Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0C010605.528ON63763724370.0
NCAS0H025605.528ON5874166202e-71
Suva_13.1555.528ON6453744336e-45
Smik_13.1445.528ON6393794283e-44
Kpol_1023.975.528ON5913664193e-43
KNAG0B036805.528ON4823353967e-41
ZYRO0D12584g5.528ON5793453867e-39
TDEL0A039205.528ON4661743295e-32
CAGL0H04631g5.528ON588643336e-32
YML007W (YAP1)5.528ON650633222e-30
Skud_13.1475.528ON6651173179e-30
SAKL0G04950g5.528ON567663132e-29
Kwal_47.186315.528ON584673113e-29
KLTH0G03784g5.528ON569643071e-28
KLLA0A01760g5.528ON583633016e-28
TBLA0G009305.528ON608662751e-24
TPHA0K005205.528ON560992688e-24
Kpol_1004.225.528ON475672622e-23
TPHA0D023405.528ON506632472e-21
KAFR0C054005.528ON481882293e-19
TBLA0D016405.528ON599591922e-14
NCAS0F011005.528ON475791813e-13
Ecym_40645.528ON426781681e-11
ADR195C5.528ON288851443e-09
NDAI0H016105.528ON519771465e-09
CAGL0F03069g5.528ON486741465e-09
YDR423C (CAD1)5.528ON409571412e-08
Smik_4.6985.528ON393531279e-07
Suva_2.600singletonOFF3821181232e-06
KNAG0C032105.528ON384701152e-05
KAFR0E032905.528ON265871053e-04
CAGL0E02321g6.42ON704111920.018
YPR199C (ARR1)na 1ON29446751.5
CAGL0M10087g2.493ON36860741.9
SAKL0E02420g2.493ON32270706.3
NOTE: 1 genes in the same pillar as NDAI0C01060 were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0C01060
         (637 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...   943   0.0  
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...   243   2e-71
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...   171   6e-45
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...   169   3e-44
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...   166   3e-43
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...   157   7e-41
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...   153   7e-39
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...   131   5e-32
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...   132   6e-32
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...   128   2e-30
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...   126   9e-30
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   125   2e-29
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...   124   3e-29
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...   122   1e-28
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...   120   6e-28
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...   110   1e-24
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....   107   8e-24
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...   105   2e-23
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...   100   2e-21
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...    93   3e-19
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    79   2e-14
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    74   3e-13
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    69   1e-11
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    60   3e-09
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    61   5e-09
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    61   5e-09
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    59   2e-08
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    54   9e-07
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    52   2e-06
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    49   2e-05
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    45   3e-04
CAGL0E02321g Chr5 (222703..224817) [2115 bp, 704 aa] {ON} simila...    40   0.018
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    33   1.5  
CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} som...    33   1.9  
SAKL0E02420g Chr5 complement(192871..193839) [969 bp, 322 aa] {O...    32   6.3  

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/637 (77%), Positives = 493/637 (77%)

Query: 1   MTTVGTTTGKRQLDLIDXXXXXXXXFETQNANNTRPKDSTENATTNPMKKQDLDNKTNTE 60
           MTTVGTTTGKRQLDLID        FETQNANNTRPKDSTENATTNPMKKQDLDNKTNTE
Sbjct: 1   MTTVGTTTGKRQLDLIDQQQQQQQQFETQNANNTRPKDSTENATTNPMKKQDLDNKTNTE 60

Query: 61  QSNGNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIES 120
           QSNGNSKKKQLLDPEARNKRTAQNRAAQRAF              VANLTKIQKQNEIES
Sbjct: 61  QSNGNSKKKQLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEIES 120

Query: 121 EFLRSQLITLVNELKKYKPNNENASKVXXXXXXXXXXXXXXXXXXXKFSPMESDASAMKX 180
           EFLRSQLITLVNELKKYKPNNENASKV                   KFSPMESDASAMK 
Sbjct: 121 EFLRSQLITLVNELKKYKPNNENASKVLNYISNSNSNSNPDLNLNSKFSPMESDASAMKR 180

Query: 181 XXXXXXXXXXXXXXMTSMDAPSMSTTTSVQSNPLNLKPHNNMTLNDILPPATTVASTSTL 240
                         MTSMDAPSMSTTTSVQSNPLNLKPHNNMTLNDILPPATTVASTSTL
Sbjct: 181 STGSVSSGDSNSRTMTSMDAPSMSTTTSVQSNPLNLKPHNNMTLNDILPPATTVASTSTL 240

Query: 241 DANPSSTLFDSLLANDDLFTQQLMSFXXXXXXXXXXXDSVTTLDNSXXXXXXXXXXXXXX 300
           DANPSSTLFDSLLANDDLFTQQLMSF           DSVTTLDNS              
Sbjct: 241 DANPSSTLFDSLLANDDLFTQQLMSFANNANNNNNNNDSVTTLDNSNTQQQNLQQPQITP 300

Query: 301 XXEDSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNKS 360
             EDSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNKS
Sbjct: 301 PIEDSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNKS 360

Query: 361 PISPLNDSTLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGIXXXXXXXXXXXXXXIVPT 420
           PISPLNDSTLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGI              IVPT
Sbjct: 361 PISPLNDSTLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGIPSASPNSNDSSPNNIVPT 420

Query: 421 QDNSNVNMNFGQLGFMMDSPQFQNIDLSLPIENDKFSASNFKKPSLPFINPTLAFPXXXX 480
           QDNSNVNMNFGQLGFMMDSPQFQNIDLSLPIENDKFSASNFKKPSLPFINPTLAFP    
Sbjct: 421 QDNSNVNMNFGQLGFMMDSPQFQNIDLSLPIENDKFSASNFKKPSLPFINPTLAFPNDDL 480

Query: 481 XXXXXXXXXXXXXXXXXXXESDLLSQFLANDYSNTISTNNLMNSXXXXXXXXXXYEKKLV 540
                              ESDLLSQFLANDYSNTISTNNLMNS          YEKKLV
Sbjct: 481 FNKNNSNNDNNNNTTTTHDESDLLSQFLANDYSNTISTNNLMNSDDDEDEDDDDYEKKLV 540

Query: 541 ANNLINEEPXXXXXXXXXXXXXXEQENNDFDDFIVPSRDGGLLRCSEIWDRITAHPKYSE 600
           ANNLINEEP              EQENNDFDDFIVPSRDGGLLRCSEIWDRITAHPKYSE
Sbjct: 541 ANNLINEEPSSTNKNNNLTSTSKEQENNDFDDFIVPSRDGGLLRCSEIWDRITAHPKYSE 600

Query: 601 LDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKHMS 637
           LDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKHMS
Sbjct: 601 LDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKHMS 637

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score =  243 bits (620), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 172/416 (41%), Positives = 212/416 (50%), Gaps = 66/416 (15%)

Query: 237 TSTLDANPSSTLFDSLLANDDLFTQQLMSFXXXXXXXXXXXDSVTTLDNSXXXXXXXXXX 296
           T T +   S   FD++  NDDLF QQL+S              ++   N+          
Sbjct: 223 TGTTNNKTSLEWFDNMFNNDDLFNQQLLS--------------LSNTANANKNTTTTATN 268

Query: 297 XXXXXXEDSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNS 356
                 +D NLI+N+FD  DKFDEQVSDFCGKM+MACGTR +P+PKSKSN STPQ+  +S
Sbjct: 269 TSLLQLDDPNLITNNFDVTDKFDEQVSDFCGKMNMACGTRYDPVPKSKSNTSTPQNNNSS 328

Query: 357 NNKSPISPLNDSTLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGIXXXXXXXXXXXXXX 416
                             +   SN+F+   NTP   N N+TNT+                
Sbjct: 329 LLSP--------PSNSKQIANQSNLFNL--NTPP--NLNITNTFDFNS------------ 364

Query: 417 IVPTQDNSNVNMNFGQLGFMMDSPQFQNIDLSLPIEND-------KFSASNFKKPSLPFI 469
             P       N  FGQLG M +SPQF +    LP EN        +   ++ K P+LPFI
Sbjct: 365 --PLDSPQQQNQAFGQLG-MPNSPQFLSA-FELPTENSIQKQPQQQQPMASKKSPTLPFI 420

Query: 470 NPTLAFPXXXXXXXXXXXXXXXXXXXX--XXXESDLLSQFLANDYSNTISTNNLMNSXXX 527
           N +LAFP                          S LLS F+ N+  N   ++N  +S   
Sbjct: 421 NSSLAFPTDDIFNNTISNNNNNSNTNGPLFNESSSLLSDFIRNEDGNVSDSDNDADSDF- 479

Query: 528 XXXXXXXYEKKLVANNLINEE------PXXXXXXXXXXXXXXEQENNDFDDFIVPSRDGG 581
                   +  L+  NLIN+E                       E+ D D+FIVPSRDGG
Sbjct: 480 --------DNDLINKNLINQEISNPVLAPAPTSVPASTAATAAPEDEDDDEFIVPSRDGG 531

Query: 582 LLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKHMS 637
           LLRCSEIWDRI+AHPKYS+LDIDGLCSELMTKAKCSERGVVVNAEDVQ+ALTKHMS
Sbjct: 532 LLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALTKHMS 587

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 85/144 (59%), Gaps = 6/144 (4%)

Query: 4   VGTTTGKRQLDLIDXXXXXXXXFETQNANNTRPKDSTENATTNPMKKQDLDNKTNTEQSN 63
           + TTT KR L+L           + Q     R   STE+A +   KKQ++   +N   + 
Sbjct: 1   MSTTTAKRPLELDPNSRLQFAQSKEQQQELER--YSTEDAGSR--KKQEVSGTSNAAATT 56

Query: 64  GNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFL 123
             +KK+  LD EA+NKRTAQNRAAQRAF              V NLTKIQKQNEIESEFL
Sbjct: 57  NMTKKQ--LDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVNNLTKIQKQNEIESEFL 114

Query: 124 RSQLITLVNELKKYKPNNENASKV 147
           R QLITLVNELKKY+  N N SKV
Sbjct: 115 RGQLITLVNELKKYRDPNPNESKV 138

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score =  171 bits (433), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 132/374 (35%), Positives = 176/374 (47%), Gaps = 54/374 (14%)

Query: 304 DSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSN-----VSTPQSIMNSNN 358
           DSN+ SN F+F ++FDEQVS+FC KM+ ACGT+  PIPK   +     V    S++++N 
Sbjct: 284 DSNMFSNDFNFENQFDEQVSEFCSKMNQACGTKQCPIPKKSVHQLDKEVFASSSVLSAN- 342

Query: 359 KSPISPLNDSTLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGIXXXXXXXXXXXXXXIV 418
            SP+  L ++  + SNV T         NTP  I +N +++                   
Sbjct: 343 -SPV--LTNTWDSHSNVTT---------NTPANITTNGSSSSSFGQPGFDLNTNHYATND 390

Query: 419 PTQDNSNVNM--NFGQ-LGFMMDSP----QFQNIDLSLPIENDKFSASNFKKPSL----- 466
              DNS+ N   N+   L F+ +SP    Q  N            + +N   PSL     
Sbjct: 391 KYTDNSDNNKTNNYNDILPFISESPFDMNQVTNFFSPGTNNTTNANTTNSHNPSLQQSTK 450

Query: 467 ---PFINPTLAFPXXXXXXXXXXXXXXXXXXXXXXXE----------SDLLSQFLANDYS 513
              PFIN +LAFP                       +          ++L  +FL  D  
Sbjct: 451 DDIPFINTSLAFPDDNPTNIQLQPLSQSQHQNKFDYDMFFRDSSKEGNNLFEEFLEEDDD 510

Query: 514 NTISTNNLMNSXXXXXXXXXXYEKKLVANNLINEEPXXXXXXX-----------XXXXXX 562
           +     N  N            E  L+ N LINEEP                        
Sbjct: 511 DDDDDGNDGNDNDGEAVNASDDESNLIKNKLINEEPQQQSQCHLSTPKNGSEVLQNKNSS 570

Query: 563 XEQENNDFDDFIVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVV 622
             ++ ND D+ +VPS++G LLRCSEIWDRIT HPKYS++D+DGLCSELM KAKCSERGVV
Sbjct: 571 NSEDVNDNDNEVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVV 630

Query: 623 VNAEDVQMALTKHM 636
           +NAEDVQ+AL KHM
Sbjct: 631 INAEDVQLALNKHM 644

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 54/80 (67%)

Query: 68  KKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQL 127
           KKQ LDPE + KRTAQNRAAQRAF              V +L  IQ++NE+E+ FLR QL
Sbjct: 58  KKQDLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQENEVEATFLRDQL 117

Query: 128 ITLVNELKKYKPNNENASKV 147
           +TLV+ELKKY+P   N SKV
Sbjct: 118 VTLVSELKKYRPETRNDSKV 137

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score =  169 bits (428), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 132/379 (34%), Positives = 171/379 (45%), Gaps = 65/379 (17%)

Query: 304 DSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNKSPIS 363
           DSNL SN F+F ++FDEQVS+FC KM+  CGTR  PIPK                  P+S
Sbjct: 279 DSNLFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKK-----------------PVS 321

Query: 364 PLNDSTLAKSNVITT-----SNIFDHQSN----TPQAINSNLTNT-----------WGIX 403
            L+    A S++++      +N ++  SN    TP  +  N T+            +G+ 
Sbjct: 322 TLDKEVFASSSILSANSPSLTNTWESHSNITVNTPANVIGNDTSIDTSFSSFGQLGFGVA 381

Query: 404 XXXXXXXXXXXXXIV-PTQDNSNVNMNFGQLGFMMDSP----QFQNIDLSLP---IENDK 455
                               N N   N   L F+ +SP    Q  N     P   I N  
Sbjct: 382 ANHHDVNNDNTSSTGNKNGSNKNSTNNDDVLPFISESPFDMDQVTNFFCPGPTNTINNVA 441

Query: 456 FSA-SNF---KKPSLPFINPTLAFPXXXXXXXXXXXXXXXXXXXXXXXESDLLSQFLAND 511
            SA SNF    K  +PFIN  LAFP                       + D+  +  + +
Sbjct: 442 ASANSNFLQNSKDDIPFINANLAFPDENSTNIQLQPISESQSQNKF--DYDMFFRDSSKE 499

Query: 512 YSNTISTNNLMNSXXXXXXXXXXY-----EKKLVANNLINEEPXXXXXXXXXXXXXXE-- 564
            +N        +           Y     E  L+ N LINEEP              +  
Sbjct: 500 GNNLFEEFLEEDDDDDDDGNKKAYNTSDDESSLIKNQLINEEPQSTLKNESESAQRKDSY 559

Query: 565 -QE------NNDFDDFIVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCS 617
            QE       N  D+ +VPS++G LLRCSEIWDRIT HPKYS++D+DGLCSELM KAKCS
Sbjct: 560 VQEAIDNNNGNGNDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCS 619

Query: 618 ERGVVVNAEDVQMALTKHM 636
           ERGVV+NAEDVQ+AL KHM
Sbjct: 620 ERGVVINAEDVQLALNKHM 638

 Score = 96.3 bits (238), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 80/145 (55%), Gaps = 9/145 (6%)

Query: 4   VGTTTGKRQLDLIDXXXXXXXXFETQNANNTRPK-DSTENATTNPMKKQDLDNKTNTEQS 62
           +  +T KR LDL+               ++++P  +  EN  T+   + + DN+    + 
Sbjct: 1   MSVSTAKRSLDLVSSGSLAEF-------DDSKPHHEEIENEHTSNGTRDNDDNEQPKRKG 53

Query: 63  NGNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEF 122
              SKK Q LDPE + KRTAQNRAAQRAF              V +L  IQ+QNE+E+ F
Sbjct: 54  TKTSKK-QDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATF 112

Query: 123 LRSQLITLVNELKKYKPNNENASKV 147
           LR QL+TLVNELKKY+P   N SKV
Sbjct: 113 LRDQLVTLVNELKKYRPETRNDSKV 137

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score =  166 bits (419), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 124/366 (33%), Positives = 178/366 (48%), Gaps = 91/366 (24%)

Query: 304 DSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPK--SKSNVS--TPQSIMNSNNK 359
           DS+L SN F+F+D FD+QVS FC KM+ ACGT+ NP+PK  ++SN S  TP S  N +  
Sbjct: 285 DSDLFSNDFNFDDHFDQQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPST- 343

Query: 360 SPISPLNDSTLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGIXXXXXXXXXXXXXXIVP 419
           +P    NDS+L+ +     + +FD  SN       + TNT  I                P
Sbjct: 344 TPNESSNDSSLSIAKFDDPNFLFDSPSN-------DFTNTLDI----------------P 380

Query: 420 TQDNSNVNMNFGQLGF--MMDSPQFQNID------LSL-------------------PIE 452
           + D+SN N NFGQLGF  + +   F + D      +SL                   PI 
Sbjct: 381 SVDSSNANSNFGQLGFHGLSNDITFNSNDSNWNDFISLKTDSMTSVPTTSSVATNDHPIN 440

Query: 453 NDKFSASNF-KKPSLPFINPTLAFPXXXXXXXXXXXXXXXXXXXXXXXESDLLSQFLAND 511
             K S  N  +K  LPFI+ ++AFP                              F  + 
Sbjct: 441 ISKPSEENSPRKEVLPFIDTSIAFPETKADFDAFDNQMF----------------FRDDG 484

Query: 512 YSNTISTNNLMNSXXXXXXXXXXYEKKLVANNLINEEPXXXXXXXXXXXXXXEQENNDFD 571
           ++ +++ ++ +             +  L++ NL+ EE                       
Sbjct: 485 FNESLNISDDIVGAESDDEQDNNNDNDLISKNLVCEEVKEH------------------- 525

Query: 572 DFIVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMA 631
           D ++P+ DG LL+CSE+WDRITAHP+YS++DIDGLC ELM  AKCS++GVVV+++DVQ A
Sbjct: 526 DMVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAKCSDKGVVVDSKDVQKA 585

Query: 632 LTKHMS 637
           L+ HMS
Sbjct: 586 LSNHMS 591

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (62%), Gaps = 3/89 (3%)

Query: 62  SNGNSKK---KQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEI 118
           +N N KK   K L D E +NKRTAQNRAAQRAF              V  L K+++QN++
Sbjct: 39  ANANKKKVGRKLLGDHEVKNKRTAQNRAAQRAFRERKERKMKELEDKVHELEKVKQQNDV 98

Query: 119 ESEFLRSQLITLVNELKKYKPNNENASKV 147
           ESEFLR+QL  +++ELKKY+P   +  KV
Sbjct: 99  ESEFLRNQLTLMIDELKKYRPEKSSDIKV 127

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score =  157 bits (396), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 116/335 (34%), Positives = 153/335 (45%), Gaps = 76/335 (22%)

Query: 303 EDSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNKSPI 362
           +DS  +SN   F+ +FDEQVSDFC +M+ ACG+++NP+PKSK       S+ +++  SP 
Sbjct: 224 DDSLTVSNEITFDTQFDEQVSDFCVRMNEACGSKTNPVPKSKKG-----SVFSNSVLSPP 278

Query: 363 SPLNDSTLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGIXXXXXXXXXXXXXXIVPTQD 422
           S LN                            +L+NTWG                     
Sbjct: 279 SLLN----------------------------SLSNTWGTDRTDAGSATSETTS------ 304

Query: 423 NSNVNMNFGQLGFMMDSPQFQNIDLSLPIENDKFSASNFKKPSLPFINPTLAFPXXXXXX 482
                    +L     S    N DL L         ++F+   +PFIN +LAFP      
Sbjct: 305 --------PRLTESSSSTVTTNNDLKL--------DADFE---IPFINTSLAFPTDDGAV 345

Query: 483 XXXXXXXXXXXXXXXXXESDLLSQFLANDYSNTISTNNLMNSXXXXXXXXXXYEKKLVAN 542
                             S L      +D+        L             +E+K+  N
Sbjct: 346 PQTVDDNIFFRDTQHEQRSAL------DDF--------LEEEELTDNQQQQQHEEKI--N 389

Query: 543 NLINEEPXXXXXXXXXXXXXXEQENNDFDDFIVPSRDGGLLRCSEIWDRITAHPKYSELD 602
            LINE P               + N D D  +VPS+DG LL+CSEIWDRITAHPKYS+LD
Sbjct: 390 LLINEVPFSIEADKEVPFSI--EPNEDGDPQVVPSKDGKLLKCSEIWDRITAHPKYSDLD 447

Query: 603 IDGLCSELMTKAKCSERGVVVNAEDVQMALTKHMS 637
           IDGLC ELMTKAKCSERGVVVNA+DV+ AL +H++
Sbjct: 448 IDGLCGELMTKAKCSERGVVVNADDVKDALNRHIA 482

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/76 (61%), Positives = 52/76 (68%)

Query: 72  LDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQLITLV 131
           LD EAR KRT QNRAAQRAF              V  LT+IQKQNE+ESEFLR QL+TLV
Sbjct: 45  LDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTRIQKQNEVESEFLRGQLVTLV 104

Query: 132 NELKKYKPNNENASKV 147
           +ELKKY+P   N SKV
Sbjct: 105 HELKKYRPETSNDSKV 120

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score =  153 bits (386), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 115/345 (33%), Positives = 153/345 (44%), Gaps = 92/345 (26%)

Query: 304 DSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIP-KSKSNVSTPQSIMNSNNKSPI 362
           DS   SN F+FNDKFDEQVS+FC K+   CGT+  PIP K KS+ S+P          P 
Sbjct: 306 DSVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSP--------AVPK 357

Query: 363 SPLNDSTLAKSNVITTSNIFDHQSNTPQ----AINSNLTNTWGIXXXXXXXXXXXXXXIV 418
           SP           I  SN +D  S  PQ     +  NL++                  I 
Sbjct: 358 SP-----------IVFSNTWDTPSEDPQQQLPTLEENLSDP----------------SIR 390

Query: 419 PTQDNSNVNMNFGQ---LGFMMDSPQFQNIDLSLPIENDKFSASNFKKPSLPFINPTLAF 475
            T   SN +   G    +   M+SP+                    K   LPFI+ +LAF
Sbjct: 391 QTNAYSNTDGGDGDDEGIVVSMNSPE--------------------KNSELPFIDTSLAF 430

Query: 476 PXXXXXXXXXXXXXXXXXXXXXXXESDLLSQFLANDYSNTISTNNLMNSXXXXXXXXXXY 535
           P                         ++ ++F+ +D     +  N  N+           
Sbjct: 431 PEEQDLFREQQP-------------DNMFAEFIEHDPQRDTTNGNEGNTSPD-------- 469

Query: 536 EKKLVANNLINEEPXXXXXXXXXXXXXXEQENNDFD--------DFIVPSRDGGLLRCSE 587
           + + +A+ ++ EEP               ++    D        D +VPS DG LL+CSE
Sbjct: 470 QDEFLASGMVQEEPAVTTGEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSE 529

Query: 588 IWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMAL 632
           +WDRIT+HPKYS++DIDGLC ELM KAKCSERGVVV AEDVQ AL
Sbjct: 530 VWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYAL 574

 Score = 82.8 bits (203), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 55/84 (65%)

Query: 64  GNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFL 123
           G    ++ LD EA++KRTAQNRAAQRAF              V  L ++ +Q+ +E+EFL
Sbjct: 36  GGKPGRKPLDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVHALEELNQQSLVETEFL 95

Query: 124 RSQLITLVNELKKYKPNNENASKV 147
           RSQL+TLV ELK+Y+P N N S+V
Sbjct: 96  RSQLVTLVTELKRYRPENPNDSQV 119

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score =  131 bits (329), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 91/174 (52%), Gaps = 35/174 (20%)

Query: 463 KPSLPFINPTLAFPXXXXXXXXXXXXXXXXXXXXXXXESDLLSQFLANDYSNTISTNNLM 522
           +P LPFI+PT+AFP                       E+ L ++ L ++   T   NN +
Sbjct: 326 QPELPFIDPTMAFPTDDDEGLFFRTHRD---------ENSLFAELL-DEVEPT--DNNFV 373

Query: 523 NSXXXXXXXXXXYEKKLVANNLINEEPXXXXXXXXXXXXXXEQENNDFDDFIVPSRDGGL 582
           N                   NLINEEP              + E +     +VPSRDG L
Sbjct: 374 N------------------ENLINEEPSTTTAVAEETRPKPKTETD-----VVPSRDGKL 410

Query: 583 LRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKHM 636
           L+CSE+WDRIT HPKYS +DIDGLC ELMTKAKCSE+GVVV AEDVQ  L KHM
Sbjct: 411 LKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464

 Score = 79.3 bits (194), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 53/86 (61%)

Query: 62  SNGNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESE 121
           + G+   ++ LD E +NKRTAQNRAAQRAF              V +L +  +   +ESE
Sbjct: 44  AKGSKPGRKPLDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQANRDTVVESE 103

Query: 122 FLRSQLITLVNELKKYKPNNENASKV 147
           FLRSQL+TLVNELKKY+P   N  +V
Sbjct: 104 FLRSQLLTLVNELKKYRPAKANDLQV 129

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/45 (57%), Positives = 33/45 (73%)

Query: 307 LISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQ 351
           L SN F+F+D+FDEQVS FC KM+ ACGTR  PIP     +++PQ
Sbjct: 244 LFSNEFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASPQ 288

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score =  132 bits (333), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 55/64 (85%), Positives = 61/64 (95%)

Query: 574 IVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALT 633
           +VPSRD GLLRCSEIWDRITAHPKYS++DIDGLCSELM KAKCSERGVV+NA+DVQ+AL 
Sbjct: 525 VVPSRDDGLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSERGVVINADDVQVALN 584

Query: 634 KHMS 637
           KHMS
Sbjct: 585 KHMS 588

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 53/96 (55%)

Query: 52  DLDNKTNTEQSNGNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTK 111
           ++DN    + S    K+ Q LDPE R KR AQNRAAQ+AF              V +L  
Sbjct: 3   EVDNGGAQKSSASRKKRYQELDPETRMKRVAQNRAAQKAFRERKERKMKELERKVVDLEN 62

Query: 112 IQKQNEIESEFLRSQLITLVNELKKYKPNNENASKV 147
           + K NE+E+ FLR QL  LV EL+KY+P  +   KV
Sbjct: 63  LTKLNEVETNFLRDQLSILVKELRKYRPETKQDHKV 98

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 86/189 (45%), Gaps = 37/189 (19%)

Query: 311 SFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVST--PQSIMNSNNKSPISPLNDS 368
             DFN+ FDEQVS+FC K++ ACGT++ PIP+SKS  +T  P +  N N+ SP+  +ND 
Sbjct: 238 GIDFNNFFDEQVSEFCTKLNQACGTKACPIPQSKSAATTPLPGTSSNGNSNSPMI-IND- 295

Query: 369 TLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGIXXXXXXXXXXXXXXIVPTQDNSNVNM 428
           T+   ++    N   + +N      + L+NTW                    Q ++    
Sbjct: 296 TMGDVSLNMQGNEHGNATNNLVTDPAFLSNTW------------DDMSPASNQHSTGGAP 343

Query: 429 NFGQLGF---------------------MMDSPQFQNIDLSLPIENDKFSASNFKKPSLP 467
            FGQLGF                     ++ S + Q +  S  ++      +  K  + P
Sbjct: 344 GFGQLGFGDNLLGNDILFSPNSPAYSPSVLGSGRTQEVYRSPAVQKVVEKENESKSVNFP 403

Query: 468 FINPTLAFP 476
           FIN +LAFP
Sbjct: 404 FINSSLAFP 412

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score =  128 bits (322), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 51/63 (80%), Positives = 59/63 (93%)

Query: 574 IVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALT 633
           +VPS++G LLRCSEIWDRIT HPKYS++D+DGLCSELM KAKCSERGVV+NAEDVQ+AL 
Sbjct: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 646

Query: 634 KHM 636
           KHM
Sbjct: 647 KHM 649

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/78 (58%), Positives = 52/78 (66%)

Query: 70  QLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQLIT 129
           Q LDPE + KRTAQNRAAQRAF              V +L  IQ+QNE+E+ FLR QLIT
Sbjct: 60  QDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLIT 119

Query: 130 LVNELKKYKPNNENASKV 147
           LVNELKKY+P   N SKV
Sbjct: 120 LVNELKKYRPETRNDSKV 137

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%)

Query: 304 DSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPK 342
           DSN+ SN F+F ++FDEQVS+FC KM+  CGTR  PIPK
Sbjct: 281 DSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPK 319

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score =  126 bits (317), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 76/117 (64%), Gaps = 16/117 (13%)

Query: 536 EKKLVANNLINEEPXXXXXXXXXXXXXXEQ----------------ENNDFDDFIVPSRD 579
           E  L+ N LINEEP              ++                + ND D+ +VPS++
Sbjct: 548 ESSLIRNQLINEEPQPLNQNSLSSLNNEKETSPKTNSGGTQNANDSDGNDNDNDVVPSKE 607

Query: 580 GGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKHM 636
           G LLRCSEIWDRIT HPKYS++D+DGLCSELM KAKCSERGVV+NAEDVQ+AL KHM
Sbjct: 608 GSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 664

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 77/144 (53%), Gaps = 7/144 (4%)

Query: 4   VGTTTGKRQLDLIDXXXXXXXXFETQNANNTRPKDSTENATTNPMKKQDLDNKTNTEQSN 63
           +  +T KR LDL          F+   A++    D  EN   +   + D DN+   ++  
Sbjct: 1   MSVSTAKRSLDL--ASPGSLAEFDDSAAHH----DEIENEHRHDSTRDDDDNE-QPKKKG 53

Query: 64  GNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFL 123
               KKQ LDPE + KRTAQNRAAQRAF              V  L  IQ+QNE+E+ FL
Sbjct: 54  TKISKKQDLDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFL 113

Query: 124 RSQLITLVNELKKYKPNNENASKV 147
           R QL+TLVNELKKY+P   N SKV
Sbjct: 114 RDQLVTLVNELKKYRPETRNDSKV 137

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 63/134 (47%), Gaps = 36/134 (26%)

Query: 304 DSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNKSPIS 363
           DSN+ SN+F+F ++FDEQVS+FC KM+  CGTR  PIP                 K P+S
Sbjct: 276 DSNMFSNNFNFENQFDEQVSEFCSKMNQVCGTRQCPIP-----------------KKPVS 318

Query: 364 PLNDSTLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGIXXXXXXXXXXXXXXIVPTQDN 423
            L+    A S++++        +N+P      LTNTW                 + T D 
Sbjct: 319 TLDQEVFASSSILS--------ANSPA-----LTNTW----ESHSNITANTPANITTNDT 361

Query: 424 SNVNMNFGQLGFMM 437
           S     FGQLGF +
Sbjct: 362 S--LSGFGQLGFEL 373

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%)

Query: 572 DFIVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMA 631
           D +VPSRDG LL+C EIWDRIT+HPKYS+LDIDGLC EL TKAKCSE+GVVVNA+DVQ A
Sbjct: 502 DDVVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKA 561

Query: 632 LTKHMS 637
           L KHMS
Sbjct: 562 LAKHMS 567

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (62%), Gaps = 5/97 (5%)

Query: 48  MKKQDLDNKTNTEQSNGNSK-----KKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXX 102
           + K+ LDN+   +     +K      ++ L  EA+NKRTAQNRAAQRAF           
Sbjct: 25  VHKRPLDNEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQRAFRERKERKMKEL 84

Query: 103 XXXVANLTKIQKQNEIESEFLRSQLITLVNELKKYKP 139
              V +L  +++QNE+E+EFLRSQL+TL++ELKKY+P
Sbjct: 85  EDKVTHLETVREQNEVETEFLRSQLMTLISELKKYRP 121

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/39 (58%), Positives = 31/39 (79%)

Query: 308 ISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSN 346
           I+N FDF   FDEQVS+FC +M+ ACGTR +P+P++ SN
Sbjct: 264 ITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVPQTLSN 302

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score =  124 bits (311), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 61/67 (91%)

Query: 571 DDFIVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQM 630
           +D +VP+RDG LL+CSE+WDRIT+HPKYS++DIDGLC EL TKAKCSE+GVVVN +DVQ 
Sbjct: 518 EDAVVPARDGTLLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKGVVVNIDDVQR 577

Query: 631 ALTKHMS 637
           ALTKHMS
Sbjct: 578 ALTKHMS 584

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 63/101 (62%), Gaps = 3/101 (2%)

Query: 50  KQDLDNKTNTEQ---SNGNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXV 106
           K++L+  T  E+     G+   ++ LD EA+NKRTAQNRAAQRAF              V
Sbjct: 5   KRELETPTAAEELHKRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQV 64

Query: 107 ANLTKIQKQNEIESEFLRSQLITLVNELKKYKPNNENASKV 147
             L ++++Q+E+ESEFLRSQL  L+ E++KY+P   + S+V
Sbjct: 65  ERLERVREQSELESEFLRSQLQKLLAEIQKYRPRQSSDSQV 105

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 67/170 (39%), Gaps = 40/170 (23%)

Query: 312 FDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNKSPISPLNDS-TL 370
           FDFN  FDEQVS+FC +M+  CGTR  P+    +    P + M     S   P  DS T 
Sbjct: 281 FDFNSHFDEQVSEFCTRMNEVCGTRECPV----APALPPSTAMAHTTPSSAQPQPDSLTR 336

Query: 371 AKSNVITTSNIFDHQSNTPQAINSNLTNTWGIXXXXXXXXXXXXXXIVPTQDNSNVNMNF 430
             S  ++  ++ +  S  PQA +S     W                             F
Sbjct: 337 RPSQELSEKHLQNQLS--PQAASS----VWDTP-------------------------QF 365

Query: 431 GQLGFMMD----SPQFQNIDLSLPIENDKFSASNFKKPSLPFINPTLAFP 476
           G  GF  D    + ++     +   E      ++    SLPFI+ ++AFP
Sbjct: 366 GHSGFGSDLEDPTNRWMFAGFNAATEGGVIRTTSATADSLPFIDTSMAFP 415

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score =  122 bits (307), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 51/64 (79%), Positives = 59/64 (92%)

Query: 574 IVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALT 633
           +VP+RDG LL+CSEIWDRITAHPKYS++DIDGLC EL TKAKCSE+GVVVN++DVQ AL 
Sbjct: 506 VVPARDGLLLKCSEIWDRITAHPKYSDIDIDGLCMELRTKAKCSEKGVVVNSDDVQSALA 565

Query: 634 KHMS 637
           KHMS
Sbjct: 566 KHMS 569

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 55/84 (65%)

Query: 64  GNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFL 123
           G+   ++ LD EA+NKRTAQNRAAQRAF              V  L K+++Q+E+ESEFL
Sbjct: 22  GSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEKVREQSEMESEFL 81

Query: 124 RSQLITLVNELKKYKPNNENASKV 147
           RSQL  L+ E++KY+P   + S+V
Sbjct: 82  RSQLQMLIAEIQKYRPQQSSDSQV 105

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 5/56 (8%)

Query: 312 FDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNKSPISPLND 367
           FDFN  FDEQVS FC +M+  CGTR  P+P+     + P S   S    PISP+ +
Sbjct: 269 FDFNTHFDEQVSVFCTQMNEVCGTRECPLPQ-----ALPPSTAASVTPRPISPIQE 319

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score =  120 bits (301), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (88%)

Query: 574 IVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALT 633
           I+PS DG LL+CSE+WDRITAHP+YS+LDIDGLC EL TKAKCSE+GVVVNAEDVQ AL 
Sbjct: 520 IIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALI 579

Query: 634 KHM 636
            HM
Sbjct: 580 SHM 582

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 63/111 (56%), Gaps = 8/111 (7%)

Query: 35  RPKDSTENATTNPMKKQDLDNKTNTEQSNGNSKKKQL------LDPEARNKRTAQNRAAQ 88
           RP D+    +  P    D D+  N   S+  SK+++       L+ EA++KRTAQNRAAQ
Sbjct: 8   RPFDNKRAGS--PDDGTDSDSGGNNSGSSPASKRRERKPGRKPLETEAKDKRTAQNRAAQ 65

Query: 89  RAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQLITLVNELKKYKP 139
           RAF              V+ L  + KQ+E+E++FLR+Q+  L++ELK+Y P
Sbjct: 66  RAFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQVTNLLSELKRYNP 116

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 91/234 (38%), Gaps = 91/234 (38%)

Query: 308 ISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQS--------------- 352
           +++ FDF+ +FDE VS FC K+SMACGT+SNPIPK+ S VSTP S               
Sbjct: 247 VTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKA-SPVSTPSSSDLLKPKSNSNVNIT 305

Query: 353 -----IMNSNNKSPISPLNDSTLAKS-----NVITTSNIFD---------HQSNTPQAI- 392
                 +NS + S  +PL+DS  A +     +V   SN F          H   TP  + 
Sbjct: 306 NHNNNKINSKDLSSSAPLHDSASASALNNHDSVNAVSNQFSVDKQYNDSSHSQATPNGLD 365

Query: 393 NSNLTNTWGIXXXXXXXXXXXXXXIVPTQDNSNVNMNFGQLGFMMDSPQFQNIDLSLPIE 452
           N +  + W                            +FGQLGF  D     ++D + PI 
Sbjct: 366 NDSSVSAWQ-------------------------QPSFGQLGFRTDQLFDLDLDSASPIT 400

Query: 453 NDK------------------------------FSASNFKKPSLPFINPTLAFP 476
             K                                + N + P +PFI+  LAFP
Sbjct: 401 KQKDNNYSTTTNNTNSPAKADGMYWNFNTPLSNMVSRNMQNPEIPFIDTGLAFP 454

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 46/66 (69%), Positives = 56/66 (84%), Gaps = 2/66 (3%)

Query: 574 IVPSRDGG--LLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMA 631
           I+   D G   ++CSE+WDRIT+HPKYS+LDIDGLC+ELM KAKCSE+GVVV A+DVQ A
Sbjct: 543 IIREEDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKA 602

Query: 632 LTKHMS 637
           LTKH+S
Sbjct: 603 LTKHLS 608

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 53/79 (67%)

Query: 69  KQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQLI 128
           ++L D EA++KRTAQNRAAQRAF              V +L ++ K++EIES+FLR QL 
Sbjct: 42  RKLSDQEAKSKRTAQNRAAQRAFRERRERKMQELEDKVKSLEEVHKKSEIESQFLRDQLK 101

Query: 129 TLVNELKKYKPNNENASKV 147
            L+ EL++Y+P  +N +KV
Sbjct: 102 VLLGELQRYRPERQNDAKV 120

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score =  107 bits (268), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 66/99 (66%), Gaps = 7/99 (7%)

Query: 539 LVANNLINEEPXXXXXXXXXXXXXXEQENNDFDDFIVPSRDGGLLRCSEIWDRITAHPKY 598
           L+ NNL+ EE                Q  + + + ++ + DG  L+CS++W R+T HPKY
Sbjct: 468 LIKNNLVTEE-------CMDDAQAKSQLCDKYKNTVIRAEDGSYLKCSQVWSRLTEHPKY 520

Query: 599 SELDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKHMS 637
           SELDIDGLC+ELM +AKCSE+GVVV + DVQ AL+K++S
Sbjct: 521 SELDIDGLCTELMLQAKCSEKGVVVESRDVQKALSKYLS 559

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 68  KKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQL 127
           +K L D + ++KRT QNR AQRAF              V  L ++ +  E+E+ FLRS+L
Sbjct: 32  RKLLNDSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNFLRSRL 91

Query: 128 ITLVNELKKYKP 139
            ++ +ELKKY+P
Sbjct: 92  KSMADELKKYRP 103

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 21/26 (80%)

Query: 304 DSNLISNSFDFNDKFDEQVSDFCGKM 329
           DS+L SN F+F+DKF +QVS FC K+
Sbjct: 292 DSSLFSNDFNFDDKFSDQVSSFCDKV 317

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score =  105 bits (262), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 42/67 (62%), Positives = 54/67 (80%)

Query: 571 DDFIVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQM 630
           +D +VPS D  L+RCSEIWDRIT +P+Y++LDIDGLC ELM  AKCS++GVVV ++DV  
Sbjct: 409 EDVVVPSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHK 468

Query: 631 ALTKHMS 637
            L KHM+
Sbjct: 469 VLAKHMA 475

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 55/86 (63%)

Query: 62  SNGNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESE 121
           S  N  +K  +D EAR +RTAQNRAAQRAF              V +L  I ++NE+E+E
Sbjct: 29  STSNKIRKNDIDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETE 88

Query: 122 FLRSQLITLVNELKKYKPNNENASKV 147
           FLRSQ++TLVNELKKY+    + SK+
Sbjct: 89  FLRSQVLTLVNELKKYRSETTSDSKI 114

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 26/40 (65%)

Query: 304 DSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKS 343
           DS L SN F+FN++FDEQVS FC KM+     R   I K+
Sbjct: 183 DSGLFSNDFNFNNQFDEQVSTFCAKMNNNFENRKKIIKKT 222

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 51/63 (80%)

Query: 574 IVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALT 633
           IVP  DG LL C EIWDRIT +P+YS++DIDGLC ELM  AKCS++GV+V+++DVQ  L+
Sbjct: 443 IVPLTDGRLLECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKGVLVSSDDVQKVLS 502

Query: 634 KHM 636
           + +
Sbjct: 503 RRL 505

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 45/73 (61%)

Query: 66  SKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRS 125
            K K+  + + R KR AQNRAAQ+AF              V  L  I ++NEIE+ FLR+
Sbjct: 8   GKDKEQNNADYRMKRIAQNRAAQKAFRERKEKKMKELQEKVRKLENINEKNEIETVFLRT 67

Query: 126 QLITLVNELKKYK 138
           QL++LVNELKKY+
Sbjct: 68  QLLSLVNELKKYR 80

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 303 EDSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNK 359
           +DSNL S  FDF ++FDEQVS FC KM+     R   I +  +     + + NSNNK
Sbjct: 259 QDSNLFSTEFDFANEFDEQVSTFCAKMNKTFENRKEMIKQFYT-----EKVRNSNNK 310

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/88 (55%), Positives = 59/88 (67%)

Query: 60  EQSNGNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIE 119
           +++N +   +  LD EA+ KRTAQNRAAQRAF              V +L+ IQKQNEIE
Sbjct: 30  KKNNASKSSRTELDQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVDHLSNIQKQNEIE 89

Query: 120 SEFLRSQLITLVNELKKYKPNNENASKV 147
           SEFLRSQLITLV ELKKY+P   N S+V
Sbjct: 90  SEFLRSQLITLVKELKKYRPETANDSQV 117

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 58/110 (52%), Gaps = 20/110 (18%)

Query: 244 PSSTLFDSLLANDDLFTQQLMSFXXXXXXXXXXXDSVTTLDNSXXXXXXXXXXXXXXXXE 303
           PS    D++L  +DLF +QL SF           +S   +                    
Sbjct: 216 PSINWLDNMLHTEDLFNEQLSSFSNTPISRNDSNESKNPM-------------------T 256

Query: 304 DSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIP-KSKSNVSTPQS 352
           DS LISN F+F D+FDE+V+DFC KM+  CGTRSNPIP KS SN+ + +S
Sbjct: 257 DSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNLPSTES 306

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 47/59 (79%), Gaps = 1/59 (1%)

Query: 574 IVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMAL 632
           +VP+ D  +L C++IWDRITA PKY+  DI+ LC+ELM+KAKCS++GVVV++ DV   L
Sbjct: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKCSDKGVVVSSLDVDKVL 586

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 41/71 (57%)

Query: 66  SKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRS 125
           SK ++  + E ++KRTAQNRAAQRAF              V  L K+ + +E E+ FLRS
Sbjct: 22  SKVQKDSNAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEKVCRAHESETSFLRS 81

Query: 126 QLITLVNELKK 136
           QLI    EL+K
Sbjct: 82  QLILFGTELRK 92

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 22/27 (81%)

Query: 311 SFDFNDKFDEQVSDFCGKMSMACGTRS 337
           +F+F+++FDEQ+S FC K++ ACG  S
Sbjct: 355 TFNFDNQFDEQISKFCLKLNSACGNLS 381

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (64%)

Query: 69  KQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQLI 128
           ++ LD  A+N+RTAQNRAAQRAF              +++L +I+  NE+ES FLR  ++
Sbjct: 26  RKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVESTFLRDYMM 85

Query: 129 TLVNELKKYKPNNENASKV 147
            L+ +++KY+PNN   SKV
Sbjct: 86  DLICDMQKYRPNNSTDSKV 104

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 7/67 (10%)

Query: 577 SRDGGLL-----RCSEIWDRI-TAHPKYSELDIDGLCSELMTKAKCSERG-VVVNAEDVQ 629
           S DGG+      +CS IW R  T  PK+S+ DID LC EL+TKAKCS+ G +V+ + DV+
Sbjct: 409 SIDGGMACNKYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVK 468

Query: 630 MALTKHM 636
             L KH 
Sbjct: 469 NTLRKHF 475

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 49/78 (62%)

Query: 64  GNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFL 123
           GN   ++ LD EA+N+RTAQNRAAQRAF              V  L + + Q+E E + L
Sbjct: 42  GNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSEREVQSL 101

Query: 124 RSQLITLVNELKKYKPNN 141
           R+Q+++L+ ELKKY+P +
Sbjct: 102 RNQVVSLLRELKKYRPGS 119

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 45/85 (52%)

Query: 61  QSNGNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIES 120
           +  GN   ++ LD EA+N+RTAQNRAAQRAF              V  L + +   E E 
Sbjct: 23  KRRGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRLEEERSSAECEV 82

Query: 121 EFLRSQLITLVNELKKYKPNNENAS 145
           + LR  +I LV EL++++   + A 
Sbjct: 83  QSLRGHVIALVRELRRWRARQQGAG 107

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 46/77 (59%), Gaps = 14/77 (18%)

Query: 574 IVPSR-DGG----LLRCSEIWDRIT--------AHPKYSELDIDGLCSELMTKAKCSERG 620
           + PS  +GG      +CS+IW+RI         + P++ + DID LC+ELMTKA+CS  G
Sbjct: 443 VAPSCCNGGYGNRFAKCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARCSTNG 502

Query: 621 -VVVNAEDVQMALTKHM 636
            +V+   D++ +L KH 
Sbjct: 503 SIVIKTGDIKQSLMKHF 519

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 30/42 (71%)

Query: 106 VANLTKIQKQNEIESEFLRSQLITLVNELKKYKPNNENASKV 147
           +++L KI+ +N IE+ FLRS +  L+NE+ K++P N   SK+
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKI 49

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%)

Query: 69  KQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQLI 128
           ++++D EA+NKRTAQNRAAQRAF              +  L  +  +   E+E+L+  L 
Sbjct: 14  RKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLS 73

Query: 129 TLVNELKKYKPNNE 142
            L+ E+ KY+P NE
Sbjct: 74  ELLTEVTKYRPANE 87

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 582 LLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSE----------RGVVVNAEDVQMA 631
           +LRC +I   +     Y  LD + LC+ELM KAK S+          R VV+ A D+Q  
Sbjct: 420 VLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRT 479

Query: 632 LTKHMS 637
           L KH+S
Sbjct: 480 LAKHIS 485

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 581 GLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERG-VVVNAEDVQMALTKHM 636
           G   C  I + I++ PKYS LDID LCSEL+ KAKC++   +VV A D+Q AL + +
Sbjct: 352 GKASCYHILEEISSLPKYSSLDIDDLCSELIIKAKCTDDCKIVVKARDLQSALVRQL 408

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 54/100 (54%)

Query: 48  MKKQDLDNKTNTEQSNGNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVA 107
           MKKQ L NK  T +       ++ +D EA+++RTAQNRAAQRAF              V 
Sbjct: 17  MKKQMLLNKDGTPKRKVGRPGRKRIDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVE 76

Query: 108 NLTKIQKQNEIESEFLRSQLITLVNELKKYKPNNENASKV 147
            L +   QN+  ++FL   L +L++E+ KY+  N +  ++
Sbjct: 77  LLEQKDAQNKTTTDFLLCSLKSLLSEITKYRAKNSDDERI 116

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 585 CSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERG-VVVNAEDVQMALTKHM 636
           C  I   I++ PKYS LDID LC ELMTKA+ ++   +VV A D+Q  L K +
Sbjct: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%)

Query: 48  MKKQDLDNKTNTEQSNGNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVA 107
           M +Q L NK    +       ++ +D EA+N+RTAQNRAAQRAF              + 
Sbjct: 1   MSEQVLANKDGIPKRKVGRPGRKRVDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIE 60

Query: 108 NLTKIQKQNEIESEFLRSQLITLVNELKKYKPNNENASKV 147
            L +   QN+   +FL+S L +L++E+ KY+  N N  ++
Sbjct: 61  LLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERI 100

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 53/118 (44%), Gaps = 41/118 (34%)

Query: 539 LVANNLINEEPXXXXXXXXXXXXXXEQENNDFDDFIVPSR--DGGLLR------------ 584
           L+  +LIN+EP                      D I+P+    GG+L+            
Sbjct: 285 LITRHLINQEPL---------------------DSILPASAPRGGVLKLHPEPFTSKMPY 323

Query: 585 -----CSEIWDRITAHPKYSELDIDGLCSELMTKAKCS-ERGVVVNAEDVQMALTKHM 636
                CS I   I++ PK+S LDID LC ELM KAKCS +  ++V A  +Q  L + +
Sbjct: 324 NETFFCSHILRHISSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLARQL 381

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 75  EARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQLITLVNE 133
           EA+N+RTAQNRAAQ+AF                 L     Q+++ +++L+  L +L+ E
Sbjct: 11  EAKNERTAQNRAAQQAFRNRKEDKWKQLEEKTELLESRDAQSKVATDYLQGSLRSLLLE 69

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%)

Query: 69  KQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQLI 128
           ++ LD EA+NKRT QNR AQRA+              +A L ++   NE  +E + + L 
Sbjct: 20  RRKLDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIAALERLNSYNEDRAELMAAHLR 79

Query: 129 TLVNELKKYK 138
            L+ E  K++
Sbjct: 80  DLLGEANKFR 89

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 2/73 (2%)

Query: 567 NNDFDDFIVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAK--CSERGVVVN 624
           N      I   R G    C+ +   +T  P Y E D++ LC ELM K K    +  + V 
Sbjct: 311 NESLRSIIAEKRCGSNDTCAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHDASITVG 370

Query: 625 AEDVQMALTKHMS 637
            EDV+ AL +H++
Sbjct: 371 REDVRSALERHIA 383

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 9/87 (10%)

Query: 56  KTNTEQSNGNSKKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQ 115
           +T  ++  G   +K+L D +A+NKRT QNR AQRAF              V    K+Q +
Sbjct: 2   ETEVKRRVGRPGRKKL-DADAKNKRTQQNRMAQRAFRERKEAKLKLLENEV---DKLQLE 57

Query: 116 N----EIESEFLRSQLITLVNELKKYK 138
           N    EI  EFL+  ++TL+ E+K Y+
Sbjct: 58  NLSKAEI-IEFLKQNVMTLLGEIKNYR 83

>CAGL0E02321g Chr5 (222703..224817) [2115 bp, 704 aa] {ON} similar
           to uniprot|Q08108 Saccharomyces cerevisiae YOL011w PLB3
           phospholipase B
          Length = 704

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 21/111 (18%)

Query: 359 KSPISPLNDSTLAKS--NVITTSNIFDHQSNTPQA-----INSNLTNTWGIXXXXXXXXX 411
           K PI  L+DS ++    N+I T+  +DH +N  +A      N++L + WG          
Sbjct: 182 KDPIWDLSDSIVSPGGLNIIKTARRWDHITNAVKAKQEAGFNTSLADVWG---------R 232

Query: 412 XXXXXIVPTQDNSNVNMNFGQLGFMMDSPQFQNIDLSLPI--ENDKFSASN 460
                  PT +   ++  +  L    DSP FQ  D+ LPI   + ++  SN
Sbjct: 233 ALSYKFFPTLERGGIDYTWSSL---RDSPIFQAGDMPLPITVADGRYPGSN 280

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
           ARR1Transcriptional activator of the basic leucine
           zipper (bZIP) family, required for transcription of
           genes involved in resistance to arsenic compounds
          Length = 294

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 580 GG--LLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVV 623
           GG  LL   +IW  +  HPK +  D++ L +EL   A CS   +++
Sbjct: 236 GGDVLLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILI 281

>CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} some
           similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009c transcription factor
          Length = 368

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 11/60 (18%)

Query: 78  NKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQLITLVNELKKY 137
           +K+ AQNRAAQRAF               A   ++Q++   ESE  R QL+  + +L+K+
Sbjct: 168 DKKKAQNRAAQRAFRERKE----------AKFKELQRKVR-ESEIDRDQLLKELEKLRKW 216

>SAKL0E02420g Chr5 complement(192871..193839) [969 bp, 322 aa] {ON}
           some similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009C YAP3 bZIP transcription factor
          Length = 322

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 11/70 (15%)

Query: 67  KKKQLLDPEARNKRTAQNRAAQRAFXXXXXXXXXXXXXXVANLTKIQKQNEIESEFLRSQ 126
           K+  L + E + ++ AQNRAAQRAF               A L +++++  +ESE  R  
Sbjct: 139 KQDNLTEKEIQARKKAQNRAAQRAFRERKE----------AKLKELERK-LMESEQNRES 187

Query: 127 LITLVNELKK 136
           L+  V +L++
Sbjct: 188 LLKEVEQLRR 197

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.124    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,036,041
Number of extensions: 2350171
Number of successful extensions: 13802
Number of sequences better than 10.0: 110
Number of HSP's gapped: 14235
Number of HSP's successfully gapped: 157
Length of query: 637
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 521
Effective length of database: 40,180,143
Effective search space: 20933854503
Effective search space used: 20933854503
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)