Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B059203.501ON2352359931e-137
NCAS0F036003.501ON2372446224e-81
TPHA0A057203.501ON2202395962e-77
KNAG0A079903.501ON2212445771e-74
SAKL0F02486g3.501ON2302445782e-74
Smik_16.4063.501ON2122385735e-74
Skud_16.4483.501ON2082375726e-74
Suva_16.4823.501ON2352375748e-74
YPR154W (PIN3)3.501ON2152385598e-72
TDEL0D056903.501ON2012355552e-71
Kwal_47.189053.501ON2362395564e-71
KLTH0G02332g3.501ON2332365312e-67
TBLA0C045303.501ON2222355112e-64
KAFR0G037403.501ON2342625061e-63
YGR136W (LSB1)3.501ON2412484541e-55
Kpol_480.83.501ON2391324504e-55
Skud_7.4473.501ON2382604452e-54
CAGL0F04829g3.501ON2022364283e-52
Suva_7.4243.501ON2491513975e-47
Smik_6.2323.501ON2411623835e-45
ZYRO0D09702g3.501ON1581793541e-41
AFR320W3.501ON2571653593e-41
Ecym_12283.501ON2531743211e-35
KNAG0B007503.501ON2171233024e-33
KLLA0E03873g3.501ON2201312885e-31
ZYRO0G20372gsingletonON150582032e-19
TBLA0D029103.501ON2691142079e-19
TBLA0A025705.470ON493671511e-10
Suva_15.1991.356ON457731501e-10
NDAI0A043505.470ON459621472e-10
TBLA0D049501.356ON468501455e-10
Smik_8.811.356ON468511448e-10
Skud_8.681.356ON475711439e-10
TBLA0B054702.502ON539691422e-09
YHR016C (YSC84)1.356ON468651412e-09
CAGL0I08965g1.356ON437651384e-09
Ecym_27471.356ON452501385e-09
Kwal_0.3711.356ON217641338e-09
NCAS0A089901.356ON434501351e-08
TPHA0C040202.502ON485541351e-08
NDAI0G059601.356ON423541341e-08
SAKL0D09702g1.356ON428691341e-08
KLTH0D06138g2.502ON489611342e-08
SAKL0G03454g5.470ON468581332e-08
AEL017W1.356ON416501332e-08
TPHA0O012801.356ON4541111332e-08
KLTH0H12980g1.356ON399691323e-08
KLLA0B13475g2.502ON508691313e-08
SAKL0E02200g2.502ON511691314e-08
NDAI0K021302.502ON459671314e-08
TDEL0A033405.470ON473701314e-08
Suva_8.512.502ON456761304e-08
Kpol_440.105.470ON470611305e-08
Ecym_24402.502ON459681305e-08
Smik_8.472.502ON447741296e-08
KAFR0E036405.470ON441561296e-08
KAFR0D033602.502ON455571296e-08
ZYRO0B01298g2.502ON411591287e-08
KNAG0C046305.470ON516561297e-08
KAFR0C044001.356ON459631289e-08
NCAS0A119205.470ON463551271e-07
TDEL0A027802.502ON451641271e-07
KLLA0A08360g1.356ON423501271e-07
Skud_4.6615.470ON460551271e-07
KNAG0C020401.356ON464501271e-07
CAGL0M01650g5.470ON466561271e-07
CAGL0K02761g2.502ON450551271e-07
TPHA0E015005.470ON457551261e-07
Smik_7.3351.356ON460501262e-07
Kwal_55.212875.470ON461811252e-07
YFR024C-A (LSB3)1.356ON459501252e-07
Kpol_1056.372.502ON501521252e-07
KAFR0A009701.356ON396931252e-07
TBLA0F034901.356ON511501252e-07
YDR388W (RVS167)5.470ON482561252e-07
NCAS0B072501.356ON441501242e-07
TDEL0D022401.356ON433611243e-07
Smik_4.6585.470ON472561243e-07
Kwal_26.79022.502ON532621243e-07
KLTH0F15114g5.470ON435551233e-07
ZYRO0D11110g5.470ON459571224e-07
TPHA0A022101.356ON397621225e-07
ABR008C2.502ON443501225e-07
KNAG0A067102.502ON419691215e-07
YHL002W (HSE1)2.502ON452521217e-07
Ecym_23165.470ON421601217e-07
Skud_6.1081.356ON459501209e-07
NDAI0B045801.356ON424721201e-06
Suva_6.961.356ON455501191e-06
Kpol_1008.251.356ON449501191e-06
Skud_8.432.502ON454521163e-06
Skud_8.1752.159ON633521154e-06
ZYRO0G00792g1.356ON469501154e-06
NCAS0A050802.502ON450591145e-06
ACR266W2.159ON626571138e-06
KLLA0E03059g5.470ON428541129e-06
CAGL0A02145g1.356ON391521111e-05
AFR140C5.470ON388491074e-05
KLTH0E09790g2.159ON622521075e-05
Smik_8.1922.159ON633521066e-05
KNAG0I015801.356ON581571057e-05
TDEL0E055204.45ON15891001058e-05
KLLA0C12551g2.591ON607641059e-05
YLR191W (PEX13)7.365ON386601049e-05
Kwal_47.178942.159ON621521041e-04
YHR114W (BZZ1)2.159ON633521041e-04
Smik_12.2517.365ON388601031e-04
Kpol_1072.562.159ON637571022e-04
TPHA0B028902.159ON634591022e-04
KLTH0B04818g7.365ON380601003e-04
KLLA0F23848g2.159ON649491004e-04
Suva_15.3102.159ON63452994e-04
Ecym_54262.159ON67255995e-04
Ecym_25266.366ON52451985e-04
SAKL0H21912g4.108ON1253101995e-04
Suva_10.2877.365ON39260986e-04
ABR082W2.591ON68355986e-04
Ecym_47107.365ON39960977e-04
Ecym_23082.591ON67856977e-04
AGR306C5.170ON92358987e-04
TDEL0A078106.366ON55865978e-04
Skud_12.2567.365ON40360950.001
TBLA0C055602.159ON67351960.001
KLLA0A04983g4.108ON125176950.001
NDAI0I002206.366ON61565950.002
SAKL0G17600g4.335ON44163940.002
ZYRO0G10098g4.108ON139261950.002
TPHA0F031007.365ON38160930.002
SAKL0A00594g6.366ON63650930.002
SAKL0F11748g7.365ON40860930.002
Suva_2.1184.108ON116664930.003
NDAI0A033304.108ON122671930.003
Smik_13.2022.591ON66371930.003
KLLA0F14575g5.170ON85191920.003
Suva_2.564singletonON4339820.004
KAFR0J026506.366ON55350910.004
TDEL0B052202.159ON61352910.004
NCAS0B069802.159ON63951910.005
Suva_13.2012.591ON66870900.006
Kpol_538.255.170ON70756900.006
Ecym_11474.335ON42273900.006
NCAS0A145707.419ON35553890.007
Skud_2.1044.108ON121463900.008
TDEL0F023804.108ON125567890.009
NCAS0A034904.108ON123564890.009
Kwal_23.64376.366ON63151880.010
ZYRO0A02662g2.319ON88668880.012
AER140C4.335ON41474870.012
KNAG0I027006.366ON57553870.014
YMR032W (HOF1)2.591ON66970870.015
CAGL0E02783g4.108ON120365870.015
Kpol_325.126.366ON57050860.016
CAGL0C03597g6.366ON58053860.017
KNAG0C029104.108ON124463860.020
TBLA0F002806.366ON57650860.021
Smik_2.1134.108ON123064860.021
TPHA0H023806.366ON52865850.023
NCAS0B060202.319ON86466850.024
AGL237C6.366ON57850850.027
Skud_13.1882.591ON66970850.029
Ecym_11678.539ON550101840.030
KLLA0E06953g7.419ON35752840.030
KLTH0A07348g6.366ON62651840.030
Smik_5.2637.419ON36852840.031
Kwal_26.83232.591ON62768840.033
ADL038W4.45ON150976840.041
KAFR0L015807.365ON34460830.041
ZYRO0D17358g6.366ON66875830.042
TDEL0C018207.365ON38960830.042
ZYRO0B16214g2.159ON65960830.043
TPHA0E007307.413ON97898830.045
YBL007C (SLA1)4.108ON1244100830.050
TBLA0A006108.539ON59771820.063
TBLA0C041004.108ON130267820.064
NCAS0D047406.366ON59453820.066
KLLA0D09306g4.45ON153778810.082
Suva_5.2397.419ON36853800.084
Skud_3.1606.366ON58653810.084
Smik_3.1866.366ON59153810.085
TBLA0B096202.319ON941123810.094
TPHA0G009302.319ON82486810.097
Suva_3.1246.366ON60053800.11
NDAI0C028305.170ON977113800.11
NDAI0J008508.344ON24567780.12
NCAS0D019505.170ON93951800.12
KLTH0D08580g2.591ON60062790.12
KNAG0B050005.170ON85553790.13
YLL017WsingletonOFF10339740.14
KLTH0D16434g4.335ON46166780.16
SAKL0H15048g8.344ON20750770.16
Kpol_534.62.319ON88656790.16
YCR088W (ABP1)6.366ON59253780.17
TPHA0K006807.419ON35552780.18
CAGL0E01045g8.344ON21350770.18
NDAI0B033302.319ON91953780.18
CAGL0C01881g7.413ON99976780.19
Skud_10.2005.170ON110176780.19
NDAI0A014707.419ON36752770.20
TBLA0A076107.365ON41372770.21
KLTH0E07744g4.108ON124964780.22
TDEL0G024902.319ON85053770.24
KAFR0B058608.344ON24988760.28
Ecym_72314.108ON114664770.28
YDR162C (NBP2)8.344ON23691750.28
Kpol_1045.277.413ON88072770.29
AGL286C7.419ON33051760.30
SAKL0E10780g2.159ON625103760.33
KAFR0L018807.413ON93049760.34
SAKL0H24222g4.45ON152675760.35
Ecym_71347.419ON33271750.36
Kpol_2000.28.344ON22590740.36
CAGL0M00858g4.320ON31556750.36
Skud_4.4208.344ON23385740.47
KAFR0I010404.108ON120360750.53
Suva_2.3268.344ON24089730.55
KLLA0F10175g6.366ON57650740.65
KLLA0D16874g8.344ON22751720.68
Smik_10.2515.170ON112276740.70
Ecym_42288.344ON26152720.73
TPHA0K016004.108ON113664730.78
TDEL0C027307.413ON101662730.80
KNAG0C033907.419ON34251720.93
KLTH0C06182g7.413ON102571730.97
Kpol_1025.404.108ON120260730.97
TBLA0C064405.170ON131474730.99
KAFR0K020007.419ON33252721.0
Kpol_457.12singletonON56732721.0
Kwal_27.107077.419ON34358721.0
KLLA0E23365g8.539ON57551721.0
SAKL0F12958g7.413ON102767721.0
KLTH0C06028g7.419ON34271711.1
NCAS0A059704.45ON132370721.1
KLTH0B02354g5.170ON121467721.2
CAGL0G03597g7.419ON35352711.2
YDL117W (CYK3)2.319ON88553721.2
KNAG0J027504.45ON165269721.3
TBLA0I010807.413ON155548721.3
Smik_4.1192.319ON88756711.4
Suva_4.1292.319ON88756711.5
Ecym_71417.413ON102982711.5
TBLA0E015604.45ON139479711.5
YJL020C (BBC1)5.170ON115755711.5
Skud_5.2617.419ON37252701.8
Skud_4.1372.319ON88756701.8
Kpol_1045.217.419ON35852692.2
Kwal_27.107337.413ON101466692.4
TBLA0H011608.344ON22481682.6
Suva_10.4064.45ON158763692.8
Scer_YGOB_SDC25 (SDC25)4.45ON125239692.8
YER118C (SHO1)7.419ON36752683.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05920
         (235 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   387   e-137
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   244   4e-81
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   234   2e-77
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   226   1e-74
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   227   2e-74
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   225   5e-74
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   224   6e-74
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   225   8e-74
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   219   8e-72
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   218   2e-71
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   218   4e-71
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   209   2e-67
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   201   2e-64
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   199   1e-63
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   179   1e-55
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   177   4e-55
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   176   2e-54
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   169   3e-52
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   157   5e-47
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   152   5e-45
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   140   1e-41
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   142   3e-41
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   128   1e-35
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   120   4e-33
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   115   5e-31
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    83   2e-19
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    84   9e-19
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    63   1e-10
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    62   1e-10
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    61   2e-10
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    60   5e-10
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    60   8e-10
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    60   9e-10
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    59   2e-09
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    59   2e-09
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    58   4e-09
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    58   5e-09
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    56   8e-09
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    57   1e-08
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    57   1e-08
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    56   1e-08
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    56   1e-08
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    56   2e-08
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    56   2e-08
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    56   2e-08
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    56   2e-08
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    55   3e-08
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    55   3e-08
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    55   4e-08
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    55   4e-08
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    55   4e-08
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    55   4e-08
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    55   5e-08
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    55   5e-08
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    54   6e-08
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    54   6e-08
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    54   6e-08
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    54   7e-08
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    54   7e-08
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    54   9e-08
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    54   1e-07
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    54   1e-07
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    54   1e-07
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    54   1e-07
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    54   1e-07
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    54   1e-07
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    54   1e-07
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    53   1e-07
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    53   2e-07
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    53   2e-07
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    53   2e-07
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    53   2e-07
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    53   2e-07
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    53   2e-07
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    53   2e-07
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    52   2e-07
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    52   3e-07
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    52   3e-07
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    52   3e-07
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    52   3e-07
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    52   4e-07
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    52   5e-07
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    52   5e-07
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    51   5e-07
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    51   7e-07
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    51   7e-07
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    51   9e-07
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    51   1e-06
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    50   1e-06
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    50   1e-06
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    49   3e-06
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    49   4e-06
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    49   4e-06
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    49   5e-06
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    48   8e-06
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    48   9e-06
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    47   1e-05
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    46   4e-05
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    46   5e-05
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    45   6e-05
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    45   7e-05
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    45   8e-05
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    45   9e-05
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    45   9e-05
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    45   1e-04
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    45   1e-04
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    44   1e-04
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    44   2e-04
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    44   2e-04
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    43   3e-04
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    43   4e-04
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    43   4e-04
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    43   5e-04
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    42   5e-04
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    43   5e-04
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    42   6e-04
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    42   6e-04
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    42   7e-04
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    42   7e-04
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    42   7e-04
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    42   8e-04
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    41   0.001
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    42   0.001
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    41   0.001
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    41   0.002
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    41   0.002
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    41   0.002
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    40   0.002
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    40   0.002
SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {...    40   0.002
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    40   0.003
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    40   0.003
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    40   0.003
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    40   0.003
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    36   0.004
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    40   0.004
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    40   0.004
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    40   0.005
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    39   0.006
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    39   0.006
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    39   0.006
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    39   0.007
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    39   0.008
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    39   0.009
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    39   0.009
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    39   0.010
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    39   0.012
AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON} N...    38   0.012
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    38   0.014
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    38   0.015
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    38   0.015
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    38   0.016
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    38   0.017
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    38   0.020
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    38   0.021
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    38   0.021
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    37   0.023
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    37   0.024
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    37   0.027
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    37   0.029
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    37   0.030
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    37   0.030
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    37   0.030
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    37   0.031
Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W...    37   0.033
ADL038W Chr4 (623309..627838) [4530 bp, 1509 aa] {ON} Syntenic h...    37   0.041
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    37   0.041
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    37   0.042
TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.3...    37   0.042
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    37   0.043
TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.4...    37   0.045
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    37   0.050
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    36   0.063
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    36   0.064
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    36   0.066
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    36   0.082
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    35   0.084
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    36   0.084
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    36   0.085
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    36   0.094
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    36   0.097
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    35   0.11 
NDAI0C02830 Chr3 complement(651724..654657) [2934 bp, 977 aa] {O...    35   0.11 
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    35   0.12 
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     35   0.12 
KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} simila...    35   0.12 
KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.1...    35   0.13 
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    33   0.14 
KLTH0D16434g Chr4 complement(1358785..1360170) [1386 bp, 461 aa]...    35   0.16 
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    34   0.16 
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    35   0.16 
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    35   0.17 
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    35   0.18 
CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar t...    34   0.18 
NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.3...    35   0.18 
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    35   0.19 
Skud_10.200 Chr10 complement(366708..370013) [3306 bp, 1101 aa] ...    35   0.19 
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    34   0.20 
TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa] ...    34   0.21 
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    35   0.22 
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    34   0.24 
KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {...    34   0.28 
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    34   0.28 
YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}  N...    33   0.28 
Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON} (60698....    34   0.29 
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    34   0.30 
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    34   0.33 
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    34   0.34 
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    34   0.35 
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    33   0.36 
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    33   0.36 
CAGL0M00858g Chr13 complement(95426..96373) [948 bp, 315 aa] {ON...    33   0.36 
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    33   0.47 
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    33   0.53 
Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}...    33   0.55 
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    33   0.65 
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    32   0.68 
Smik_10.251 Chr10 complement(395243..398611) [3369 bp, 1122 aa] ...    33   0.70 
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    32   0.73 
TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON} Anc_4...    33   0.78 
TDEL0C02730 Chr3 complement(479746..482796) [3051 bp, 1016 aa] {...    33   0.80 
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    32   0.93 
KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} simil...    33   0.97 
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    33   0.97 
TBLA0C06440 Chr3 (1558190..1562134) [3945 bp, 1314 aa] {ON} Anc_...    33   0.99 
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    32   1.0  
Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}...    32   1.0  
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    32   1.0  
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    32   1.0  
SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa...    32   1.0  
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    32   1.1  
NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]...    32   1.1  
KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakl...    32   1.2  
CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {...    32   1.2  
YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}  CYK3SH3-do...    32   1.2  
KNAG0J02750 Chr10 complement(521086..526044) [4959 bp, 1652 aa] ...    32   1.3  
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    32   1.3  
Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W ...    32   1.4  
Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W ...    32   1.5  
Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar ...    32   1.5  
TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4....    32   1.5  
YJL020C Chr10 complement(398937..402410) [3474 bp, 1157 aa] {ON}...    32   1.5  
Skud_5.261 Chr5 (422454..423572) [1119 bp, 372 aa] {ON} YER118C ...    32   1.8  
Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W ...    32   1.8  
Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON} (44320....    31   2.2  
Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER11...    31   2.4  
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    31   2.6  
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    31   2.8  
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    31   2.8  
YER118C Chr5 complement(397952..399055) [1104 bp, 367 aa] {ON}  ...    31   3.0  
TPHA0A04630 Chr1 complement(1047671..1050622) [2952 bp, 983 aa] ...    31   3.2  
Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016...    31   3.2  
CAGL0G06842g Chr7 complement(651033..654152) [3120 bp, 1039 aa] ...    31   3.2  
Kwal_33.15339 s33 complement(1065599..1069153) [3555 bp, 1184 aa...    31   3.2  
SAKL0F13112g Chr6 complement(1037049..1038071) [1023 bp, 340 aa]...    30   3.3  
Suva_12.60 Chr12 complement(81323..84748) [3426 bp, 1141 aa] {ON...    31   3.3  
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    30   3.5  
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    30   3.6  
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    31   3.9  
Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310...    30   4.4  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...    30   4.5  
NCAS0B03360 Chr2 (587093..587794) [702 bp, 233 aa] {ON} Anc_8.34...    30   4.6  
KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.34...    30   4.6  
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    30   4.7  
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    30   5.1  
Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}...    30   5.1  
TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON...    30   5.8  
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    30   6.0  
TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 a...    30   7.4  
ZYRO0F02640g Chr6 complement(209802..212891) [3090 bp, 1029 aa] ...    30   7.9  
CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} simil...    30   8.2  
KNAG0C03420 Chr3 (670941..673997) [3057 bp, 1018 aa] {ON} Anc_7....    30   8.5  

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  387 bits (993), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 196/235 (83%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP
Sbjct: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120

Query: 121 SKTRLTPGPPQYQASVETQSIHSSSNVSYQPPFPPASTNXXXXXXXXXXXXXXXXXXXXX 180
           SKTRLTPGPPQYQASVETQSIHSSSNVSYQPPFPPASTN                     
Sbjct: 121 SKTRLTPGPPQYQASVETQSIHSSSNVSYQPPFPPASTNYYQQPAQQPQAQYIPPPQPVQ 180

Query: 181 XXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                             HHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 181 QVQQQVQQQPQQQQPQQQHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  244 bits (622), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 144/244 (59%), Positives = 161/244 (65%), Gaps = 16/244 (6%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRE-SVSS------ 53
           MSAS INRSL  IRTELDFLKESNVIS+ETF+QI + LP +YDP+ SR  S+ S      
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 54  QAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPA 113
           Q    E+VEAIYPFEPQQ+GDLALK GDKI+VIEKPSPEWFKG+CNGQ G+FPSNYV+PA
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120

Query: 114 FSGTSQPSKTRLTP-GPPQYQASVETQSIHSSSNVSYQP-PFPPASTNXXXXXXXXXXXX 171
           FSG+S        P GPPQYQ S++TQ+ H+ S    QP PFPPA TN            
Sbjct: 121 FSGSSGSVNKVARPNGPPQYQNSLQTQNSHTPS--FQQPAPFPPALTN---YYQQQQPQF 175

Query: 172 XXXXXXXXXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIV 231
                                      HH H G  LKKFGSKLGNAAIFGAGATIGSDIV
Sbjct: 176 IQTPQQQQPQQVQQQPVQQQQPQQQEQHHSHHG--LKKFGSKLGNAAIFGAGATIGSDIV 233

Query: 232 NSIF 235
           NSIF
Sbjct: 234 NSIF 237

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  234 bits (596), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 158/239 (66%), Gaps = 23/239 (9%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSS----QAP 56
           MS SLINRSLT IRTEL+FLKES VIS+  F +IN+ LP+RYDP+ +   +S+     + 
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 57  TLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSG 116
            LEYVEAIY F+PQQ+GDLA++ GDKIQV+EK SPEW+KG CNG+VG+FPSNY +PAFSG
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120

Query: 117 TSQPSKTRLTPGPPQYQASVETQSIHSSSNVSYQPPFPPASTNXXXXXXXXXXXXXXXXX 176
           ++  SK+ LTP PPQYQ   +      S + SYQ PFPP STN                 
Sbjct: 121 STNASKSELTPVPPQYQQQQQPIQQVQSYH-SYQQPFPPQSTN----------------- 162

Query: 177 XXXXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                                 HH +TG+HLK FGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 163 -YYQQAPQQQQQQQQPEQQQQQHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  226 bits (577), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 133/244 (54%), Positives = 155/244 (63%), Gaps = 32/244 (13%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPN-----GSRESVSSQA 55
           MSASLINRSLTN+RTELDFL+ES VISEETFN+I + LPQ+YDPN      SR+S  S A
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 56  PTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFS 115
             LEYVEA+Y F+PQQ+GDL L+ GDKIQV+EKPS EW+KGKC GQVG+FPSNYV+PAFS
Sbjct: 61  -KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFS 119

Query: 116 G-TSQPSKTRLTPGPPQYQ---ASVETQSIHSSSNVSYQPPFPPASTNXXXXXXXXXXXX 171
           G +S P +    P  PQ Q   A +  Q  ++  + S  PPFPP S N            
Sbjct: 120 GESSAPKRPAGPPYQPQQQHLAAPMYQQPQNTGYSQSSNPPFPPQSAN------------ 167

Query: 172 XXXXXXXXXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIV 231
                                      H H+     KKFGS+LGNAAIFGAGATIGSDIV
Sbjct: 168 -------YYPPQQQQQPQQVVVEQQQPHKHNA---FKKFGSQLGNAAIFGAGATIGSDIV 217

Query: 232 NSIF 235
           NSIF
Sbjct: 218 NSIF 221

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  227 bits (578), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 151/244 (61%), Gaps = 23/244 (9%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MSASLINRSLT IRTELDFL+ES VISEETF QI+N LPQRYDPN +    SS  P+LEY
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSS--PSLEY 58

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEAIY F+ QQ+GDL LK GDKIQV+EKPS EW+KGKCNG VG+FPSNYV+PAFSG++  
Sbjct: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNGF 118

Query: 121 SKTRLTPGPPQYQ--------ASVETQSIHSSSNVSYQPPFPPASTNXXXXXXXXXXXXX 172
           ++                    +++ Q   SS+ ++ QP FPP ST              
Sbjct: 119 TREEPARPNLPPPPQYQSSPTVALQPQQTSSSTQLASQPQFPPPSTG------------F 166

Query: 173 XXXXXXXXXXXXXXXXXXXXXXXXXXHHHHTG-EHLKKFGSKLGNAAIFGAGATIGSDIV 231
                                     H  H G +  KKFGSKLGNAAIFGAGATIGSDIV
Sbjct: 167 YQQPPQQYYQQPPVQQSPVQQPAPEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIV 226

Query: 232 NSIF 235
           NSIF
Sbjct: 227 NSIF 230

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  225 bits (573), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 130/238 (54%), Positives = 154/238 (64%), Gaps = 29/238 (12%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MSASLINRSLTNIRTELDFLKESNVIS + F+QIN  LP R+DP  +  + SS   +LEY
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSST--SLEY 58

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEA+Y F+PQQ+GDL LK GDKIQ++EK SPEW+KG CNG+ GIFP+NYV+PAFSG++  
Sbjct: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQ 118

Query: 121 SKTRLTPGPPQYQASVETQSI--HSSSNVSY-QPPFPPASTNXXXXXXXXXXXXXXXXXX 177
           S     P PPQY+A  E Q +   +S+  SY Q PFPP STN                  
Sbjct: 119 SN---LPPPPQYKAQ-ELQPVPTQNSAVSSYQQQPFPPPSTN------------------ 156

Query: 178 XXXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                                   ++  HLK FGSKLGNAAIFGAGA+IGSDIVNSIF
Sbjct: 157 --YYQQPQQAPAPAPQQQQQQQQPNSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  224 bits (572), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 127/237 (53%), Positives = 151/237 (63%), Gaps = 31/237 (13%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MSASLINRSLT IRTELDFLKESNVIS + F+QIN  LP R++P+ +    SS   +LEY
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSA--SLEY 58

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEA+Y F+PQQ+GDL LK GDK+Q++EK SPEW+KG CNG+VGIFP+NYV+PAFSG++  
Sbjct: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSNGS 118

Query: 121 SKTRLTPGPPQYQASVETQSIHSSSNVS--YQPPFPPASTNXXXXXXXXXXXXXXXXXXX 178
           S     P PPQY+A    Q+   +S VS   Q PFPP STN                   
Sbjct: 119 SN---LPPPPQYKAQELQQAPTQNSAVSSYQQQPFPPPSTN------------------- 156

Query: 179 XXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                                   +  HLK FGSKLGNAAIFGAGA+IGSDIVNSIF
Sbjct: 157 -----YYQQPQQQPQQAPPQQQPSSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  225 bits (574), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 127/237 (53%), Positives = 153/237 (64%), Gaps = 22/237 (9%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MSASL+NRSLTNIRTELDFLKESNVIS++ F+QIN  LP ++DP+ +     S + +LEY
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRG--SNSASLEY 76

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEA+Y F+PQQ+GDL LK GDK+Q++EK SPEW+KG CNG+ GIFP+NYV+P FS +   
Sbjct: 77  VEAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDSD-- 134

Query: 121 SKTRLTPGPPQYQASVETQSIHSSSNV-SYQP-PFPPASTNXXXXXXXXXXXXXXXXXXX 178
            + RL P PPQY+A    Q    +SNV SYQP PFPP STN                   
Sbjct: 135 GQHRLPP-PPQYKAQELQQIPTQNSNVSSYQPQPFPPPSTN---------------YYQQ 178

Query: 179 XXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                                   +  HLK FGSKLGNAAIFGAGA+IGSDIVNSIF
Sbjct: 179 PLQQPQLQPQQPPPPQQQQQQQSSSNNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 235

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  219 bits (559), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 153/238 (64%), Gaps = 26/238 (10%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MSASLINRSLTNIRTELDFLK SNVIS + ++QIN  LP ++DP  +  + S    +LEY
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPA--SLEY 58

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEA+Y F+PQQ+GDL LK GDK+Q++EK SPEW+KG CNG+ GIFP+NYV+PAFSG++ P
Sbjct: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGP 118

Query: 121 SKTRLTPGPPQYQASVETQSI--HSSSNVSY-QPPFPPASTNXXXXXXXXXXXXXXXXXX 177
           S     P PPQY+A  E Q I   +S+  SY Q PFPP STN                  
Sbjct: 119 SN---LPPPPQYKAQ-ELQQIPTQNSAASSYQQQPFPPPSTN-----------------Y 157

Query: 178 XXXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                                 H  +  HLK FGSKLGNAAIFGAGA+IGSDIVN+IF
Sbjct: 158 YQQPQQQPQQAPPPQQQQQQQQHQSSHSHLKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  218 bits (555), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 119/235 (50%), Positives = 145/235 (61%), Gaps = 34/235 (14%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MSAS INRSL  +RTELDFL+ESNVIS+E ++ +N  LPQ     G            EY
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNASNKGG-----------EY 49

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           +EA+Y F+PQQ+GDLAL  GDKI+V+EKPS EWFKG+CNG+VG+FP+NYV+ A+SG+ +P
Sbjct: 50  MEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRP 109

Query: 121 SKTRLTPGPPQYQASVETQSIHSSSNVSYQPPFPPASTNXXXXXXXXXXXXXXXXXXXXX 180
           S     P PPQY+ +  T +  SS   SYQ PFPP STN                     
Sbjct: 110 S----VPPPPQYEQAQRTNTGQSSG--SYQQPFPPPSTN-----------------YYQQ 146

Query: 181 XXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                               HH+  HLKKFGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 147 PPQQYQQPQQQQPQQEQQQQHHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  218 bits (556), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 155/239 (64%), Gaps = 7/239 (2%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESV-SSQAPTLE 59
           MSAS INRSL+ +RTEL+FL+ESNVI+E ++  I   LP+RY+P  S  +V SSQ+   E
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQS---E 57

Query: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQ 119
           +VEAIY F+ QQ+GDL L+ GDKI+V+EKPSPEW+KG+CNG+VG+FPSNYV+PAFSG++ 
Sbjct: 58  FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNA 117

Query: 120 PSKTRLTPGPPQYQA-SVETQSIHSSSNVSY-QPPFPPAST-NXXXXXXXXXXXXXXXXX 176
             +    P PP+YQ+  +  Q+ ++S+N +Y QPPFPP ST                   
Sbjct: 118 SLERPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSTAYYQGPPQQYQPQQQYQQQ 177

Query: 177 XXXXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                                    HTG   KKFG KLGNAAIFGAGATIGSDIVNSIF
Sbjct: 178 YYQGQQATPQPAPAAPAAQQGTGSSHTGAAFKKFGGKLGNAAIFGAGATIGSDIVNSIF 236

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  209 bits (531), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 115/236 (48%), Positives = 146/236 (61%), Gaps = 4/236 (1%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MSAS INRSL+ +RTEL+FL+ES+VI+E ++  I + LP+RYDP  SR      A   E+
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDP--SRGPQQPSATQGEF 58

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEAIY F+ QQ+GDL L+ GDK++V+EKPSPEWFKGKCNG+VG+FPSNYV+PAFSG++  
Sbjct: 59  VEAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAFSGSTTT 118

Query: 121 SKTRLTPGPPQYQASVETQSIHSSSNVSY-QPPFPPASTNXXXXXXXXXXXXXXXXXXXX 179
            +  + P P      +  Q  ++S+  +Y QPPFPP+STN                    
Sbjct: 119 ERPVVPPPPQYQSQQLVPQQTNASAQSAYSQPPFPPSSTN-YYQPPPQQYPQQYPQQQYY 177

Query: 180 XXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                              H        KKFG KLGNAA+FGAGATIGSDIVNSIF
Sbjct: 178 QAQQAPVAAPVAAPAAQQGHSSQASSAFKKFGGKLGNAAVFGAGATIGSDIVNSIF 233

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  201 bits (511), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 117/235 (49%), Positives = 143/235 (60%), Gaps = 13/235 (5%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MS+SLIN+SL+ I TELDFL +SN I ++T+++I++ LP+R     SR+  S+ +   E+
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQ-SNSSKNEEW 59

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEAIY F+PQQ+GDL L  GDKI V EKPSPEWFKGKCNG+VG+FPSNYVRPAFSG++  
Sbjct: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNN- 118

Query: 121 SKTRLTPGPPQYQASVETQSIHSSSNVSYQPPFPPASTNXXXXXXXXXXXXXXXXXXXXX 180
            K+R    PPQYQ      S HSS   S  PP P                          
Sbjct: 119 EKSRSDAAPPQYQQDDHHISKHSSHQSSMMPPQPYPQQQQVYQAPPPQQQQAYQAPPQQV 178

Query: 181 XXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                               HH  +HLK FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 179 VVEQAPAK-----------QHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  199 bits (506), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/262 (42%), Positives = 146/262 (55%), Gaps = 55/262 (20%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPT--- 57
           MS++LINR++TNI+TELDFL+ES +I+++  ++I  QLP++YDP+  +   + + P    
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 58  -----------------------LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWF 94
                                  LEYVEA+Y FEPQQEGDL L AGDK+Q++EKPS EW+
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 95  KGKCNGQVGIFPSNYVRPAFSGTSQPSKTRLTPGPPQYQASVETQSIHSSSNVSY-QPPF 153
           KG CNGQ+G+FP+NYV+P        +K    P PPQYQ     Q  ++    SY QP +
Sbjct: 121 KGTCNGQIGMFPANYVKPV-------TKDSFAPPPPQYQ-----QYSNNYQQPSYSQPAY 168

Query: 154 PPASTNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSK 213
           PPAST                                            T E LK+FGSK
Sbjct: 169 PPASTG----------------YYQQPQQVQVQQPQQVQVQQQPQQQSQTNEQLKRFGSK 212

Query: 214 LGNAAIFGAGATIGSDIVNSIF 235
           LGNAAIFGAGAT+GSD+VNSIF
Sbjct: 213 LGNAAIFGAGATLGSDLVNSIF 234

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  179 bits (454), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 109/248 (43%), Positives = 139/248 (56%), Gaps = 20/248 (8%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MSASL+NRSL NIR EL+FLKESNVIS + F  IN++LP+++D N   +     A T EY
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGN---QRSPQNADTEEY 57

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEA+Y FE QQ+GDL+LK GDKIQV+EK SP+W++GK N ++GIFP+NYV+PAF+ ++ P
Sbjct: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRSASP 117

Query: 121 SK---------TRLTPGPPQYQASVETQSIHSSSNVSYQPPFPPA----STNXXXXXXXX 167
                      +R +  PP Y+ +    S + S  VS  P  PPA    +          
Sbjct: 118 KSAEAASSSTVSRPSVPPPSYEPAA---SQYPSQQVS-APYAPPAGYMQAPPPQQQQAPL 173

Query: 168 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIG 227
                                                   K FGSKLGNAAIFGAG+ IG
Sbjct: 174 PYPPPFTNYYQQPQQQYAPPSQQAPVEAQPQQSSGASSAFKSFGSKLGNAAIFGAGSAIG 233

Query: 228 SDIVNSIF 235
           SDIVNSIF
Sbjct: 234 SDIVNSIF 241

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  177 bits (450), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 112/132 (84%), Gaps = 5/132 (3%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQ--APTL 58
           MS++ INRSLT+++TEL+FL++SNVIS E F+QINN LP R+DP  SRES+++   +P L
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDP--SRESLATNNSSPNL 58

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTS 118
           EYVEAIY F+PQQ+GDLA++ GDKIQV+EK SPEW+KGKCNG+VG+FPSNYV+PAFSG S
Sbjct: 59  EYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPAFSGGS 118

Query: 119 -QPSKTRLTPGP 129
            + S++ LT  P
Sbjct: 119 NEKSRSHLTSPP 130

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 26/31 (83%), Positives = 29/31 (93%)

Query: 205 EHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
           +H K FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 209 KHFKSFGSKLGNAAIFGAGATLGSDLVNSIF 239

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  176 bits (445), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 111/260 (42%), Positives = 141/260 (54%), Gaps = 47/260 (18%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MSASLINRSL NIR EL+FLKESNVIS E F+ I++ LP ++D N      ++ A T EY
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKS---ANNASTEEY 57

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEA+Y FE QQ+GDL+LK GDKIQ++EK S +W+KGK N  +GIFP+NYV+PAF+ ++ P
Sbjct: 58  VEALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTRSTSP 117

Query: 121 S--KTRLTPG-------PPQYQASVETQSIHSSSNVSYQP----------------PFPP 155
              KT L+         PP Y+ +V   S    S  +  P                P+PP
Sbjct: 118 DFEKTPLSSRVSRPSVPPPSYEPAVPEYSSQQVSAPNVPPLGYVQAPPLQQNQAPLPYPP 177

Query: 156 ASTNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLG 215
           + TN                                                K FGSKLG
Sbjct: 178 SFTN-------------------YYQQPQQQYAPAPQQAQPQQQSSSASSAFKSFGSKLG 218

Query: 216 NAAIFGAGATIGSDIVNSIF 235
           +AAIFGAG+TIGSDI+NSIF
Sbjct: 219 DAAIFGAGSTIGSDIINSIF 238

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  169 bits (428), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 110/236 (46%), Positives = 131/236 (55%), Gaps = 35/236 (14%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MS S INRSL NIR ELDFL+ESNVISE  F +I  +LP     NG+  S      +LEY
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPS----NGA--SPVPPPMSLEY 54

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEA+Y F+PQQ+GDLA++AGDKIQV+EKPS EW++G  NG+ G+FPSNYVRPA    + P
Sbjct: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPA----AAP 110

Query: 121 SKTRLTPGPPQYQASVETQSIHSSSNV-SYQPPFPPASTNXXXXXXXXXXXXXXXXXXXX 179
           S       PP Y    +   +     V S+QPP  P                        
Sbjct: 111 SANL---APPAY----DNPKLSPQPTVQSFQPPAQPIVAQPSPQPAYYQAPPQQVVVEQQ 163

Query: 180 XXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                                 H G  LK FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 164 PVQQSSA---------------HNG--LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  157 bits (397), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 81/151 (53%), Positives = 104/151 (68%), Gaps = 24/151 (15%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYD------PNGSRESVSSQ 54
           MSASLINRSL NIR ELDFLKES VIS++ FN IN++LP+++D      PN S E     
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDVNLRPVPNASVE----- 55

Query: 55  APTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAF 114
               E+VEA+Y FEPQQEGDL LK GDKIQ++EK SP+W++GK N +VGIFP+NYV+PAF
Sbjct: 56  ----EFVEALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAF 111

Query: 115 SGTSQPSK---------TRLTPGPPQYQASV 136
           + ++ P           +R +  PP Y+  V
Sbjct: 112 ARSASPENEGASLSSKVSRPSAPPPSYEPVV 142

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%)

Query: 207 LKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
            K FGSKLGNAAIFGAG+TIGSDIV+SIF
Sbjct: 221 FKSFGSKLGNAAIFGAGSTIGSDIVHSIF 249

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  152 bits (383), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 110/162 (67%), Gaps = 13/162 (8%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MSA+L+NRSL NIR EL+FL+ESNVIS + F+ IN++LP++++ N       + A T EY
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRS---PNNADTEEY 57

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFS----- 115
           VEA+Y FE QQ+GDL+LK GDKIQV+EK SP+W+KGK N +VGIFP+NYV+PAF+     
Sbjct: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLT 117

Query: 116 ----GTSQPSKTRLTPGPPQYQASVETQSIHSSSNVSYQPPF 153
               G      +R +  PP Y+ +V +Q     +  SY PP 
Sbjct: 118 KPEEGDLSSKVSRPSVPPPSYEPAV-SQYPPQQTPASYAPPL 158

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (89%)

Query: 207 LKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
            K FGSKLGNAAIFGAG+ IGSDIVNSIF
Sbjct: 213 FKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  140 bits (354), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 101/179 (56%), Gaps = 26/179 (14%)

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGT- 117
           E+VEAIY F+PQQEGDLAL  GDKI+V+EKPSPEWF+G+CNG+VG+FPSNYV+PAFSG  
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63

Query: 118 SQPSKTRLTPGPPQY-QASVETQSIHSSSNVSYQPPFPPASTNXXXXXXXXXXXXXXXXX 176
            +P+     P PPQY Q ++ +Q               P+  N                 
Sbjct: 64  DRPA----APPPPQYDQKAMASQ---------------PSGGNAMWQQPSPYPPPSTNYY 104

Query: 177 XXXXXXXXXXXXXXXXXXXXXXHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
                                 HH      L KFGSKLGNAAIFGAGAT+GSD++NSIF
Sbjct: 105 QPPPPQQQQPQPMVVQQEQGKRHH-----GLGKFGSKLGNAAIFGAGATLGSDLINSIF 158

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  142 bits (359), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 107/165 (64%), Gaps = 15/165 (9%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGS-RESVSSQAPTLE 59
           MS++LINRSL  IRTEL FL +S VI+ +   QI + LP   +PN + R + ++ A  +E
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP---NPNEALRGAPANNAGPVE 57

Query: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQ 119
           YVEA+Y F+ QQ GDL  K G+KI+V+EKPSPEW+KG+CNG+VG+FPSNYV+PAFSG S 
Sbjct: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSL 117

Query: 120 PSKTRLTPGPPQYQASVETQSIHSSSNVSY-------QPPFPPAS 157
             +      PP+Y A      + S +  S        Q PFPP +
Sbjct: 118 MKEAS----PPRYPAQASAPQVQSPTPQSPPPPAGFSQSPFPPGA 158

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 28/28 (100%)

Query: 208 KKFGSKLGNAAIFGAGATIGSDIVNSIF 235
           KKFGSKLGNAAIFGAGAT+GSD+V+SIF
Sbjct: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  128 bits (321), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 105/174 (60%), Gaps = 21/174 (12%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60
           MS+SLINRSL NI+TEL+FL ESNVIS+    QI + L    +P       +SQ    EY
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSMLS---NPREGTMKAASQQVLKEY 57

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120
           VEA+Y F PQQ GDL  K GDKI+V+EKPS +W+KG+ NG+VG+FPSNYV+   S  + P
Sbjct: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK---SLRTLP 114

Query: 121 SKTRLTPGPPQYQASVETQSIHSSSNVS---------------YQPPFPPASTN 159
           +  R    PPQY   V+  +  SSSN S                QP  PPA+++
Sbjct: 115 NGGRFDEPPPQYSLMVQDTAHSSSSNHSQLPPAPPAPIGGGYYQQPSLPPAASS 168

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 27/29 (93%)

Query: 207 LKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
            KKFGSKLGNAA+FGAGAT+GS++V+ IF
Sbjct: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  120 bits (302), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 85/123 (69%), Gaps = 6/123 (4%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPN---GSRESVSSQAPT 57
           MS   +NRS+TNIRTEL++L ES VIS +TF++ N +LP  +D     G+ E      P 
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEP- 59

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPA-FSG 116
            EYVEAI+ ++PQ++ DL L+ GDK++++EK S +W++GK  G+VG+FPSNYV+   FSG
Sbjct: 60  -EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSG 118

Query: 117 TSQ 119
              
Sbjct: 119 VDD 121

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 200 HHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSI 234
           HHH+G   K    + GN+ +FGAG  IGSDIVN I
Sbjct: 180 HHHSGAG-KNLLKQFGNSIVFGAGQRIGSDIVNGI 213

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  115 bits (288), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 60/131 (45%), Positives = 81/131 (61%), Gaps = 5/131 (3%)

Query: 6   INRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEYVEAIY 65
           +  S+  I++EL +LKE   ++E  +  I + LP R  P         Q    E VEA+Y
Sbjct: 4   VEESVATIKSELKYLKEQGALAELAYKDIESLLP-RVRPQPPVADTMGQ--NNEIVEALY 60

Query: 66  PFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQPSKTRL 125
            F+PQQ+GDLALK GDKI+++EK SPEW+KGKCNGQVG+FPSNYV+   +   +   +  
Sbjct: 61  AFQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVKSVDTKDVEKRSSSA 120

Query: 126 TP--GPPQYQA 134
           TP    PQY A
Sbjct: 121 TPVANLPQYAA 131

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (82%)

Query: 201 HHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
           H      KKFGSKLGNAAIFGAGATIGSD+VNSIF
Sbjct: 186 HQGSAAFKKFGSKLGNAAIFGAGATIGSDLVNSIF 220

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 82.8 bits (203), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 46/58 (79%)

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSG 116
           EYVE +Y F+PQ + DL +K GDK++V+EK S +W+KGKCNG+ G+FP+NYV+P   G
Sbjct: 15  EYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVKPVGGG 72

 Score = 52.0 bits (123), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/37 (67%), Positives = 29/37 (78%), Gaps = 3/37 (8%)

Query: 199 HHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235
           H HH    L K GSKLGNAAIFG GAT+G+D+V+SIF
Sbjct: 117 HRHHA---LGKVGSKLGNAAIFGVGATLGNDLVDSIF 150

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 84.3 bits (207), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 6/114 (5%)

Query: 4   SLINRSLTNIRTELDFLKESNVISEETFNQINNQLP-QRYDPNGSRESVSSQAPTL---- 58
           + I  + T IR  L+ L ++  ISE  +++I + L  +R  P+ S  S  ++        
Sbjct: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNG 67

Query: 59  -EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
            +YVEAIY +  +Q+GDL L  GD I+VI K SP+W++G+ NG+VG+FP+NYV+
Sbjct: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 20/23 (86%)

Query: 213 KLGNAAIFGAGATIGSDIVNSIF 235
           KLGNAA+FGAG+  G+DIVN IF
Sbjct: 247 KLGNAALFGAGSAFGADIVNDIF 269

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 47  SRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGI 104
           S   V   AP  E V A+Y ++ Q EGDL+  AG  I+++++ +   EW+ GK NGQ G+
Sbjct: 423 SATGVPQSAPAFETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNGQQGV 482

Query: 105 FPSNYVR 111
           FP NYV+
Sbjct: 483 FPGNYVK 489

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 46/73 (63%), Gaps = 5/73 (6%)

Query: 43  DPNGSRESV--SSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKC 98
           D N SR  +  S Q+PT   V A+Y F  +Q GDLA K GD I +++K     +W+ G+ 
Sbjct: 384 DDNHSRVKLPTSLQSPTQTAV-ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRV 442

Query: 99  NGQVGIFPSNYVR 111
           NG+ GIFP+NYVR
Sbjct: 443 NGKEGIFPANYVR 455

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 41/62 (66%), Gaps = 2/62 (3%)

Query: 52  SSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNY 109
           S  AP +E V A+Y ++ Q  GDL+  AG  I+++E+ S   EW+ GK NGQ G+FP NY
Sbjct: 394 SMAAPGVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNY 453

Query: 110 VR 111
           V+
Sbjct: 454 VQ 455

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 60.5 bits (145), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQVGIFPSNYV 110
           A+Y F+ ++ GDL+ + GD I +I+K     +W+ G+CNG+ GIFP+NYV
Sbjct: 416 ALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYV 465

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYVR 111
           A+Y F  +Q GDLA K GD I +++K     +W+ G+ NG+ GIFP+NYVR
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 43  DPNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNG 100
           D  G++   S  +PT   + A+Y F  +Q GDLA K GD I +++K     +W+ G+ NG
Sbjct: 404 DNTGAKMRPSLHSPTPTAI-ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRING 462

Query: 101 QVGIFPSNYVR 111
           + GIFP+NYVR
Sbjct: 463 KEGIFPANYVR 473

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 45  NGSRESVSSQAP-TLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVG 103
           N   + +  Q P  ++ V A+Y     + G+L+ K GD I+VIE+   +W++G   G VG
Sbjct: 228 NNPNQQIDEQKPAVVKRVRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVG 287

Query: 104 IFPSNYVRP 112
           IFP NYV P
Sbjct: 288 IFPLNYVNP 296

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 3/65 (4%)

Query: 49  ESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFP 106
           ES ++ + T   V A+Y F  +Q GDLA K GD I +++K     +W+ G+ NG+ GIFP
Sbjct: 403 ESTATNSATPTAV-ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFP 461

Query: 107 SNYVR 111
           +NYVR
Sbjct: 462 ANYVR 466

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 5/65 (7%)

Query: 48  RESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIF 105
           R   SS AP      A+Y F  ++ GDL+ + GD I +I+K     +W+ GK NG+ GIF
Sbjct: 373 RRDASSGAPK---AVALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIF 429

Query: 106 PSNYV 110
           P+NYV
Sbjct: 430 PANYV 434

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQVGIFPSNYV 110
           A+Y F+ +Q+GDL  + GD I +++K +   +W+ G+ NGQ GIFP+NYV
Sbjct: 400 ALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPANYV 449

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 5/64 (7%)

Query: 49  ESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQVGIFP 106
            S SS AP      A+Y F  +Q GDL  + GD I +++K     +W+ G+ NGQ GIFP
Sbjct: 154 RSTSSGAPK---AVALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFP 210

Query: 107 SNYV 110
           +NYV
Sbjct: 211 ANYV 214

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 36/50 (72%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           A+Y F  +Q+GDL+ + GDKI ++++     +W+ G+ NG+ GIFP+NYV
Sbjct: 382 ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYV 431

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 35/54 (64%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAF 114
           V A+Y    Q+E +L+ + GD I V+E+   +W++G  +G++GIFP NYV P  
Sbjct: 234 VRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTPII 287

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQVGIFPSNYV 110
           E V A+Y F  +Q+GDLA K GD I VI+K     +W+ GK   + GIFP+NYV
Sbjct: 367 EKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYV 420

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 5/69 (7%)

Query: 44  PNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQ 101
           P   R   SS AP      A+Y F+ +Q GDL  + GD + +++K     +W+ G+ NGQ
Sbjct: 360 PVSRRSPASSGAPK---AVALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQ 416

Query: 102 VGIFPSNYV 110
            GIFP+NYV
Sbjct: 417 EGIFPANYV 425

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 37/61 (60%)

Query: 57  TLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSG 116
           T+  V A++    ++  +L+ + GD I VIE+   +W++G+  G+VGIFP NYV P    
Sbjct: 213 TVRKVRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYVTPVAEK 272

Query: 117 T 117
           T
Sbjct: 273 T 273

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 56  PTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPE--WFKGKCNGQVGIFPSNYVR 111
           P +E V A+Y ++ Q EGDL    G  I+V+E+ +    W+ G+ NGQ G+FP NYV+
Sbjct: 407 PGVETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQVGIFPSNYV 110
           A+Y F+ +Q+GDL  + GD I ++++     +W+ G+ NGQ GIFP+NYV
Sbjct: 364 ALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYV 413

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 58/111 (52%), Gaps = 10/111 (9%)

Query: 9   SLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEYVE------ 62
           S TN R E +     N + ++  N+ +       + + +RE  +S++   + V       
Sbjct: 342 SRTNTRWEDEIYDNENNV-DDVSNRFSRARISSNNNSANRERRASRSSYNDGVSHAGPKA 400

Query: 63  -AIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQVGIFPSNYV 110
            A+Y F  ++ GDL+ K GD I +++K     +W+ G+ NG+ GIFP+NYV
Sbjct: 401 VALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYV 451

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 5/69 (7%)

Query: 44  PNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQ 101
           P+    + SS AP      A+Y F+ +Q GDL  + GD I +++K     +W+ G+ NGQ
Sbjct: 331 PSAHSRTASSGAPK---AVALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQ 387

Query: 102 VGIFPSNYV 110
            GIFP+NYV
Sbjct: 388 EGIFPANYV 396

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 57  TLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSG 116
            +  V A+Y F   ++ +L+ K GD I V+E+   +W++G   G VGIFP NYV P    
Sbjct: 223 VIRKVRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTP---- 278

Query: 117 TSQPSKTRL 125
            ++PS+  L
Sbjct: 279 VTEPSQQEL 287

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 57  TLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSG 116
            ++ V A+Y     +  +L+ K GD I V+E+   +W++G   G+VGIFP NYV P    
Sbjct: 229 VIKRVRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYVTP---- 284

Query: 117 TSQPSKTRL 125
            ++P+K  L
Sbjct: 285 ITEPTKEEL 293

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 54  QAPTL-EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRP 112
           Q PT+   V A+Y        +L+ K GD I V+E+   +W+KGK   Q GIFP NYV P
Sbjct: 225 QQPTIVRKVRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTP 284

Query: 113 AFSGTSQ 119
               TS+
Sbjct: 285 VPEPTSE 291

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 44  PNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQ 101
           P  S  + ++  P    V A+Y ++ Q  GDL+  AG  I+V+++     EW+ G+ NGQ
Sbjct: 400 PAYSMSTATTAPPAANTVTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQ 459

Query: 102 VGIFPSNYVR 111
            G+FP NYV+
Sbjct: 460 QGVFPGNYVQ 469

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 47  SRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFP 106
           S+ S +S    +  V A+Y     +  +L+ + GD I V+E+   +W+KG   G++GIFP
Sbjct: 212 SQTSAASGQSVVRRVRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFP 271

Query: 107 SNYVRPAFSGTSQPSK 122
            NYV P     ++PSK
Sbjct: 272 LNYVTP----IAEPSK 283

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 53  SQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           S AP  E   ++Y ++ Q  GDL+  AG  I+++E+ +   EW+ G+ NGQ G+FP NYV
Sbjct: 407 SAAPQAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYV 466

Query: 111 R 111
           +
Sbjct: 467 Q 467

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 38/68 (55%)

Query: 46  GSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIF 105
           G  +  +SQ   ++ V A+Y     +  +L+   GD I VIE+   +W++G   G+VGIF
Sbjct: 216 GQEQRHTSQLFQVKKVRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIF 275

Query: 106 PSNYVRPA 113
           P NYV P 
Sbjct: 276 PLNYVTPC 283

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 52  SSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
           +S+   ++ V A+Y     +  +L+ + GD I V+E+   +W+KG   G++GIFP NYV 
Sbjct: 208 TSRQTVVKKVRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPLNYVT 267

Query: 112 PAFSGTSQPSKTRL 125
           P     S+PSK  +
Sbjct: 268 P----ISEPSKEEI 277

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQVGIFPSNYVR 111
           +E V A+Y ++ Q  GDL+  AG  I+++++ +   EW+ G+ NGQ G+FP NYV+
Sbjct: 383 METVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGT 117
           V A+Y F   +  +L+ K GD I V+E+   +W++G   G++GIFP NYV P    T
Sbjct: 216 VRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYVTPIMDPT 272

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQ 119
           V+A+Y     +  +LA K GD I V+E+   +W++G   G +GIFP NYV P    T Q
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPVAEPTQQ 290

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYVR 111
           +E V A+Y ++ Q  GDL+  AG  I+++++ +   EW+ G+ NGQ G+FP NYV+
Sbjct: 458 VETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVFPGNYVQ 513

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 50  SVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPS 107
           S SS AP      A+Y F  ++ GDL  + GD I +++K     +W+ G+ NG+ GIFP+
Sbjct: 397 SSSSNAPK---AVALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPA 453

Query: 108 NYV 110
           NYV
Sbjct: 454 NYV 456

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYVR 111
           E V A+Y ++ Q  GDL+  AG  I+++E+     EW+ G+ NGQ G+FP NYV+
Sbjct: 405 ETVTALYEYQAQAAGDLSFPAGAVIEIVERTPDVNEWWTGRYNGQQGVFPGNYVQ 459

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%)

Query: 49  ESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSN 108
           E+ SS    +  V A+Y    ++  +L+ + GD I V+E+   +W++G   G+VGIFP N
Sbjct: 216 EAKSSAPAVIRKVRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLN 275

Query: 109 YVRP 112
           YV P
Sbjct: 276 YVTP 279

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQVGIFPSNYV 110
           A+Y F+ ++ GDL  + GD I +I+K     +W+ G+ NG+ GIFP+NYV
Sbjct: 371 ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYV 420

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEK--PSPEWFKGKCNGQVGIFPSNYVR 111
           E V A+Y ++ Q  GDL+  AG  I+++++   + EW+ G+ NGQ G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           A+Y F  ++ GDL  + GD I V++K     +W+ G+ NG+ GIFP+NYV
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYV 461

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYVR 111
           +E V A+Y ++ Q  GDL+  AG  I+V+++     EW+ G+ NGQ G+FP NYV+
Sbjct: 409 VETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 464

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 35/55 (63%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRP 112
           +  V A+Y     ++ +L+ + GD I V+E+   +W++G  +G++GIFP NYV P
Sbjct: 214 IRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTP 268

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYVR 111
           EY  ++Y ++ Q +GDL+  AG  IQ++++ +   +W+ G  NGQ G+FP NYV+
Sbjct: 400 EYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           A+Y F  ++ GDL  + GD I +++K     +W+ G+ NG+ GIFP+NYV
Sbjct: 408 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYV 457

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 6/81 (7%)

Query: 36  NQLPQRYDPNGSRESVSSQAPTL--EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPE- 92
           N  PQ   P  S  +  + AP    E V A+Y ++ Q EGDL   AG  I+V+E+ +P+ 
Sbjct: 379 NYTPQPTSPYASTYTPPTTAPLSAPETVTALYDYQAQAEGDLTFPAGAIIEVVER-TPDV 437

Query: 93  --WFKGKCNGQVGIFPSNYVR 111
             W+ G+ NG  G+FP NYV+
Sbjct: 438 NGWWTGRYNGYQGVFPGNYVQ 458

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           A+Y F  ++ GDL  + GD I +++K     +W+ G+ NG+ GIFP+NYV
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYV 456

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRP 112
           V A+Y     +  +L+ K GD I V+E+   +W+KG   G +GIFP NYV P
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTP 291

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 50/93 (53%), Gaps = 15/93 (16%)

Query: 23  SNVISEETF---NQINNQLPQRYDPNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKA 79
           +N   EE +    Q ++ LPQ  D N S          ++ V A+Y F  ++EGDL  K 
Sbjct: 311 TNTDDEELYEHRGQHSDHLPQLSDKNQS---------GMKAV-ALYNFGGKEEGDLIFKR 360

Query: 80  GDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           GD I ++++     +W+ G  NG+ G+FP+NYV
Sbjct: 361 GDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYV 393

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           A+Y F  ++ GDL+ + GD I +I+K     +W+ G+ +G+ GIFP+NYV
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYV 508

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP---EWFKGKCNGQVGIFPSNYVR 111
           E V A+Y ++ Q  GDL+  AG  I+++++ +P   EW+ G+ NGQ G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 478

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           A+Y F  ++ GDL  + GD I +++K     +W+ G+ NG+ GIFP+NYV
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYV 438

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 5/61 (8%)

Query: 52  SSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQVGIFPSNY 109
           SS AP      A+Y F  ++ GDL  + GD I +++K     +W+ G+ NG+ GIFP+NY
Sbjct: 373 SSNAPK---AVALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANY 429

Query: 110 V 110
           V
Sbjct: 430 V 430

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP---EWFKGKCNGQVGIFPSNYVR 111
           E V A+Y ++ Q  GDL+  AG  I+++++ +P   EW+ G+ NGQ G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 468

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 36/62 (58%)

Query: 56  PTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFS 115
           P +  V A++    +   +L+ + GD I+V+E+   +W++G   G++GIFP NYV P   
Sbjct: 224 PVVRKVRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTPVTD 283

Query: 116 GT 117
            T
Sbjct: 284 KT 285

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPE--WFKGKCNGQVGIFPSNYVR 111
           E V A+Y ++ Q EGDL   AG  I+V+E+ +    W+ G+ NG  G+FP NYV+
Sbjct: 378 ETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVFPGNYVQ 432

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 39/57 (68%), Gaps = 2/57 (3%)

Query: 57  TLEYVEAIYPFEPQQEGDLALKAGDKIQVIEK--PSPEWFKGKCNGQVGIFPSNYVR 111
           ++E V A+Y ++ Q  GDL+  A   I+++++   + EW+ G+ +GQVG+FP NYV+
Sbjct: 399 SVETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 2/62 (3%)

Query: 51  VSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSN 108
           VSS  P      A++ F+ +Q GDL+   GD + +++K     +W+ G+ N Q GIFP+N
Sbjct: 333 VSSPIPQGPKAIALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPAN 392

Query: 109 YV 110
           YV
Sbjct: 393 YV 394

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYV 110
           V+AI+     +  +L+ K GD I VIE+   +W++G   G+VGIFP NYV
Sbjct: 215 VKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%)

Query: 57  TLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSG 116
           T++ V A+Y  E     +LA +  D I VIE+   +W+ G    +VGIFP NYV P    
Sbjct: 215 TIKKVRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIFPLNYVTPIIEL 274

Query: 117 TSQPSKTRL 125
           T +  +  L
Sbjct: 275 TPEQKQKEL 283

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRP 112
           V A+Y     +  +L+ + GD I V+E+   +W+KG   G +GIFP NYV P
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 53  SQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKP-SPEWFKGKCNGQVGIFPSNYVR 111
           S AP  E   ++Y F  Q + DL   A   I+++++  S  W+ G+ NGQ G+FP NYVR
Sbjct: 358 STAPAPETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYNGQEGLFPGNYVR 417

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           A+Y F  ++ GDL  + GD I +++K     +W+ G+ +G+ GIFP+NYV
Sbjct: 407 ALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYV 456

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 5/72 (6%)

Query: 41  RYDPNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKC 98
           RY    +  +V S AP      A+Y F  ++  DL  + GD I +++K     +W+ G+ 
Sbjct: 353 RYARTRNDSAVPSSAPK---AVALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRV 409

Query: 99  NGQVGIFPSNYV 110
           NG+ GIFP+NYV
Sbjct: 410 NGREGIFPANYV 421

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           A++ F  ++ GDL  + GD + +++K     +W+ G+ NG+ GIFP+NYV
Sbjct: 403 ALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFPANYV 452

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQVGIFPSNYV 110
           A+Y F  ++ GDL  K GD I +++K     +W+ G+ N   GIFP+NYV
Sbjct: 397 ALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPANYV 446

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRP 112
           V A+Y     +  +L+ +  D I V+E+   +W+KG   G++GIFP NYV P
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 276

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIE-KPSPEWFKGKCNGQVGIFPSNYVR 111
           +EA+Y +E Q + ++++  GD+I VI       W  G+C+G  G+FP++Y R
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPS--PEWFKGKCNGQVGIFPSNYV 110
           A+Y F  ++ GDL  + GD I +++K     +W+ G+  G+ GIFP+NYV
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYV 466

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQ 119
           V A+Y     +  +L+   GD I V+E+   +W++G   G  GIFP NYV P    T Q
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTPISDPTPQ 278

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 55  APTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPE-WFKGKCNGQVGIFPSNYV 110
           A  L+ V AIY +  Q + +++++AGD I+V+   +   W  G+ NG  G+FPSNY 
Sbjct: 569 AAPLKTVTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNYC 625

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPE-WFKGKCNGQVGIFPSNYV 110
           +E   A+Y +  Q EGDL   AG  IQV+++     W+ G  NG  G+FP NYV
Sbjct: 370 VETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNYV 423

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           V A+Y F  QQ+GDL+ K  D I V +K     +W+ G  +G  G+FP+NYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPE-WFKGKCNGQVGIFPSNYV 110
           A+Y F  Q +GDL+      I+++++     W+ G+ NG+ G+FP+NYV
Sbjct: 336 ALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLFPANYV 384

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPE-WFKGKCNGQVGIFPSNYVR 111
           V+A++ +E Q + +++++ GD I V++      W  G+ NGQ G+FP+NY +
Sbjct: 571 VKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLFPTNYCQ 622

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIE-KPSPEWFKGKCNGQVGIFPSNYVR 111
           +EA+Y +E Q + ++++  GD I VI       W  G+C+G  G+FP++Y +
Sbjct: 582 LEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 56  PTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYV 110
           P +    A++ F   + GDL  K GD I +I++     +W+ G+ N + G+FP+NYV
Sbjct: 522 PNIAKAVALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYV 578

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 10/100 (10%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG---KCNGQV--GIFPSNYVRP 112
           ++ V AI+ +  + + +L L+ GD I VI K    W+ G   + NG+V  G FP NY R 
Sbjct: 48  VDVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCRS 107

Query: 113 AFSGTSQPSKTRLTPGPPQYQASVETQSIHSSSNVSYQPP 152
           + S     +K R +    Q +AS+ +Q+    S + YQ P
Sbjct: 108 SHSQIPFKTKRRAS----QLRASLSSQTSRRGS-LQYQQP 142

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 52  SSQAPTLEYVEAIYPF-EPQQEGDLALKAGDKIQVIEKPSPEWFKGKC---NGQVGIFPS 107
           S + P ++YV+A+Y + EP +   L   +GD + ++E  + +W+ G+    N Q G+ P 
Sbjct: 541 SMKNPVVKYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPM 600

Query: 108 NYVR 111
           NYV+
Sbjct: 601 NYVK 604

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 7/60 (11%)

Query: 58  LEYVEAIYPFEPQQ-EGDLALKAGDKIQVIEKPSP-----EWFKGKC-NGQVGIFPSNYV 110
           LE+  A+Y F P+  E ++ALK GD + ++ K  P     +W+K +  NG +G  P NY+
Sbjct: 308 LEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYI 367

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPE-WFKGKCNGQVGIFPSNYVR 111
           VEA+Y ++ Q E + +L  GD I V++      W  G+ NG+ G+FP++Y +
Sbjct: 570 VEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYCK 621

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIE-KPSPEWFKGKCNGQVGIFPSNYVR 111
           +EAIY +E Q + ++++  GD I VI       W  G+C+G  G+FP++Y +
Sbjct: 582 MEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 7/60 (11%)

Query: 58  LEYVEAIYPFEPQQ-EGDLALKAGDKIQVIEKPSP-----EWFKGKC-NGQVGIFPSNYV 110
           LE+  A+Y F P+  E ++ALK GD + ++ K  P     +W+K +  NG +G  P NY+
Sbjct: 310 LEFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYNYI 369

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 56  PTLEYVEAIYPFEPQQEGDLALKAGDKIQVIE-KPSPEWFKGKCNGQVGIFPSNYVR 111
            ++  VEAIY +E   + +L++  G+ I+VI       W  G+ NG  G+FPS+Y +
Sbjct: 581 ASIRTVEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 54  QAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIE-KPSPEWFKGKCNGQVGIFPSNYVR 111
           +  T   V+A+Y +E Q + ++++  GD I VI+      W  G+ NG  G+FPS+Y +
Sbjct: 576 KTTTTRKVQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSYCK 634

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 58  LEYVEAIYPFEPQQ-EGDLALKAGDKIQVIEKPSP-----EWFKGKCN-GQVGIFPSNYV 110
           LE+  A+Y F P+  + + AL+ GD + VI K  P     EW++ +   G VG  PSNYV
Sbjct: 310 LEFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGYVPSNYV 369

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVI-EKPSPEWFKGKCNGQVGIFPSNYV 110
           A YP++ Q   +L+L+ GDKI+V+ E     W  G+ NG  G+FP+ Y 
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIE-KPSPEWFKGKCNGQVGIFPSNYVR 111
           +EA Y +E + + ++++  GD I VI       W  G+C+G  G+FP++Y +
Sbjct: 583 LEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 634

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 57  TLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPE-WFKGKCNGQVGIFPSNYV 110
           +L  V A+Y +  +   +++++AGD I+VI   +   W  G+  G  G+FPSNY 
Sbjct: 617 SLRTVIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNYC 671

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG--KCNGQVGIFPSNYVR 111
           A Y +E  ++ +L  K GD+I  IE    +W+ G  K  G+ G+FPSNYV+
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 8/101 (7%)

Query: 54  QAPTLEYVEAIYPFEPQQEGD--LALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNY 109
           QAP + + +A+Y ++  Q  D  L    GD+  V +   P+W     K +G++G  P NY
Sbjct: 67  QAPVISHAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNY 126

Query: 110 VRPAFSGTSQPSKTRLTPGPPQYQASVETQSIHSSSNVSYQ 150
           V  +    + P  +   P PPQ+  S + ++    SN++ +
Sbjct: 127 VEIS---EATPVGSNSFPPPPQH-VSKQARATTDVSNINIE 163

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNY 109
           L   +AIY ++PQ   +LA+   D + +++K    +W+  K +  G      VG+ P+NY
Sbjct: 5   LGVYKAIYAYQPQNPEELAIDEEDLLYLLQKSDVDDWWTVKKRVIGTDQEEPVGLVPNNY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEQA 68

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 7/60 (11%)

Query: 58  LEYVEAIYPFEPQQ-EGDLALKAGDKIQVIEKPSP-----EWFKGKC-NGQVGIFPSNYV 110
           LE+  A+Y F P+  + ++ALK GD + ++ K  P     +W+K +  NG +G  P NY+
Sbjct: 314 LEFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIPYNYI 373

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 60  YVEAIYPF-EPQQEGDLALKAGDKIQVIEKPSPEWFKGKC---NGQVGIFPSNYV 110
           Y  AIY F EP     L  + GD + + EK + +W+ G+    NG+ G+ P NYV
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYV 679

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 58  LEYVEAIYPFEPQQ-EGDLALKAGDKIQVIEKPSP-----EWFKGKCN-GQVGIFPSNYV 110
           LE+  A+Y F P+    + +LK GD + +I K  P     +W+K +   G+VG  PSNY+
Sbjct: 314 LEFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSNYI 373

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 60  YVEAIYPF-EPQQEGDLALKAGDKIQVIEKPSPEWFKGKC---NGQVGIFPSNYVR 111
           Y +A+Y F EP +   L  + GD + + EK + +W+ G+    NG+ G+ P NYV+
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWF-----KGKCNGQVGIFPSNYVRPA 113
           V A Y +E   +GDL  + G +I+VI     +W+      G  N Q GIFP NYV  A
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA 70

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 48  RESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIF 105
           R SV    P      A Y +E  +E +L     DKI  I+    +W+ G+   NG+ G+F
Sbjct: 491 RRSVEPPKPAAPSATAEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLF 550

Query: 106 PSNYV 110
           PSNYV
Sbjct: 551 PSNYV 555

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 7/60 (11%)

Query: 58  LEYVEAIYPFEPQQ-EGDLALKAGDKIQVIEKPSP-----EWFKGKC-NGQVGIFPSNYV 110
           LE+  A+Y F P+  + ++AL  GD + ++ K  P     +W+K +  NG++G  P NY+
Sbjct: 325 LEFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGYIPYNYI 384

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSP--EWFKGKCNGQVGIFPSNYVR 111
           A+YP+E Q + +++L  GD I+VI KP     W  G+ N +  +FP++Y +
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKVI-KPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 32.3 bits (72), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 62  EAIYPFEPQQEGDLALKAGDKIQVIEKPSPE-WFK--GKCNGQVGIFPSNYV 110
           + +Y +    + ++++  GD I V+EK +   W K      G++G+ PS+Y+
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYL 589

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query: 49  ESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVI-EKPSPEWFKGKC--NGQVGIF 105
           E+ S  A T +  +A+Y F      +L +K GD I ++ ++ S +W+  +    G+ GI 
Sbjct: 403 EAASRPAMTKKRAKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIV 462

Query: 106 PSNYVRPAFSGTSQPS 121
           P+ +V    SG+S+PS
Sbjct: 463 PAQFVETRGSGSSRPS 478

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 4/61 (6%)

Query: 54  QAPTLEYVEAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNY 109
           +AP +  V A+Y +E  Q    +L     D  Q+ +    +WF  K   N +VG  P NY
Sbjct: 67  EAPVIGSVVALYDYEQVQNANEELVFHENDTFQLYDDRDADWFLVKNTKNSEVGFVPGNY 126

Query: 110 V 110
           V
Sbjct: 127 V 127

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNY 109
           L   +A+Y +  Q + +L +K GD + ++EK S  +W+  K +  G      VG+ P  Y
Sbjct: 5   LGVYQALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEEA 68

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 48  RESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIF 105
           R ++  +  T  +  A Y ++  +E +L     DKI  IE    +W+ G+   NG+ G+F
Sbjct: 547 RRTMEPKEETKPWATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLF 606

Query: 106 PSNYV 110
           PSNYV
Sbjct: 607 PSNYV 611

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 8/63 (12%)

Query: 55  APTLEYVEAIYPF--EPQQEG---DLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPS 107
            PT+ Y  A+Y +  +P Q+G   DL  K GD I+VI+K    W+ G+     + G FP 
Sbjct: 374 VPTV-YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPV 432

Query: 108 NYV 110
           N+V
Sbjct: 433 NFV 435

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 8/61 (13%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNYVRP 112
           V+A+Y +EPQ + +LA+K  D + ++EK    EW+  K +  G       G+ PSNYV P
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNYVEP 67

Query: 113 A 113
           A
Sbjct: 68  A 68

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 58  LEYVEAIYPFEPQ-QEGDLALKAGDKIQVIEKPSP-----EWFKGKC-NGQVGIFPSNYV 110
           LE+  A++ F P+ ++ +L L  GD + ++ K  P     +W+K +  NG  G  PSNY+
Sbjct: 306 LEFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYVPSNYI 365

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           A Y +E  +E +L    GDKI  IE    +W+ G+    G+ G+FPSNYV
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 632

>SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191W PEX13 Integral peroxisomal membrane receptor
          Length = 408

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 58  LEYVEAIYPFEPQQ-EGDLALKAGDKIQVIEKPSP-----EWFKGKC-NGQVGIFPSNYV 110
           LE+  A+Y F P+  + ++ LK GD + +I K  P     +W+K +   G +G  P NY+
Sbjct: 323 LEFARAVYDFTPENPQIEVTLKKGDLMAIISKQDPIGNESQWWKVRTKKGDIGYVPYNYI 382

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 54  QAPTLEYVEAIYPFEPQQEGD--LALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNY 109
           +AP L+ V AIY +E  Q  D  L     D   V++   P+W   K   + + G  P NY
Sbjct: 67  EAPILKKVRAIYDYEQVQNADEELTFHENDVFNVLDDKDPDWLLVKSTVSNEFGFIPGNY 126

Query: 110 VRPA 113
           V  A
Sbjct: 127 VEGA 130

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 65  YPFEPQQEGDLALKAGDKIQVI-EKPSPEWFKGKC--NGQVGIFPSNYVRPA 113
           Y F  + + +L +K+GDK+ ++ +K S +W+  +   +G+ G+ P+ +V P 
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEPV 405

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWFKGK-------CNGQVGIFPSNY 109
           L    AIY +EPQ   +LA+   D + +++K    +W+  K        +  VG+ PS Y
Sbjct: 5   LGIYRAIYDYEPQTPEELAIHEDDLLYLLQKSDIDDWWTVKRRVIGSDSDEPVGLVPSTY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEEA 68

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query: 54  QAPTLEYVEAIYPFEPQQ--EGDLALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNY 109
           +AP +  V+A+Y +E  Q  E +L     D   V +   P+W   K + + +VG  P NY
Sbjct: 67  EAPVIAQVKALYDYEQIQNPEEELIFHENDLFSVYDDKDPDWLLVKSQISNEVGFVPGNY 126

Query: 110 VRPAFSGTSQP 120
           V+P  S T+ P
Sbjct: 127 VQPV-SATAAP 136

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNY 109
           L   +AIY +EPQ   +L LK  D + ++EK    +W+  K +  G      VG+ PSNY
Sbjct: 5   LGVYKAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEEA 68

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 9/71 (12%)

Query: 56  PTLEYVEAIYPFEPQQEGDLA-LKAGDKIQVIEKPSPEWFKGKC--------NGQVGIFP 106
           P +EY +A+YP    +   LA    GD I + E  + +W+KG+         N +VG+ P
Sbjct: 593 PVIEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIP 652

Query: 107 SNYVRPAFSGT 117
            N+++    G+
Sbjct: 653 YNFIQLLHQGS 663

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 9/91 (9%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGK---CNGQV--GIFPSNYV-RPAF 114
           VEA++P+    E DL    G  I V+E    EWF G+    +G+   GIFP  +V  P  
Sbjct: 7   VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFVSEPLK 66

Query: 115 SGTSQPSKTRLTPGPPQYQASV---ETQSIH 142
              S+P++ +     P  +  V   ETQ+++
Sbjct: 67  ETASEPAQEKQPEEKPNVETPVKIPETQTVN 97

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 36.2 bits (82), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 2/39 (5%)

Query: 75  LALKAGDKIQVIEKP--SPEWFKGKCNGQVGIFPSNYVR 111
           L   AG  I+++++   + EW+ G+ NGQ G+FP NYV+
Sbjct: 1   LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 39

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           A Y +E  ++ +L  +  DKI  IE    +W+ G+   NG+ G+FPSNYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIE-KPSPEWFKGKCNGQVGIFPSNYVR 111
           ++A Y +E Q + +L+L   D + VI       W  G+ NG+ G+FP++Y R
Sbjct: 562 MQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPTSYCR 613

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIE-KPSPEWFKGKCNGQVGIFPSNYV 110
           + A YP+  Q + ++++ AGD I VI       W  G+ NG  G+FP++Y 
Sbjct: 588 MTAKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGVKGLFPTSYC 638

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 56  PTLEYVEAIYPFEPQQEGDLA-LKAGDKIQVIEKPSPEWFKGKC--------NGQVGIFP 106
           P +EY +A+YP    +   LA    GD I + E  + +WFKG+         + +VG+ P
Sbjct: 598 PVIEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIP 657

Query: 107 SNYVRPAFSG 116
            N+++    G
Sbjct: 658 YNFIQLLHQG 667

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQ-----VGIFPSNYVR 111
           V A+  +EPQ   DL +  GDKI V+      W+ G+   +      GIFPS++V+
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK 66

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 43  DPNGSRESVSSQAPTLEYVEAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKC-- 98
           D + +  S+    PT+ Y   +Y +EPQ      L++K GD IQ+I +    W+ G    
Sbjct: 345 DDSSNSNSLQKAVPTM-YATVLYDYEPQFNDPQYLSIKKGDTIQIITQSKNGWWYGDLLR 403

Query: 99  NGQVGIFPSNYVR 111
               G+FP +YV+
Sbjct: 404 TKTKGLFPQSYVQ 416

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 61  VEAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
           V+A+Y ++       +L+ + GD ++V +     W   K NGQ GI PSNYV+
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 4/63 (6%)

Query: 54  QAPTLEYVEAIYPFEPQQEGD--LALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNY 109
           +AP L+ V AIY +E  Q  D  L     D   V++    +W   K   + + G  P NY
Sbjct: 67  EAPILKKVRAIYDYEQVQNADEELTFHENDVFDVLDDKDVDWLLVKSTVSNEFGFIPGNY 126

Query: 110 VRP 112
           V P
Sbjct: 127 VEP 129

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 17  LDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLA 76
           L+    +N   EE  N I        DP      ++S++     V+  Y F  + + +L 
Sbjct: 309 LELHTGNNNTCEEIMNIIGEYKGASRDPGLKEVEMASKSKKRGIVQ--YNFMAESQDELT 366

Query: 77  LKAGDKIQVIE-KPSPEWFKGKC--NGQVGIFPSNYVRPA 113
           +K+GDK+ +++ K S +W+  +   +G+ G+ P+ ++ P 
Sbjct: 367 VKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEPV 406

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNY 109
           L    AIY +EPQ   +LA++  D + ++ K    +W+  K +  G      VG+ PS Y
Sbjct: 5   LGIYRAIYAYEPQTPEELAIEEDDLLYLLHKSDVDDWWTVKKRVIGSDSEEPVGLVPSTY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEEA 68

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 4/67 (5%)

Query: 54  QAPTLEYVEAIYPFEPQQEGD--LALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNY 109
           QAP +  V A+Y ++  Q  D  L     ++  V +   P+W   + K  G  G  P NY
Sbjct: 67  QAPVINSVRALYDYDQAQNPDEELTFHENEEFDVYDDQDPDWLLVQQKSTGACGFVPGNY 126

Query: 110 VRPAFSG 116
           V P   G
Sbjct: 127 VEPCGQG 133

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWFKGK-------CNGQVGIFPSNY 109
           L   +A+Y +EPQ   +LA++  + + ++EK    EW+  K        +  VG+ PSNY
Sbjct: 5   LGVYKALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNY 64

Query: 110 VRPA 113
           V  A
Sbjct: 65  VEQA 68

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 54  QAPTLEYVEAIYPF-EPQ-QEGDLALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNY 109
           +AP +  ++A+Y + E Q QE +L     D   V +   P+W   K + + +VG  P NY
Sbjct: 67  EAPAISQMKALYDYTEAQNQEEELTFHENDIFDVYDDKDPDWLLVKSRTSNEVGFIPGNY 126

Query: 110 VRPA 113
           V P 
Sbjct: 127 VEPV 130

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNY 109
           L   +AIY +EPQ   +L +   D + ++EK    EW+  K +  G      VG+ PSNY
Sbjct: 5   LGVYKAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEEA 68

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYVR 111
           A Y  E ++  +LA K GDKI  I     +W+ G+    G+ G+FPSNYV+
Sbjct: 578 AEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 886

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 11/68 (16%)

Query: 50  SVSSQAPTLEY-VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG------KCNGQV 102
           SVS Q P L + V+A Y +  Q +GDL    GD ++V  + + +WF G      KC+   
Sbjct: 2   SVSIQVPPLPFKVKARYGWSGQTKGDLGFLEGDVMEVT-RITGDWFYGRLLRNKKCS--- 57

Query: 103 GIFPSNYV 110
           G FP+N+V
Sbjct: 58  GYFPNNFV 65

>AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON}
           NOHBY516; No homolog in Saccharomyces cerevisiae'
          Length = 414

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 6/74 (8%)

Query: 43  DPNGSR-ESVSSQAPTLEYVEAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKC- 98
           + +GSR  + S   PT+ Y  A+Y ++PQ      L++K GD IQVI +    W+ G   
Sbjct: 336 NDDGSRANAFSGIIPTV-YATALYDYDPQFNDPQYLSIKKGDIIQVITQSKNGWWYGDLL 394

Query: 99  -NGQVGIFPSNYVR 111
                G+FP +YV+
Sbjct: 395 RTKTKGLFPQSYVQ 408

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           +  A Y ++  +E +L     DKI  IE    +W+ G+   NG+ G+FPSNYV
Sbjct: 519 WALAEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 56  PTLEYVEAIYPFEPQQEGDLA-LKAGDKIQVIEKPSPEWFKGKC--------NGQVGIFP 106
           P +EY +A+YP    +   LA    GD + + E  + +W+KG+         N ++G+ P
Sbjct: 599 PVIEYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIP 658

Query: 107 SNYVRPAFSG 116
            N+++    G
Sbjct: 659 YNFIQLLHQG 668

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 55  APTLEYVEAIYPFE----PQQEGDLALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSN 108
           AP +  + A+Y F+    PQ+E  L  K  D   V +   P+W   +   + + G  P N
Sbjct: 68  APVISTMRALYDFDQAQNPQEE--LVFKENDMFDVYDDKDPDWILVRSHSSNEYGFVPGN 125

Query: 109 YVRPA 113
           YV PA
Sbjct: 126 YVEPA 130

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVI-EKPSPEWFKGKC--NGQVGIFPSNYV 110
           A+Y FE +   +L ++ GD + VI +K S +W+  +   NG+ G+ P+ ++
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFI 427

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNY 109
           L   +A+Y +EPQ   +LA++  D + ++EK    +W+  K +  G       G+ PSNY
Sbjct: 5   LGVYKAVYSYEPQTPEELAIQEDDLLYLLEKSEVDDWWTVKKRIIGSDAEEPQGLVPSNY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEAA 68

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           A Y ++  ++ +L    GDKI  IE    +W+ G+    G+ G+FPSNYV
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           +  A Y +E  ++ +L  +  DKI  IE    +W+ G+    G+ G+FPSNYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query: 54  QAPTLEYVEAIYPFEPQQEGD--LALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNY 109
           ++P +    A+Y ++  Q  D  LA K  D   + +   P+W   + + +G VG  P NY
Sbjct: 67  ESPVIGQWRALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVGFVPGNY 126

Query: 110 VRP 112
           V P
Sbjct: 127 VEP 129

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 8/61 (13%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNY 109
           L   +A+Y +EPQ E +LA++  D + +++K    +W+  K +  G       G+ PSNY
Sbjct: 5   LGVYKAVYDYEPQTEEELAVRENDMLYLLQKSDVDDWWTVKKRVIGSDVEEPSGLVPSNY 64

Query: 110 V 110
           +
Sbjct: 65  I 65

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           A Y +E  ++ +L     DKI  IE    +W+ G+   +G+ G+FPSNYV
Sbjct: 523 AQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYV 572

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 4/64 (6%)

Query: 54  QAPTLEYVEAIYPFEPQQEGD--LALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNY 109
           +AP L+ V AIY +   Q  D  L     D   V +    +W   K   + + G  P NY
Sbjct: 67  EAPVLKKVRAIYDYGQVQNADEELTFHENDTFDVFDDNDADWLLVKSTVSNEFGFIPGNY 126

Query: 110 VRPA 113
           V PA
Sbjct: 127 VEPA 130

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 48/100 (48%), Gaps = 5/100 (5%)

Query: 17  LDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLA 76
           L+    +    EE  N I        DP      ++S++     V+  Y F  + + +L 
Sbjct: 313 LELHTGNTTTCEEIMNIIGEYKGASRDPGLKEVEMASKSKKRGVVQ--YDFMAESQDELT 370

Query: 77  LKAGDKIQVI-EKPSPEWFKGKC--NGQVGIFPSNYVRPA 113
           +K+GDK+ ++ +K S +W+  +   +G+ G+ P+ ++ P 
Sbjct: 371 IKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIEPV 410

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNY 109
           L    AIY +EPQ   +LA++  D + +++K    +W+  K +  G      VG+ PS Y
Sbjct: 5   LGIYRAIYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEEA 68

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 48  RESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGK--CNGQVGIF 105
           R+  + + P L    A Y ++  ++ +L    G KI  IE    +W+ G+    G+ G+F
Sbjct: 460 RKVATQEKPALATAVAEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKGLF 519

Query: 106 PSNYV 110
           P+NYV
Sbjct: 520 PANYV 524

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
           Anc_2.319 YDL117W
          Length = 864

 Score = 37.4 bits (85), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 11/66 (16%)

Query: 54  QAPTLEY-VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG------KCNGQVGIFP 106
           QA TL + V A Y +  Q +GDL    GD ++V  + + +WF G      KC    G FP
Sbjct: 5   QATTLPFKVRARYGWSGQTKGDLGFLEGDIMEVT-RVAGDWFYGRLLRNKKC---AGYFP 60

Query: 107 SNYVRP 112
           +N+V P
Sbjct: 61  NNFVIP 66

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           A Y +E  ++ +L  + GD I  I+    +W+ G+    GQ G+FPSNYV
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYV 574

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 56  PTLEYVEAIYPFEPQQEGDLA-LKAGDKIQVIEKPSPEWFKGKC--------NGQVGIFP 106
           P +EY +A+YP    +   LA    GD + + E  + +W+KG+         + +VG+ P
Sbjct: 599 PVIEYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIP 658

Query: 107 SNYVRPAFSG 116
            N+++    G
Sbjct: 659 YNFIQLLHQG 668

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 6/101 (5%)

Query: 45  NGSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQV 102
           NG   S S++ P +  ++A+Y +  Q  G+L+   G+ + VI +   EWF+     +G+ 
Sbjct: 55  NGGGVSPSNEVPII--LKALYTYHAQSPGELSFTKGELVHVIGEDG-EWFEVSSPDSGRK 111

Query: 103 GIFPSNYVRPAFSGTSQPSKTRLTPGPPQYQASVETQSIHS 143
           G+ P +Y  P  S +   S   +   P Q   SV+  S+++
Sbjct: 112 GMVPKSYFEPV-SRSRVVSTQSILVSPQQAMQSVKAGSLYA 151

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 62  EAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
           EA+Y ++  Q    +++ + G+ ++V +     W   K NG+ GI PSNYV+
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYVR 111
           A Y  E ++  +LA + GDKI  I     +W+ G+    G+ G+FPSNYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 62  EAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
           +A+YP++   E   +++ +  + +QV +     W   + NG+ GI PSNYV+
Sbjct: 307 KALYPYDADDEDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W
           (HOF1) - SH3 domain containing-protein [contig 59] FULL
          Length = 627

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 9/68 (13%)

Query: 52  SSQAPTLEYVEAIYPF-EPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--------NGQV 102
           S +   L+Y +A+Y F E  ++  +  +AGD + + E+   +WF G+           + 
Sbjct: 556 SKEEKVLKYAKALYTFMEANEQQIVNFRAGDYLLLTEQLDQDWFIGEVLDSHDVEPEYRY 615

Query: 103 GIFPSNYV 110
           GI P NY+
Sbjct: 616 GIIPRNYI 623

>ADL038W Chr4 (623309..627838) [4530 bp, 1509 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR310C (CDC25),
           YLL016W and YLL017W; YLL016W and YLL017W represent one
           ORF in this genome
          Length = 1509

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 34/76 (44%), Gaps = 16/76 (21%)

Query: 52  SSQAPTL----EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG-------KCNG 100
           SSQ PTL    + V A+  F P ++  L LKAGD + V+ +    W  G       K N 
Sbjct: 7   SSQPPTLVKCKDVVRALCDFVPLKKQHLPLKAGDVVYVLSRHESGWCDGIIIEQTAKGNS 66

Query: 101 QV-----GIFPSNYVR 111
            V     G FP  Y R
Sbjct: 67  TVTQCQRGWFPRTYTR 82

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 36.6 bits (83), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 7/60 (11%)

Query: 58  LEYVEAIYPFEPQQEG-DLALKAGDKIQVIEKPSP-----EWFKGKC-NGQVGIFPSNYV 110
           LE+  AIY F P+    ++ L+ GD + ++ K        +W+K +  NG VG  P NY+
Sbjct: 259 LEFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPFNYI 318

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 38  LPQRYDPNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGK 97
           LP R+  N +    +S  P+     A Y ++  ++ +L  +  DKI  IE    +W+ G+
Sbjct: 593 LPARHVENENESGNTSSNPS---AIAEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGE 649

Query: 98  C--NGQVGIFPSNYV 110
               G+ G+FPSNYV
Sbjct: 650 LGSTGEKGLFPSNYV 664

>TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.365
           YLR191W
          Length = 389

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 58  LEYVEAIYPFEPQQ-EGDLALKAGDKIQVIEKP-----SPEWFKGKC-NGQVGIFPSNYV 110
           LE+  A+Y F P+  + ++ LK GD + ++ K        EW+K +  +G +G  P NY+
Sbjct: 308 LEFARALYDFTPENPQMEVTLKKGDLMAIMSKQDSLGRDSEWWKVRTKSGDIGYVPFNYI 367

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 53  SQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVI-EKPSPEWFKGKCNGQVGIFPSNYVR 111
           S+ P+L  +   Y ++ Q+E ++ ++ GD + V+ E     W   + +G  G+ P+NY +
Sbjct: 601 SKKPSL-TLTVQYDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNYCK 659

>TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.413
           YER114C
          Length = 978

 Score = 36.6 bits (83), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 14/98 (14%)

Query: 38  LPQRYDPNGSRES----VSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPE- 92
           L   YD + + ES    V+  + T     AI  +E + E +L ++ GDKIQVI   S   
Sbjct: 9   LAHYYDVDSNLESPTSIVNGSSKTFPLYIAINQYEKRMEDELNMQLGDKIQVITDDSEYN 68

Query: 93  --WFKGKC--NGQVGIFPSNYVRPAFSGTSQPSKTRLT 126
             W+ GK     + G++P       F+ T  P + +LT
Sbjct: 69  DGWYYGKNLRTQEEGLYPV-----VFTQTFVPDRVQLT 101

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 48/100 (48%), Gaps = 5/100 (5%)

Query: 17  LDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLA 76
           L+    +    EE  N I        DP      ++S++     V+  Y F  + + +L 
Sbjct: 316 LELHTGNTTTCEEIMNIIGEYKGASRDPGLREVEMASKSKKRGIVQ--YDFMAESQDELT 373

Query: 77  LKAGDKIQVI-EKPSPEWFKGKC--NGQVGIFPSNYVRPA 113
           +K+GDK+ ++ +K S +W+  +   +G+ G+ P+ ++ P 
Sbjct: 374 IKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPV 413

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 4/70 (5%)

Query: 54  QAPTLEYVEAIYPFEPQQEGD--LALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNY 109
           +AP L+ V AIY +E  Q  D  L     D   V +    +W   K   + + G  P NY
Sbjct: 67  EAPVLKKVRAIYDYEQVQNADEELTFHENDVFDVFDDKDADWLLVKSTVSNEFGFIPGNY 126

Query: 110 VRPAFSGTSQ 119
           V P    TS+
Sbjct: 127 VEPENGSTSK 136

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNY 109
           L    A+Y +EPQ   +LA++  D + +++K    +W+  K +  G      VG+ PS Y
Sbjct: 5   LGIYRAVYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEEA 68

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 33  QINNQLPQRYDPNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPE 92
            I N LP   + +G ++    ++    Y   +Y FE  +E +L + AG+ + +      E
Sbjct: 141 DIENLLPDSKEISGDKKKKIFKSL---YALCLYDFEAAKEDELTVYAGETLFIYAHYEEE 197

Query: 93  WFKGKCNGQVG 103
           WF G+  G++G
Sbjct: 198 WFIGRPLGRIG 208

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 4/67 (5%)

Query: 54  QAPTLEYVEAIYPFEPQQEGD--LALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNY 109
           +AP +  V+AIY ++  Q  D  L     +   V +    +W   K +   QVG  P NY
Sbjct: 67  EAPIISQVKAIYNYDEAQNPDEELLFNENEIFDVFDDRDQDWLLVKSRSANQVGFVPGNY 126

Query: 110 VRPAFSG 116
           V P   G
Sbjct: 127 VEPISGG 133

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWFKGK-------CNGQVGIFPSNY 109
           L   +A+Y +EPQ   +LA++  D + ++EK    +W+  K        +   G+ PSNY
Sbjct: 5   LGIYKAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWWTVKKRVLGTDADEPTGLVPSNY 64

Query: 110 VRPA 113
           V  A
Sbjct: 65  VEEA 68

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 46  GSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVI-EKPSPEWFKGKC--NGQV 102
           G RE V   + T    +  Y F  +   +L + AGD + VI ++ S EW+  +    G+ 
Sbjct: 385 GLRE-VQQASQTKRKAQISYDFLAESHDELTVHAGDAVYVIDDQKSSEWWMVELISTGKK 443

Query: 103 GIFPSNYVRP 112
           G+ P+++V P
Sbjct: 444 GVVPADFVEP 453

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 36.2 bits (82), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           +  A Y +E  ++ +L     DKI  IE    +W+ G+   +G+ G+FPSNYV
Sbjct: 538 WAIAEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEKGLFPSNYV 590

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1537

 Score = 35.8 bits (81), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 39  PQRYDPNGSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG-- 96
           PQ    N  +  +S+    L+ V A Y F P ++  L   AGD I VI K    W+ G  
Sbjct: 4   PQDEGMNPPKAGLSTIIKPLDIVIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGIL 63

Query: 97  ---KCNGQVGIFPSNYVR 111
              K     G FP +Y +
Sbjct: 64  YYNKSLVLRGWFPRSYTK 81

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 35.4 bits (80), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 61  VEAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
            +A+YP++   +   +++ +  + +QV +     W   + NG+ GI PSNYV+
Sbjct: 306 AKALYPYDADGDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 35.8 bits (81), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           +  A Y ++  ++ +L     DKI  IE    +W+ G+   +G  G+FPSNYV
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 35.8 bits (81), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           +  A Y ++  ++ +L     DKI  IE    +W+ G+   +G  G+FPSNYV
Sbjct: 535 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 59/123 (47%), Gaps = 28/123 (22%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG------KCNGQVGIFPSNYVR--- 111
           V+A Y +  Q +GDL    GD ++V  K + +W+ G      KC+   G FP+N+V+   
Sbjct: 15  VKAKYGWSGQAKGDLGFLEGDVMEVT-KITGDWYYGRLLRNRKCS---GYFPNNFVKIVE 70

Query: 112 --------PAFSGTSQPSKTRLTPGPPQYQAS-------VETQSIHSSSNVSYQPPFPPA 156
                    +   +S P+K + +  P Q +AS       + ++S+  SS  S + P   +
Sbjct: 71  ERLNETSNTSTPTSSHPNKKKDSKVPKQQEASNKVVIPPIPSRSVDHSSTRSSRKPTSAS 130

Query: 157 STN 159
           +TN
Sbjct: 131 TTN 133

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 35.8 bits (81), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 13/86 (15%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG---KCNGQVGIFPSNYVRPAFSGT 117
           V+A Y +  Q +GDL    GD I  + K + +W+ G   +     G FP N+V    +G 
Sbjct: 7   VKARYGWSGQAKGDLGFLEGD-IMNVTKTTGDWYYGFLLRNKKSKGYFPKNFV-IELNGK 64

Query: 118 SQPSKTRLT--------PGPPQYQAS 135
           ++PS   +T        P   +Y+AS
Sbjct: 65  TKPSVEAITADAKLPNIPSRSKYEAS 90

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           +  A Y ++  ++ +L     DKI  IE    +W+ G+   +G  G+FPSNYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>NDAI0C02830 Chr3 complement(651724..654657) [2934 bp, 977 aa] {ON}
           Anc_5.170
          Length = 977

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 51  VSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQV----GIFP 106
           +S  AP  + V A +P++   E DL  +    I V      EW+ G+ N       GIFP
Sbjct: 1   MSEPAPPFKVV-AQFPYQSGYEDDLNFEKDQVITVTSIEDDEWYYGEYNDGTHVLEGIFP 59

Query: 107 SNYVRPAFSGTSQPSKTRLTPGPPQYQASVETQSIHSSSNVSYQPPFPPASTN 159
            ++V  A +   +P++ +L    P     V ++S+     ++  PP P   +N
Sbjct: 60  KSFV--AVALEKEPTQKQLPTVQPVEPEHVLSKSLPQEDVITDIPPVPHTVSN 110

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNYVRPAFSG 116
           ++  A+Y FEP+ + +L LK  D + +  K    W   + +   Q G+ P  YV    SG
Sbjct: 107 QWAVALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEYVSYLESG 166

Query: 117 TSQPSKT 123
               + T
Sbjct: 167 EEDVAAT 173

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
           V+A +P++ + E DL       I V      EW+ G+   + GIFP ++V+
Sbjct: 10  VQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

>KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain- containing protein
           required for cytokinesis
          Length = 600

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 58  LEYVEAIYPF-EPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--------NGQVGIFPSN 108
           L Y +A+Y F EP ++  +    GD + + E+   +WF G+           + GI P N
Sbjct: 535 LRYAKALYTFMEPNEQQIVNFHVGDYLLLTEQLDQDWFIGEVLDSQNVDPEYRYGIIPRN 594

Query: 109 YV 110
           Y+
Sbjct: 595 YI 596

>KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.170
           YJL020C
          Length = 855

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCN---GQV--GIFPSNYV 110
           A + +E + E DL  KAG KI V      EW+ G+     G V  GIFP ++V
Sbjct: 12  AQFAYESEFEDDLNFKAGQKITVTAIEDDEWYAGEYEADGGTVASGIFPKSFV 64

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF}
          Non-essential Ras guanine nucleotide exchange factor
          (GEF) localized to the membrane; expressed in poor
          nutrients and on non-fermentable carbon sources;
          homologous to CDC25; contains a stop codon in S288C;
          full-length gene includes YLL016W
          Length = 103

 Score = 33.1 bits (74), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 58 LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG 96
          ++ VE  Y +  +    L+L+ GD I V+ K S  W+ G
Sbjct: 28 IDVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>KLTH0D16434g Chr4 complement(1358785..1360170) [1386 bp, 461 aa]
           {ON} conserved hypothetical protein
          Length = 461

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 50  SVSSQAPTLEYVEAIYPF---EPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGI 104
           +V    PTL Y  AI+ F   EP    DL+    D I+VI++    W+ G+     Q G 
Sbjct: 391 AVRGTVPTL-YATAIFGFSSTEPTHSDDLSFCRNDIIKVIKRNENGWWYGEVIRTKQRGY 449

Query: 105 FPSNYV 110
           FP++ V
Sbjct: 450 FPASCV 455

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNYV 110
           AIY F P+ + +LALK GD + +  K    W   + +   + G+ P  YV
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEYV 144

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 10/56 (17%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG------KCNGQVGIFPSNYV 110
           V A Y +  Q +GDL    GD ++V +K + +WF G      KC+   G FP N+V
Sbjct: 10  VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCS---GYFPKNFV 61

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           +  A Y ++  ++ +L     DKI  IE    +W+ G+   +G  G+FPSNYV
Sbjct: 536 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 62  EAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
           +A+Y ++       +++ + G+ ++V +     W   + NGQVGI PSNYV+
Sbjct: 300 KALYSYQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQ 351

>CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar to
           uniprot|Q12163 Saccharomyces cerevisiae YDR162c NBP2
           NAP1P-binding protein
          Length = 213

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQ--VGIFPSNYV 110
           A+Y FEP+ + +L LK GD I +  +    W   + + Q   G+ P  +V
Sbjct: 101 ALYDFEPENDNELGLKEGDVIFISYRHCQGWLVAQNDTQTKTGLVPEEFV 150

>NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.319
           YDL117W
          Length = 919

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC---NGQVGIFPSNYV 110
           V A Y +  Q +GDL    GD ++V  + + +WF GK        G FP+N+V
Sbjct: 15  VRAKYGWSGQAKGDLGFLEGDIMEVT-RVAGDWFYGKLLRNRKCAGYFPNNFV 66

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 7/76 (9%)

Query: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKP---SPEWFKGKC--NGQVGIFPSNYVRPAF 114
           YV  +  +  + E ++ +K GDKI+V+         W++GK     QVG++P+ + +P  
Sbjct: 5   YV-CVNEYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQPIG 63

Query: 115 SGTSQPSKT-RLTPGP 129
             T   +K+ R  P P
Sbjct: 64  HTTRTTAKSDRRVPTP 79

>Skud_10.200 Chr10 complement(366708..370013) [3306 bp, 1101 aa]
           {ON} YJL020C (REAL)
          Length = 1101

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGK---CNGQV--GIFPSNYVRPAFS 115
           V A +P++   E DL  +   +I +      EW+ G+    +G +  GIFP ++V    S
Sbjct: 10  VVAQFPYKSDYEDDLNFEKDQEITITSVEDAEWYYGEYRDSSGDIVEGIFPKSFVAIQTS 69

Query: 116 GTSQPSKTRLTPGPPQ 131
           G+ + S++  T  P Q
Sbjct: 70  GSLKESESAATAAPTQ 85

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 61  VEAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYV 110
           V+A+Y ++       +++   G+ ++V +     W   + NGQ GI PSNYV
Sbjct: 311 VKALYSYQADDADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYV 362

>TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa]
           {ON} Anc_7.365 YLR191W
          Length = 413

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 8/72 (11%)

Query: 47  SRESVSSQAPT-LEYVEAIYPFEPQQ-EGDLALKAGDKIQVIEKPS-----PEWFKGKC- 98
           SR  + S  P+ LE+  A+Y F P+    +  +K G+ + ++++        EW+K +  
Sbjct: 319 SRGDIHSLDPSRLEFGRALYDFIPENPRIEATMKKGELLAILDRRDVFGNESEWWKVRTK 378

Query: 99  NGQVGIFPSNYV 110
           NG  G  P NY+
Sbjct: 379 NGSTGYVPYNYI 390

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNY 109
           L   +A++ +EPQ + +LA+  GD + +++K    +W+  K +  G      VG+ P+NY
Sbjct: 5   LGIYKAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEEA 68

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQV-GIFPSNYV 110
           V+A Y +  Q +GDL    GD ++V  + + +WF GK   N +  G FP+N+V
Sbjct: 13  VKARYGWSGQTKGDLGFLEGDVMEVT-RITGDWFYGKLLRNKKCSGYFPNNFV 64

>KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {ON}
           Anc_8.344 YDR162C
          Length = 249

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 39/88 (44%), Gaps = 4/88 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNYVRPAFSGTSQP 120
           A+Y FEP+ + +L L  GD + +  +    W   + +   + G+ P  +V  +F    + 
Sbjct: 117 ALYDFEPENDNELGLHEGDIVFISYRHGQGWLVAENQPRTKTGLVPEEFV--SFLDNDEE 174

Query: 121 SKTRLTPGPPQYQASVETQSIHSSSNVS 148
            K       P Y     +Q + +S ++S
Sbjct: 175 DKEAHDMARPFYLTHFISQGLQNSKDIS 202

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWFKGK-------CNGQVGIFPSNY 109
           L   +AIY +EPQ + +L ++  D + V+EK    +W+  K           VG+ P+NY
Sbjct: 5   LGVYKAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEEA 68

>YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}
           NBP2Protein involved in the HOG (high osmolarity
           glycerol) pathway, negatively regulates Hog1p by
           recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex, found in the nucleus and cytoplasm, contains an
           SH3 domain that binds Pbs2p
          Length = 236

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 10/91 (10%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPS---NYVRPAFSGT 117
           A+Y FEP+ + +L L  GD + +  K    W   + +   + G+ P    +Y++P     
Sbjct: 117 ALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPEDGEN 176

Query: 118 SQPSKTRLTPGPPQYQASVETQSIHSSSNVS 148
              +K R     P Y   + TQS+   +N+ 
Sbjct: 177 EVENKAR-----PFYLTHLITQSVSPKNNID 202

>Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON}
           (60698..63340) [2643 nt, 881 aa]
          Length = 880

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 7/72 (9%)

Query: 47  SRESVSS--QAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVI---EKPSPEWFKGKC--N 99
           SRES S+  Q  +     AI  +  + E +L  K GDKIQVI   E+ +  W+ GK    
Sbjct: 20  SRESSSTVIQTKSFPIYIAINEYSRRMEDELDFKPGDKIQVITDDEEYNDGWYYGKNLRT 79

Query: 100 GQVGIFPSNYVR 111
            Q G++P+ + +
Sbjct: 80  QQEGLYPAVFTQ 91

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 62  EAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYV 110
           +A+Y +E       +++ + G+ ++V +     W   K NG+ GI PSNYV
Sbjct: 271 KALYAYEADASDAYEISFQQGEILRVGDIEGRWWKAKKANGETGIIPSNYV 321

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 13/103 (12%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPE-WFKGK--CNGQVGIFPSNYVRPAFSGTSQ 119
            +YP+  Q   ++ +  GD I ++ K +   W K K    G++G+ PS+YV    S  S 
Sbjct: 499 VLYPYAKQDADEVTINPGDLISLVTKDTGSGWTKIKNSTTGEMGLVPSSYVDIKESTHSV 558

Query: 120 P---------SKTRLTPGPPQYQASVETQ-SIHSSSNVSYQPP 152
           P         S  R       YQA  + + SI++ S V    P
Sbjct: 559 PHAPPPRKCVSSVRTIEALYDYQAQGDDELSIYAGSVVKVLKP 601

>KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {ON}
           Anc_7.413 YER114C
          Length = 930

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVI---EKPSPEWFKGKC--NGQVGIFP 106
           A+  +  + E ++++K GDKIQVI   E  +  W+ G+    G+ G+FP
Sbjct: 33  AVSAYTKRMEDEISIKPGDKIQVITDDEDYNDGWYVGRNLRTGKEGLFP 81

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 9/75 (12%)

Query: 44  PNGSRESVSSQAPTL----EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG--- 96
           P  S E   S   TL    + V A Y + P ++  L L  GD + V+ K    W+ G   
Sbjct: 5   PVPSHEETGSSGSTLVRPVDVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIIL 64

Query: 97  KCNGQV--GIFPSNY 109
             N +   G FP NY
Sbjct: 65  DSNNKASRGWFPCNY 79

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 43  DPNGSRESVSSQAPTLEYV-EAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCN 99
           D  G    V  +  +  Y   A+Y +E  +    +++ + G+ ++V +     W   + N
Sbjct: 253 DTLGLYSDVGDELISFPYTSRALYAYEADESDAYEISFQQGEILRVGDIEGRWWKAKRSN 312

Query: 100 GQVGIFPSNYV 110
           G+ GI PSNYV
Sbjct: 313 GETGIIPSNYV 323

>Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON}
           complement(1407..2084) [678 nt, 226 aa]
          Length = 225

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 4/90 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNG--QVGIFPSNYVRPAFSGTSQP 120
           A+Y F P+ + +L L+ GD + +  K    W   +  G  + G+ P  +V          
Sbjct: 107 ALYDFVPENDSELGLEEGDIVFISYKHGQGWLVAENQGRTKTGLVPEEFV-SFLEDDEDY 165

Query: 121 SKTRLTPGPPQYQASVETQSIHS-SSNVSY 149
                    P Y     TQSI+S S+N SY
Sbjct: 166 EDEDEDKARPFYLTQFITQSINSTSTNTSY 195

>CAGL0M00858g Chr13 complement(95426..96373) [948 bp, 315 aa] {ON}
           similar to uniprot|P36517 Saccharomyces cerevisiae
           YLR439w MRPL4
          Length = 315

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 7/56 (12%)

Query: 111 RPAFSGTSQPSKTRLTPGPPQ-------YQASVETQSIHSSSNVSYQPPFPPASTN 159
           R   SG  Q ++TR T   P+        Q  + TQ  H S+ +  QPP PP++ N
Sbjct: 4   RQFHSGCVQLARTRYTKPKPKNTETRAKEQIRLPTQQTHHSNELRIQPPIPPSTKN 59

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 10/85 (11%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPS---NYVRPAFSGT 117
           A+Y FEP+ + +L L  GD + +  K    W   + +   + G+ P    +Y++P     
Sbjct: 117 ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENESRSKTGLVPEEFVSYIQPEDGEE 176

Query: 118 SQPSKTRLTPGPPQYQASVETQSIH 142
            Q    R     P Y   + TQS++
Sbjct: 177 EQEDTAR-----PFYLTHLITQSVN 196

>KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4.108
           YBL007C
          Length = 1203

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 62  EAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNYVRPA 113
           +AIY +EPQ   +LAL+  D + ++EK    +W+  K +  G       G+ PSNY+  A
Sbjct: 9   KAIYSYEPQTPEELALQEDDFLYLLEKSEVDDWWTVKKRVIGSDAEEPSGLVPSNYIETA 68

 Score = 32.7 bits (73), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 44/105 (41%), Gaps = 14/105 (13%)

Query: 55  APTLEYVEAIYPFEPQQEGD--LALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPSNYV 110
           AP +  V+A Y +E  Q  D  L     D  +V +    +W   K     + G  P NYV
Sbjct: 68  APVISKVKASYDYEQVQNPDEELTFHENDIFEVYDDKDQDWLLVKSLSTNEFGFVPGNYV 127

Query: 111 RPAFSG---TSQPSKTRLTPGPPQYQASVETQSIHSSSNVSYQPP 152
            P   G   TS P    +T   P  Q +  T ++ ++   ++ PP
Sbjct: 128 EPYTEGAMATSGP----ITANLPTAQPTTATSNVGAA---TFMPP 165

>Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}
           YDR162C (REAL)
          Length = 240

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 10/89 (11%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWF--KGKCNGQVGIFPS---NYVRPAFSGT 117
           A+Y FEP+ + +L L  GD + +  K    W   + +   + G+ P     Y++P     
Sbjct: 117 ALYDFEPENDNELKLTEGDLVFISYKHGQGWLVAENESRSKTGLVPEEFVTYIQPEDGEE 176

Query: 118 SQPSKTRLTPGPPQYQASVETQSIHSSSN 146
            +    R     P Y   + TQS++  +N
Sbjct: 177 EKDDTAR-----PFYLTHLITQSVNPENN 200

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQVGIFPSNYV 110
           A Y +E  ++ +L  +  ++I  I+    +W+ G+   +G+ G+FPSNYV
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 32.3 bits (72), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNG--QVGIFPSNYVR 111
           A+Y F P+ + +L LK GD + +  K    W   + +   + G+ P  YV+
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQ 117

>Smik_10.251 Chr10 complement(395243..398611) [3369 bp, 1122 aa]
           {ON} YJL020C (REAL)
          Length = 1122

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGK---CNGQV--GIFPSNYVRPAFS 115
           V A +P++   E DL  +   +I V      EW+ G+    NG+V  GIFP ++V    S
Sbjct: 10  VVAQFPYKSDYEDDLNFEKDQEITVTSVEDAEWYFGEYQDSNGEVIEGIFPKSFVAAQVS 69

Query: 116 GTSQPSKTRLTPGPPQ 131
            + +  ++     P Q
Sbjct: 70  ESGEKVESPAIAAPTQ 85

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGK-CNG-QVGIFPSNYV 110
           V A+Y F P+ + +L LK GD I +  K    W   +  +G + G+ P  YV
Sbjct: 119 VVALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEYV 170

>TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1136

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWF--KGKCNGQ-----VGIFPSNY 109
           L   +AIY +EPQ   +LA++  D + ++EK    +W+  K +  G       G+ PSNY
Sbjct: 5   LGIYKAIYNYEPQTPEELAIQEDDLLYLLEKSDVDDWWTVKKRVIGSDAEEPSGLIPSNY 64

Query: 110 VRPA 113
           +  A
Sbjct: 65  IEEA 68

>TDEL0C02730 Chr3 complement(479746..482796) [3051 bp, 1016 aa] {ON}
           Anc_7.413 YER114C
          Length = 1016

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 50  SVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVI---EKPSPEWFKGKC--NGQVGI 104
           S S   P   Y+ AI  +  + E +L +K GDKIQVI   E+ +  WF G+     + G+
Sbjct: 33  SSSGMKPCPMYI-AINEYTKRMEDELDMKPGDKIQVITTDEEYNDGWFYGRNLRTKEEGL 91

Query: 105 FP 106
           +P
Sbjct: 92  YP 93

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 32.3 bits (72), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 62  EAIYPFEPQ--QEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYV 110
           +A+Y ++     + +++ + G+ ++V +     W   + NG+ GI PSNYV
Sbjct: 287 KALYSYDADSNDQYEVSFEQGEILKVSDIEGRWWKARRANGETGIIPSNYV 337

>KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} similar
           to uniprot|P39969 Saccharomyces cerevisiae YER114C BOI2
           Protein implicated in polar growth functionally
           redundant with Boi1p interacts with bud- emergence
           protein Bem1p contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1025

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 46  GSRESVSSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVI---EKPSPEWFKGKC--NG 100
           GS ES+ S +    Y+  I  +  + E +L +K GDKIQVI   E+ +  W+ G+     
Sbjct: 22  GSEESLGSISSGPLYI-TITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTN 80

Query: 101 QVGIFPSNYVR 111
           + G++P  + +
Sbjct: 81  EEGLYPKVFTQ 91

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 62  EAIYPFEPQQEGDLALKAGDKIQVIEKPS-PEWFKGK-------CNGQVGIFPSNYVRPA 113
           +AIY +EPQ   +L ++  D + ++EK +  +W+  K        +   G+ PSNYV  A
Sbjct: 9   KAIYNYEPQTPDELTIQEDDLLYLLEKSNVDDWWTVKKRVIGSDIDEPAGLVPSNYVEVA 68

>TBLA0C06440 Chr3 (1558190..1562134) [3945 bp, 1314 aa] {ON}
           Anc_5.170 YJL020C
          Length = 1314

 Score = 32.7 bits (73), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNG-----QVGIFPSNYVRPAFS 115
           V A +P+  + E DL       I V      EW+ G+  G     +VGIFP ++V  A  
Sbjct: 7   VVATFPYTSEYEDDLNFDKDQTITVTAIEDDEWYSGEYLGPDGVMRVGIFPRSFVA-AAP 65

Query: 116 GTSQPSKTRLTPGP 129
            T +P   +L P P
Sbjct: 66  TTVEP---KLAPTP 76

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 62  EAIYPFEPQQ--EGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
           +A+Y ++  +  + +++ + G+ ++V +     W   + NG+ GI PSNYV+
Sbjct: 273 KALYSYQADESDQYEISFEQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQ 324

>Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}
           complement(23020..24723) [1704 nt, 568 aa]
          Length = 567

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWF 94
            +Y F+P++  +L   AGDKI +    + EWF
Sbjct: 169 VLYDFKPERPDELEANAGDKITIYAHHNDEWF 200

>Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118C
           (SHO1) - Transmembrane osmosensor [contig 33] FULL
          Length = 343

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%)

Query: 53  SQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYV 110
           S  P L      Y  +     +++ + G+ ++V +     W   + NG+ GI PSNYV
Sbjct: 278 SSFPYLAKALYTYTADSNDAYEVSFEQGETLRVGDIEGRWWKAKRANGETGIIPSNYV 335

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGK--CNGQVGIFPSNY 109
           ++A+Y ++ Q  G+L+   GD   V ++   +W++     +G+ G+ P NY
Sbjct: 68  IKALYNYQAQSAGELSFNKGDFFHV-QQEENDWYEASNPADGKRGMVPKNY 117

>SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P39969 Saccharomyces cerevisiae
           YER114C BOI2 Protein implicated in polar growth
           functionally redundant with Boi1p interacts with bud-
           emergence protein Bem1p contains an SH3 (src homology 3)
           domain and a PH (pleckstrin homology) domain
          Length = 1027

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVI---EKPSPEWFKGKC--NGQVGIFPSNYVRPAFSGT 117
           AI  +  + E +L +K GDKIQVI   ++ +  W+ G+     + G++P  + +   S  
Sbjct: 43  AINEYTKRMEDELDMKPGDKIQVITDDQEYNDGWYYGRNLRTNEEGLYPKVFTQ-VISTQ 101

Query: 118 SQPSKTR 124
            QPS  R
Sbjct: 102 KQPSLMR 108

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 43  DPNGSRESVSSQAPTLEYV-EAIYPF--EPQQEGDLALKAGDKIQVIEKPSPEWFKGKCN 99
           D  G       +  +  YV +A+Y +  +     +++ + G+ ++V +     W   + N
Sbjct: 264 DTLGLYSDAGDELTSFPYVAKALYTYTADSNDAYEVSFEQGEMLRVGDIEGRWWKAKRAN 323

Query: 100 GQVGIFPSNYV 110
           G+ GI PSNYV
Sbjct: 324 GETGIIPSNYV 334

>NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]
           {ON} Anc_4.45
          Length = 1323

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 8/70 (11%)

Query: 59  EYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG-------KCNGQVGIFPSNYVR 111
           + V  +Y F P     L L+  + + V+ KP+  W+ G       +   + G FP  +V 
Sbjct: 61  DIVRVVYDFTPSSSDQLQLRQNEIVYVLNKPNTGWWDGITISESPQQQIKRGWFPQTFVH 120

Query: 112 P-AFSGTSQP 120
              FS T  P
Sbjct: 121 SITFSSTISP 130

>KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakly
           similar to uniprot|P47068 Saccharomyces cerevisiae
           YJL020C BBC1 Protein possibly involved in assembly of
           actin patches interacts with an actin assembly factor
           Las17p and with the SH3 domains of Type I myosins Myo3p
           and Myo5p localized predominantly to cortical actin
           patches
          Length = 1214

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 7/67 (10%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQV-----GIFPSNYVRPAFS 115
           V A +P+  + + DL  + G  I V      EW+ G+   +      GIFP ++V+   +
Sbjct: 10  VIAQFPYTSEHDDDLNFEKGSLITVQSIEDDEWYFGEYQDESGTYKEGIFPRSFVK--LA 67

Query: 116 GTSQPSK 122
           G  +PSK
Sbjct: 68  GDEEPSK 74

>CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118c SSU81
          Length = 353

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 61  VEAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYV 110
           V+A+Y +E       +++ + G+ + V +     W   K +G+ GI PSNYV
Sbjct: 293 VKALYSYEADSADAYEMSFEQGEILMVSDIEGRWWKAKKESGETGIIPSNYV 344

>YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}
           CYK3SH3-domain protein located in the mother-bud neck
           and the cytokinetic actin ring; mutant phenotype and
           genetic interactions suggest a role in cytokinesis
          Length = 885

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKC--NGQV-GIFPSNYV 110
           V+A Y +  Q +GDL    GD ++V  + +  WF GK   N +  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGKLLRNKKCSGYFPHNFV 65

>KNAG0J02750 Chr10 complement(521086..526044) [4959 bp, 1652 aa]
           {ON} Anc_4.45 Scer_YGOB_SDC25
          Length = 1652

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 52  SSQAPTLEYVEAIYPFE---PQQEGDLALKAGDKIQVIEKPSPEWFKG----KCNGQV-- 102
           +S+  TL+ V A++ F          L+ + GD + V+ K +  W+ G      + +V  
Sbjct: 84  NSRVCTLDIVVAVHDFNYPPASATNKLSFQRGDTVYVLAKSASGWWDGLSIADTDNKVIR 143

Query: 103 GIFPSNYVR 111
           G FP N+VR
Sbjct: 144 GWFPYNHVR 152

>TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7.413
           YER114C
          Length = 1555

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 5/48 (10%)

Query: 64  IYPFEPQQEGDLALKAGDKIQVI---EKPSPEWFKGKC--NGQVGIFP 106
           I  +  + + +L +K GDKIQVI   E+ +  W+ GK    G+ G++P
Sbjct: 55  INEYTKRMDDELDMKPGDKIQVITDDEEYNDGWYFGKNLRTGEEGLYP 102

>Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 10/56 (17%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG------KCNGQVGIFPSNYV 110
           V+A Y +  Q +GDL    GD ++V  + +  WF G      KC+   G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGRLLRNKKCS---GYFPHNFV 65

>Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 10/56 (17%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG------KCNGQVGIFPSNYV 110
           V+A Y +  Q +GDL    GD ++V  + +  WF G      KC+   G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGRLLRNKKCS---GYFPHNFV 65

>Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar to
           Ashbya gossypii AGL293C
          Length = 1029

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 6/82 (7%)

Query: 49  ESVSSQAPT-LEYVEAIYPFEPQQEGDLALKAGDKIQVI---EKPSPEWFKGKC--NGQV 102
           E VS +  T  +   AI  +  + E +L +K GDKI+ I   ++ +  W+ G+    G+ 
Sbjct: 41  ERVSERGKTRFDMYIAINEYSKRMEDELDMKPGDKIEAITDDQEYNDGWYYGRNLRTGEE 100

Query: 103 GIFPSNYVRPAFSGTSQPSKTR 124
           G++P  + +    G S P+  R
Sbjct: 101 GLYPKLFTQVISIGRSTPNIMR 122

>TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1394

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 18/79 (22%)

Query: 52  SSQAPTLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFK------GKCNGQV--- 102
           ++Q   ++ V  I+ F P     L L++G  I VIEK S  W+       G  +G     
Sbjct: 3   TTQLRPIDIVVVIHNFTPTSSNMLPLQSGSIIYVIEKNSNGWWDGVQLVAGTQSGSFSPK 62

Query: 103 ---------GIFPSNYVRP 112
                    G FP+NY +P
Sbjct: 63  SGSTQKIIRGWFPANYTKP 81

>YJL020C Chr10 complement(398937..402410) [3474 bp, 1157 aa] {ON}
           BBC1Protein possibly involved in assembly of actin
           patches; interacts with an actin assembly factor Las17p
           and with the SH3 domains of Type I myosins Myo3p and
           Myo5p; localized predominantly to cortical actin patches
          Length = 1157

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGK---CNGQV--GIFPSNYV 110
           V A +P++   E DL  +   +I V      EW+ G+    NG V  GIFP ++V
Sbjct: 10  VVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFV 64

>Skud_5.261 Chr5 (422454..423572) [1119 bp, 372 aa] {ON} YER118C
           (REAL)
          Length = 372

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 62  EAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
           +A+YP++   +   +++ +  + +QV +     W   K NG+ GI PSNYV+
Sbjct: 311 KALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARKANGETGIIPSNYVQ 362

>Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 10/56 (17%)

Query: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG------KCNGQVGIFPSNYV 110
           V+A Y +  Q +GDL    GD ++V  + +  WF G      KC+   G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGRLLRNKKCS---GYFPHNFV 65

>Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON}
           (44320..45396) [1077 nt, 359 aa]
          Length = 358

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 62  EAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
            A+Y ++       +++ + G+ ++V +     W   K  G+VGI PSNYV+
Sbjct: 299 RALYSYQADDADGYEVSFEQGEILKVSDIEGRWWKSKKETGEVGIIPSNYVQ 350

>Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER114C
           (BOI2) - involved in bud formation, has SH3 domain
           [contig 33] FULL
          Length = 1014

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 9/66 (13%)

Query: 64  IYPFEPQQEGDLALKAGDKIQVI---EKPSPEWFKGKC--NGQVGIFPSNYVRPAFSGTS 118
           I  +  + E +L +K GDKIQVI   E+ +  W+ G+     + G++P  + +      S
Sbjct: 42  ITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLYPKVFTQE----IS 97

Query: 119 QPSKTR 124
           QPS  R
Sbjct: 98  QPSLVR 103

>TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.344
           YDR162C
          Length = 224

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 33/81 (40%), Gaps = 2/81 (2%)

Query: 63  AIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGK--CNGQVGIFPSNYVRPAFSGTSQP 120
           A+Y F P+ + +L L  GD I +  K    W   +   N ++G+ P  +V          
Sbjct: 105 ALYDFVPENDNELQLVEGDIIFINYKHGQGWLVAQNLNNNKIGLVPEEFVSYLDEEDFTD 164

Query: 121 SKTRLTPGPPQYQASVETQSI 141
              +     P Y   + TQ+I
Sbjct: 165 DDEQDENIRPFYLTHLITQNI 185

>Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa]
           {ON} YLR310C (REAL)
          Length = 1587

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 11/63 (17%)

Query: 61  VEAIYPFEPQQEGD-----LALKAGDKIQVIEKPSPEWFKG----KCNGQV--GIFPSNY 109
           V A Y F    + D     L+++ GD I ++ K S  W+ G      +G+V  G FP N+
Sbjct: 66  VVAAYDFNHPTKKDGSSQLLSVQQGDTIYILNKNSSGWWDGLVIDDSSGKVDRGWFPQNF 125

Query: 110 VRP 112
            RP
Sbjct: 126 GRP 128

>Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp,
          1252 aa] {ON} ANNOTATED BY YGOB - skipping over
          frameshift in strain S288c
          Length = 1252

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 58 LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKG 96
          ++ VE  Y +  +    L+L+ GD I V+ K S  W+ G
Sbjct: 28 IDVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>YER118C Chr5 complement(397952..399055) [1104 bp, 367 aa] {ON}
           SHO1Transmembrane osmosensor involved in activation of
           the Cdc42p- and MAP kinase-dependent filamentous growth
           pathway and the high-osmolarity glycerol response
           pathway; phosphorylated by Hog1p; interacts with Pbs2p,
           Msb2p, Hkr1p, and Ste11p
          Length = 367

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 62  EAIYPFEPQQEG--DLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111
           +A+YP++   +   +++ +  + +QV +     W   + NG+ GI PSNYV+
Sbjct: 306 KALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 357

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,610,915
Number of extensions: 849232
Number of successful extensions: 3196
Number of sequences better than 10.0: 295
Number of HSP's gapped: 3101
Number of HSP's successfully gapped: 345
Length of query: 235
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 129
Effective length of database: 41,326,803
Effective search space: 5331157587
Effective search space used: 5331157587
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)