKFLRY 128

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 62/82 (75%), Gaps = 1/82 (1%)

Query: 472 EGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQD 531
           EGHFRLVLQS L+Q    K IFTAIRQSNN+   A + DDW+LYDS F+M+NL ++TL+ 
Sbjct: 471 EGHFRLVLQSVLLQRE-DKAIFTAIRQSNNKVDRATVQDDWILYDSDFSMNNLMMMTLRG 529

Query: 532 LLDSNRTFPKILFYSMVIVNES 553
           L + +    KILFYSM+IV+++
Sbjct: 530 LFNFSENMSKILFYSMIIVDDA 551

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 27/33 (81%)

Query: 653 PEMYLPTRMQTNVTTAHRSIRTANSIGEWAFNR 685
           P+MYLP +  ++ TTAHRSIRT NSIGEWA+ +
Sbjct: 589 PQMYLPQKTASHATTAHRSIRTVNSIGEWAYKK 621

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 43/97 (44%), Gaps = 23/97 (23%)

Query: 251 SSIVLNFPHLRKHSKDPKQTII-----------NEQQEEPLANNQYYTPPQSELVSINSF 299
           SSIVL+FP  +  ++  K               N      L N+  YTP  SELVS NS+
Sbjct: 278 SSIVLDFPRSKVQAQKRKVRSARSSVSGSNASNNPLLNTALNNSNLYTPASSELVSFNSY 337

Query: 300 ---GDDDTNSMAYQG---------HPLHLVLTRQDEE 324
               +D +++M Y           HPL  +LTR D +
Sbjct: 338 YNEEEDASSTMIYNSQEGRSGHMDHPLTRMLTRSDSQ 374

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score =  194 bits (492), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 109/153 (71%), Gaps = 17/153 (11%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           MQ S++V DY++NDDNGLWSWYL +IR GDFEE + N+LK TLL+RFLNSHF S      
Sbjct: 1   MQKSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHFDSNRSHYG 60

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120
                               KIL VSIPDKVH D+SLLE FLRDYFHLE LE+I+ITKLT
Sbjct: 61  QNT-----------------KILFVSIPDKVHRDLSLLENFLRDYFHLEHLEHIEITKLT 103

Query: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTW 153
           QS  YNHENHY+L DK+NNFDDP FL+FA + W
Sbjct: 104 QSPVYNHENHYILIDKLNNFDDPTFLQFASTRW 136

 Score =  176 bits (446), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 96/215 (44%), Positives = 125/215 (58%), Gaps = 51/215 (23%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           GH+RLV+QS+L+Q+P TKEI+TAIRQSNN+PT+A + DDWLLYDS+F+M+NLQ+LTLQ+L
Sbjct: 397 GHYRLVMQSSLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSMNNLQMLTLQEL 456

Query: 533 LDSNRTFPKILFYSMVIVNESSPPINDDQHNY----NGMTALNSEYXXXXXXXXXXXXXX 588
           LD NR+FPKI+FYSM++V       +D+Q       NGMT                    
Sbjct: 457 LDMNRSFPKIIFYSMIVV-------SDEQQELLQWSNGMT-------------QKEDTAD 496

Query: 589 XXXXINRYKYYPTLPKAGITAKNGEMIADVPEQFFPGPPSXXXXXXXXXXXXXXXXXSLM 648
               I R   Y ++ +              P+QF+                      SL 
Sbjct: 497 ASSSIPRADSYASMSRD-------------PQQFYAN--------------MDDDDTSLS 529

Query: 649 EQHGPEMYLPTRMQTNVTTAHRSIRTANSIGEWAF 683
           EQ GP MY PTR+Q+N +TAHRSIRT NSIG+WAF
Sbjct: 530 EQSGPMMYAPTRLQSNTSTAHRSIRTVNSIGDWAF 564

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 69/155 (44%), Gaps = 41/155 (26%)

Query: 236 QLNQTEKHTGNAYD--NSSIVLNFPH--LRK----------------HSKDPKQTIINEQ 275
           Q NQ   ++ N  D  N SIVL+F H  LRK                +S D  QTI N  
Sbjct: 217 QFNQIPINSINDQDDENESIVLDFSHSLLRKQMEEKKSQAQRIRQQEYSADTNQTITNLH 276

Query: 276 QEEPLAN-NQYYTPPQSELVSINSFGD----DDTNSM----AYQGHPLHLVLTR------ 320
             +   N +  Y+P  SE VSINS+ D    D ++S+    +Y G PL L  T       
Sbjct: 277 TNDKDTNASDIYSPAISENVSINSYEDESMRDGSDSITAKDSYSGQPLALTTTHYKDDTQ 336

Query: 321 -----QDEESSTQLEEDELGAKNL-SNTALGLNNN 349
                  EE+ ++L       K+L S T+LG NN+
Sbjct: 337 GSSDDSQEENISELSSVSRSMKSLGSQTSLGDNND 371

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score =  178 bits (452), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 106/157 (67%), Gaps = 19/157 (12%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           M  SVRV DYY ND+NG+WSWYL N+R GDFEE+  N+LKYTLLKRFLNS+         
Sbjct: 1   MSKSVRVGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLGNFSPES 60

Query: 61  XXXXXXXXXXSVNDIKPTV---KKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQIT 117
                           PT    KK++ VSIP+ VH DIS+LELFLRDYFHL+ L+N QI 
Sbjct: 61  ----------------PTRFINKKLIFVSIPEDVHQDISILELFLRDYFHLKVLDNNQIH 104

Query: 118 KLTQSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQ 154
           KLTQ + Y+HENHY L D++NNF+DP FLEF  S W+
Sbjct: 105 KLTQDKVYHHENHYFLMDELNNFEDPTFLEFGKSNWK 141

 Score =  130 bits (326), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 57/82 (69%), Positives = 73/82 (89%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           G+FRLVLQS LIQ+P TKE+FTA+RQSNN+PTIA ITDDWLLYD++F+M NLQILTLQD+
Sbjct: 465 GYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSMHNLQILTLQDI 524

Query: 533 LDSNRTFPKILFYSMVIVNESS 554
           +   + +PKILFY+MV++N+ S
Sbjct: 525 MTIKKDYPKILFYTMVVINDRS 546

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (56%), Gaps = 8/97 (8%)

Query: 230 TPDENEQLNQTEKHTGNAYDN-SSIVLNFPHLRKHSKDPKQTIINEQQEEPLANNQYYTP 288
           T  E+  ++ + K TG   D  SSIVLNF H R   K  ++T I+    E   ++ +YTP
Sbjct: 284 TDRESTNVDNSNKRTGLDDDGASSIVLNFSHNRNAHK--RKTKIDSLLGERYPSD-FYTP 340

Query: 289 PQSELVSINSFGDDDTNSMAYQGHPLHLVLTRQDEES 325
           PQSELVSINS G    ++  Y G  L L++T+   +S
Sbjct: 341 PQSELVSINSCG----SAEDYTGQSLRLMVTKNGTDS 373

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 22/26 (84%)

Query: 660 RMQTNVTTAHRSIRTANSIGEWAFNR 685
           R ++N+TT HRSIRT NSIG+W+ +R
Sbjct: 616 RTKSNMTTTHRSIRTVNSIGDWSISR 641

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  169 bits (429), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 130/362 (35%), Positives = 174/362 (48%), Gaps = 72/362 (19%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           M + V+V+DY+ ND NGLWSWYL N+R G FEELT N LK+TLLKRFLN H         
Sbjct: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHL-------- 52

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120
                      + DI    KK+LLVSIPD +H DI++LE FLR YFHL+DL+ IQI KLT
Sbjct: 53  -----------MQDIVQFNKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLT 101

Query: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQG-RPNLHLNNLDSXXXXXXXXXXXXX 179
            S+ YNHENHYL++D +NNF D  FL F        RP L  N                 
Sbjct: 102 DSQIYNHENHYLISDNLNNFHDRSFLGFGQKKHDNVRPQLSYNGYSVLSGETGYASLRTT 161

Query: 180 XXXXXXXXXYIHKESRDPNEDSSIDNDTDEILITQPITTTTSLSHNNQAYTPDENEQLNQ 239
                        E  + N  ++      ++   +P+ ++            DE +Q   
Sbjct: 162 EEQNGTHRPSGVVEQCNGNSPAT----PRDVTAVEPVKSSE-----------DEEDQ--- 203

Query: 240 TEKHTGNAYDNSSIVLNFPHLRKHSKDPKQTIINEQQEEPLANNQYYTPPQSELVSINSF 299
                    ++  IVLNFPH       P + IIN++++E +          SE VSINS 
Sbjct: 204 ---------ESGEIVLNFPH------KPPKNIINQREQEVVTT--------SEDVSINS- 239

Query: 300 GDDDTNSMAYQGHPLHLVLTRQDEESSTQLEEDELGAKNLSNTALGLN----NNDNHMDD 355
                ++ +Y G  L   +TR ++ SS   +ED      LS+    LN    N+D   DD
Sbjct: 240 ----EDASSYDGEALIQTITRDEDASSA--DEDNSNISELSSVDHSLNSLSYNSDISSDD 293

Query: 356 QS 357
            S
Sbjct: 294 YS 295

 Score =  143 bits (361), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 115/217 (52%), Gaps = 28/217 (12%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           G FRLVLQS LIQNP T+EIFTA+RQSNN+P +AHI DDWLLYD KF+M NLQ+L+L D+
Sbjct: 310 GTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHNLQMLSLHDV 369

Query: 533 LDSNRTFPKILFYSMVIVNESSPPINDDQHNYNGMTALNSEYXXXXXXXXXXXXXXXXXX 592
           L+ NR FPKILFY+MV+++  +  I D+ H Y      N  +                  
Sbjct: 370 LEINRFFPKILFYTMVMLD--TEEIADEAHAY----IPNDPHLPPPSQGIASTSTLSQ-- 421

Query: 593 INRYKYYPTLPKAGITAKNGEMI------ADVPEQFFPGPPSXXXXXXXXXXXXXXXXXS 646
            N  +  PT        ++ E++      A   E +FP                      
Sbjct: 422 -NTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFP--------EDNHDDEDDQEVNG 472

Query: 647 LMEQHGPEMYLPTRMQTNVTTAHRSIRTANSIGEWAF 683
           +M  + P     TR  +N TTAHRSI T NSIGEWAF
Sbjct: 473 VMPLYAP-----TRTNSNSTTAHRSILTVNSIGEWAF 504

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  167 bits (424), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 101/148 (68%), Gaps = 19/148 (12%)

Query: 2   QNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXXX 61
           +NSV+V DY+ ND+NGLWSWYL N+R G+FEEL  NQLK  LL+RFLN    S       
Sbjct: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMS------- 55

Query: 62  XXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLTQ 121
                       +  P  KK+LLVSIPD +H + +LLE FLRDYFHL+DL+ IQI KLTQ
Sbjct: 56  ------------ETVPFNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQ 103

Query: 122 SECYNHENHYLLTDKVNNFDDPMFLEFA 149
            +CYNHENHYL+ D ++NF+D  FLEF 
Sbjct: 104 EKCYNHENHYLICDNLSNFNDKSFLEFG 131

 Score =  119 bits (299), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 68/80 (85%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           G FRLVLQS LIQ   T++++TA+RQSNN+PT+AH+ DDWLLYD KF+M+NLQIL L D+
Sbjct: 331 GRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDV 390

Query: 533 LDSNRTFPKILFYSMVIVNE 552
           L+ N+ FPK+LFYS+++V +
Sbjct: 391 LEINKFFPKVLFYSLIVVTD 410

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 23/30 (76%)

Query: 654 EMYLPTRMQTNVTTAHRSIRTANSIGEWAF 683
           ++Y  TR  +N +TAHRSIRT  SIG+WAF
Sbjct: 504 QLYSATRTNSNKSTAHRSIRTIKSIGDWAF 533

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  166 bits (419), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 105/156 (67%), Gaps = 19/156 (12%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           +++SV+V DY++ND+NGLWSWYL N+R G+FEEL  NQLK+ LL+RFLN    S      
Sbjct: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFN 61

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120
                              KK+LLVSIPD +H + +LLE FLRDYF+L+DL+ IQI KLT
Sbjct: 62  -------------------KKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLT 102

Query: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGR 156
           Q  CYNHENHYL++D ++NF+D  FLEF   + + R
Sbjct: 103 QDRCYNHENHYLISDSLSNFNDKSFLEFGAKSRRPR 138

 Score =  139 bits (350), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 106/211 (50%), Gaps = 12/211 (5%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           G FRLVLQS L+  P T+++FTA+RQSNN+PT+AH+ DDWLLYD KF+M+NLQIL L D+
Sbjct: 331 GRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDV 390

Query: 533 LDSNRTFPKILFYSMVIVNESSPPINDDQHNYNGMTALNSEYXXXXXXXXXXXXXXXXXX 592
           L+ N+ FPKILFYS+V+++E    +  D  +Y         Y                  
Sbjct: 391 LEMNKFFPKILFYSLVMISEE---VAADAQDY---------YPSKPSKSPQPTASNSTIS 438

Query: 593 INRYKYYPTLPKAGITAKNGEMIADVPEQFFPGPPSXXXXXXXXXXXXXXXXXSLMEQHG 652
            N  K  PTL  +     +            P   S                    E   
Sbjct: 439 ENTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGEEDDYYDDDKNSEGVV 498

Query: 653 PEMYLPTRMQTNVTTAHRSIRTANSIGEWAF 683
             +Y  TR  +N +TAHRSIRT  SIG+WAF
Sbjct: 499 VPLYSATRTNSNKSTAHRSIRTIKSIGDWAF 529

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score =  158 bits (400), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/149 (53%), Positives = 99/149 (66%), Gaps = 21/149 (14%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           M NSV++ DY++ND+NGLWSWYL N+R G+FEEL  N+LK +LLKRFL +          
Sbjct: 1   MPNSVQIHDYFDNDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRNQV-------- 52

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120
                        DI   +KKILL+SIPD + SDI++LE+FL DYFHL DL NI+I KLT
Sbjct: 53  -------------DINDQIKKILLISIPDHIFSDINVLEIFLSDYFHLNDLSNIKIIKLT 99

Query: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFA 149
           +   YNHENHYLL D VNNF D  FL + 
Sbjct: 100 KFNVYNHENHYLLIDSVNNFKDETFLNYV 128

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 1/80 (1%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           GH+RLVLQS LI N    ++ T +RQSNN    A+I DDW+LYD KF+M NL IL+L+DL
Sbjct: 264 GHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKFSMRNLNILSLKDL 323

Query: 533 -LDSNRTFPKILFYSMVIVN 551
            +  N    KILFYSM+ VN
Sbjct: 324 SIIGNVDSIKILFYSMIDVN 343

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score =  152 bits (384), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 96/149 (64%), Gaps = 21/149 (14%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           M  SV+V+DYY ND NGLWSWYL N+R G+FEELTGN+LK+ LLKRFL   F +      
Sbjct: 1   MPTSVQVKDYYENDYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQFQAT----- 55

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHL-EDLENIQITKL 119
                           P  KK+LLVSIPD++H DI +LE FL +YFHL +D  NI I KL
Sbjct: 56  ---------------GPLNKKLLLVSIPDEIHQDIKVLEEFLSEYFHLKDDHTNIVIDKL 100

Query: 120 TQSECYNHENHYLLTDKVNNFDDPMFLEF 148
           T+   Y HENHYL+ DK+ NF+D  FLE 
Sbjct: 101 TRGTVYKHENHYLIQDKLTNFNDEWFLEM 129

 Score = 98.6 bits (244), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 62/83 (74%)

Query: 471 NEGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQ 530
           N G FRLVLQS LI N  T++IFT IRQS N+ + A I DDWLLYD+ F + NLQ+L+L 
Sbjct: 285 NFGTFRLVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFNLGNLQMLSLY 344

Query: 531 DLLDSNRTFPKILFYSMVIVNES 553
           D+LD ++  PKILFYSM+ V +S
Sbjct: 345 DILDFSKFLPKILFYSMIHVKDS 367

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 655 MYLPTRMQTNVTTAHRSIRTANSIGEWAFNR 685
           +Y P    T  T  HRSIRT  SIG WA NR
Sbjct: 429 LYSPA---TAATAGHRSIRTVESIGAWALNR 456

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  151 bits (381), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 81/154 (52%), Positives = 102/154 (66%), Gaps = 21/154 (13%)

Query: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXX 60
           M  SVRV DY++NDDNGLWSWYL NIR GDFEELT NQLK++L KRFL ++         
Sbjct: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYL-------- 52

Query: 61  XXXXXXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120
                     ++N+ K T  K+L+VSIP+ V  DI+LLE FL DY    +L+N++ITKLT
Sbjct: 53  --------EPTLNERKDT--KVLIVSIPEDVRRDITLLEYFLGDYL---NLDNMEITKLT 99

Query: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQ 154
            S  YNHENHY++ DK NNF +  FL FA +  Q
Sbjct: 100 TSRIYNHENHYVVMDKENNFKNSNFLHFASTNIQ 133

 Score =  116 bits (291), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 1/87 (1%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           GHFRLVLQS L  NP + EIFTAIRQSNN+PT A + DDWLLYDS+F+M NLQ+LTLQDL
Sbjct: 309 GHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDL 368

Query: 533 LDSNRTFPKILFYSMVIVNESSPPIND 559
            + N+  PK+LFYS+V V + +P + D
Sbjct: 369 SELNKGCPKVLFYSLVEVVD-TPSLED 394

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 15/93 (16%)

Query: 249 DNSSIVLNFPHLRKHSKDPKQTIINEQQEEPLANNQYYTPPQS-----------ELVSIN 297
           D  S+V NF H   H   P +    ++QEE +  +  + P Q            E+ SI+
Sbjct: 179 DEESLVFNFTHRDHHLTHPLRAN-GKEQEEAVGVSPSWNPQQQQRLQEHNASNDEMASID 237

Query: 298 SF--GDDDTNSM-AYQGHPLHLVLTRQDEESST 327
           S+  G + +  + +++G PL L +TR ++ SS+
Sbjct: 238 SYNLGSNSSRVVESFKGEPLTLTMTRTEDFSSS 270

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score =  146 bits (368), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 96/156 (61%), Gaps = 13/156 (8%)

Query: 5   VRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXXXXXX 64
           V+V DYY+ND+NGLWSWYL NIR G FEELT N LK TLLKRFL  +F            
Sbjct: 9   VQVNDYYDNDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENF------------ 56

Query: 65  XXXXXXSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLTQSEC 124
                 S +       KIL  SIPD +H D+ +LE  L+DYF L++L+NIQI KLTQ+ C
Sbjct: 57  -QQDINSTSQHSTNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRC 115

Query: 125 YNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPNLH 160
           YNHENHY+L D ++NF +  F    G+  +  P  H
Sbjct: 116 YNHENHYILKDILDNFGNTSFFIHDGTKQKIPPLKH 151

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 68/85 (80%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           GHFRLVLQ  LI +P  ++ +TAIRQS++   +A I DDWLLYD KF+MDNL+ILTLQ+L
Sbjct: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569

Query: 533 LDSNRTFPKILFYSMVIVNESSPPI 557
           LD NR +PKILFY++V +N++S  I
Sbjct: 570 LDFNRDYPKILFYTLVAINDNSSYI 594

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/35 (68%), Positives = 30/35 (85%), Gaps = 1/35 (2%)

Query: 652 GPEMYLPTRMQTNVTT-AHRSIRTANSIGEWAFNR 685
           G EMY P+++++N TT AHRSIRT NSIGEWAF+R
Sbjct: 675 GLEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHR 709

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 100/210 (47%), Gaps = 42/210 (20%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
            +F+LVLQS LI N  + E+ TAIRQSNNE   A I DDWLLYDSKF+M NLQIL+L +L
Sbjct: 258 ANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFSMTNLQILSLNEL 317

Query: 533 LDSNRTFPKILFYSMVIVNESSPPINDDQHNYNGMTALNSEYXXXXXXXXXXXXXXXXXX 592
           L  N+ +PKILFYS+V    S P +  +  NY   +                        
Sbjct: 318 LHINKDYPKILFYSLV----SIPNVTVNISNYENSSN----------------------- 350

Query: 593 INRYKYYPTLPKAGITAKNGEMIADVPEQFFP-------GPPSXXXXXXXXXXXXXXXXX 645
                  P L      + +   I D P+QF+P          +                 
Sbjct: 351 -------PHLEDYINHSDDSLSIHDTPQQFYPMIVNDNNNNININNHNNTRRSSVDYYDD 403

Query: 646 SLMEQHGP-EMYLPTRMQTNVTTAHRSIRT 674
           S+ +Q  P +M +PT++ TN T AHRS RT
Sbjct: 404 SIPQQFYPDDMNIPTKVNTNTTIAHRSYRT 433

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 18 LWSWYLRNIRLGDFEELTGNQLKYTLLKRFL 48
          +W+WYL ++R G FEE+ GN+  Y LLK  L
Sbjct: 15 VWTWYLCHVRNGSFEEILGNEDYYKLLKNNL 45

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score =  102 bits (255), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 62/80 (77%)

Query: 471 NEGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQ 530
           +EG FR+VLQS LI N    ++ TA+RQSNN+ T+A I DDWLLYD +F+M+N+Q+++L 
Sbjct: 337 DEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLI 396

Query: 531 DLLDSNRTFPKILFYSMVIV 550
           D+ + N  FPKILFYS+V +
Sbjct: 397 DIFEMNGVFPKILFYSVVAI 416

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 66/125 (52%), Gaps = 22/125 (17%)

Query: 13  NDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXXXXXXXXXXXXSV 72
           +D NGLWSWYL N+R G+FEEL+ + +K  L+KR +    YS                  
Sbjct: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKE--YS------------------ 49

Query: 73  NDIKPTVKKILLVSIPDKVHSDISLLELFLRDYF-HLEDLENIQITKLT-QSECYNHENH 130
                   ++LLVS+PD +    S+LE FLR     + ++ +  ITKLT + +  N E+H
Sbjct: 50  GGTMSASNRVLLVSVPDDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDH 109

Query: 131 YLLTD 135
           YL+ D
Sbjct: 110 YLIND 114

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (73%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           G  R VL S LIQN  +KE FTAIRQ +++P  A+I D+WLLYDSKF++DNL++ TLQD+
Sbjct: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359

Query: 533 LDSNRTFPKILFYSMVIVNE 552
           L SN+    +L Y  +++++
Sbjct: 360 LLSNKGNSMLLLYKTILISK 379

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 21/137 (15%)

Query: 11  YNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXXXXXXXXXXXX 70
           Y +D + +WSWYL N++ G+FE L    ++   L+ +  S F S                
Sbjct: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGS----------- 57

Query: 71  SVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLTQSECYNHENH 130
                    KKILL S+P  +  ++S+  LFL   F+ E L+ I + + ++S     + H
Sbjct: 58  ---------KKILL-SVPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKH 107

Query: 131 YLLTDKVNNFDDPMFLE 147
           YLLTD ++ F++  F+E
Sbjct: 108 YLLTDALSGFNEAAFIE 124

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 73/217 (33%), Positives = 101/217 (46%), Gaps = 25/217 (11%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           G F+LVLQS ++ N  + E FTA+RQSN+    A   D+WLLYDSKF+MDNL+I+TL  L
Sbjct: 337 GEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYL 396

Query: 533 LDSNRTFPKILFYSMVIVNESSPP---------INDDQHNYNGMTA---LNSEYXXXXXX 580
           +D    F KI FYSMVI+N   P          IN++  N +G +A   L+S        
Sbjct: 397 MDIYADFVKIFFYSMVIINLEYPQAITFATDKHINNNLINSDGSSANLSLDSNISPLASN 456

Query: 581 XXXXXXXXXXXXINRYKYYPTLPKAGITAKNGEMIADVPEQFFPGPPSXXXXXXXXXXXX 640
                       + R    P +P +     N        +  F  P S            
Sbjct: 457 FLSVNDKEVAVSV-RNPLLPYIPNSDDNQHNNN-----NKTTFEKPSS-------NRDDE 503

Query: 641 XXXXXSLMEQHGPEMYLPTRMQTNVTTAHRSIRTANS 677
                S++E   PE++ P  + +N  TA RS+ T NS
Sbjct: 504 DSDCDSVLEYPIPEIFSPDTIASNKATALRSVTTNNS 540

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 23/132 (17%)

Query: 17  GLWSWYLRNIRLGDFEELTGNQLKY-TLLKRF---LNSHFYSXXXXXXXXXXXXXXXXSV 72
            LW+WYL  IR G+FEEL   + KY ++L +    L +H  +                  
Sbjct: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEE------------ 61

Query: 73  NDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT----QSECY--N 126
            D   +   IL +S+   +  D  +++ FL D F   DL NI I ++      SE +  +
Sbjct: 62  -DANISDGNILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKD 120

Query: 127 HENHYLLTDKVN 138
           HE +Y++ D +N
Sbjct: 121 HETYYMVIDSLN 132

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 57/79 (72%)

Query: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532
           G  R VLQS + ++  T E+ TAIRQS+ +  +A  +D+WLLYDS F+++NL+I TLQD+
Sbjct: 293 GQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSLNNLEISTLQDI 352

Query: 533 LDSNRTFPKILFYSMVIVN 551
           L  N   P+ILFY+M +V+
Sbjct: 353 LYPNYENPRILFYTMSVVS 371

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 62/134 (46%), Gaps = 19/134 (14%)

Query: 14  DDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXXXXXXXXXXXXSVN 73
           DDN + SWYLRN+R G FE +  ++ K   L   L+   +                   N
Sbjct: 9   DDNEVLSWYLRNLREGRFENIIEDRAKNYHLNTILDRQLFD------------------N 50

Query: 74  DIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLTQSECYNHENHYLL 133
                  KIL VS    +   +S+ ++FL   F  E L+ I++ +L   +  N E HY L
Sbjct: 51  KQYGATNKIL-VSTLTSIDEIVSIKDIFLGQLFDHERLQYIEVEELKSLKGDNKETHYFL 109

Query: 134 TDKVNNFDDPMFLE 147
           TD +N+F+D +  E
Sbjct: 110 TDHLNSFNDLLLEE 123

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 56/81 (69%)

Query: 475 FRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDLLD 534
           FR+VLQS L+ +     I TA+RQ NN P IA+ +DD LLYD+K ++   +IL+L DL++
Sbjct: 249 FRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRILSLVDLME 308

Query: 535 SNRTFPKILFYSMVIVNESSP 555
            NR  PK+LFYS+  +  SSP
Sbjct: 309 LNRAHPKMLFYSVAEIFNSSP 329

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 43/90 (47%), Gaps = 20/90 (22%)

Query: 14  DDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSXXXXXXXXXXXXXXXXSVN 73
           D +GLWSWYL N+R G FE+L G++ +Y+ LK FL   F                     
Sbjct: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQE-------------- 49

Query: 74  DIKPTVKKILLVSIPDKVHSDISLLELFLR 103
                 +++ L+S P  V  D  +LE F+R
Sbjct: 50  ------RRLQLLSFPASVPCDYKILEEFIR 73

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 9/67 (13%)

Query: 491 EIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDLLDSNRTFPKILFYS---M 547
           + FTAI++ N       +   WL++DS F  +  Q+++   LL+  ++F KI FYS    
Sbjct: 581 DFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIAKSFSKIFFYSYNNT 634

Query: 548 VIVNESS 554
           V+ NE+S
Sbjct: 635 VVKNETS 641

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}
          
          Length = 324

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 14 DDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHF 52
          + N  W WY+ N+  G+FEEL  N +K   L  FL  +F
Sbjct: 16 ESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYF 54

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 33/53 (62%), Gaps = 8/53 (15%)

Query: 481 STLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDLL 533
           S L ++  + +++ A+RQ  +        DDW++YD+ F+++NL+   L+D+L
Sbjct: 263 SLLGKDDASGKLWHAVRQLQD--------DDWVIYDADFSLNNLENCKLEDIL 307

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,757,907
Number of extensions: 3780979
Number of successful extensions: 17409
Number of sequences better than 10.0: 345
Number of HSP's gapped: 18257
Number of HSP's successfully gapped: 422
Length of query: 757
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 640
Effective length of database: 40,065,477
Effective search space: 25641905280
Effective search space used: 25641905280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)