Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B05910singletonON36036010531e-143
NDAI0B05840singletonON23253693.5
KAFR0E02580singletonON30567677.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05910
         (360 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05910 Chr2 (1427727..1428809) [1083 bp, 360 aa] {ON}            410   e-143
NDAI0B05840 Chr2 (1417114..1417812) [699 bp, 232 aa] {ON}              31   3.5  
KAFR0E02580 Chr5 (528871..529788) [918 bp, 305 aa] {ON}                30   7.3  

>NDAI0B05910 Chr2 (1427727..1428809) [1083 bp, 360 aa] {ON} 
          Length = 360

 Score =  410 bits (1053), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 253/360 (70%), Positives = 253/360 (70%)

Query: 1   MSSQDLTTQTQSPNSELTSCKCSNNNKDCECGKCKCSACNCTAVAECQCSNINDSSCKCV 60
           MSSQDLTTQTQSPNSELTSCKCSNNNKDCECGKCKCSACNCTAVAECQCSNINDSSCKCV
Sbjct: 1   MSSQDLTTQTQSPNSELTSCKCSNNNKDCECGKCKCSACNCTAVAECQCSNINDSSCKCV 60

Query: 61  RXXXXXXXXXXXXSPCTSTVTVHLQSLNIQDSSCKCSAKTNGCECTDCKCSTNSNDRKCS 120
           R            SPCTSTVTVHLQSLNIQDSSCKCSAKTNGCECTDCKCSTNSNDRKCS
Sbjct: 61  RKTKDCKCTNCKCSPCTSTVTVHLQSLNIQDSSCKCSAKTNGCECTDCKCSTNSNDRKCS 120

Query: 121 DCQCSPCSCKVTVECHCPNAPQSSCRCSPCTCSAIVECQCSKPKNSVCKCSANXXXXXXX 180
           DCQCSPCSCKVTVECHCPNAPQSSCRCSPCTCSAIVECQCSKPKNSVCKCSAN       
Sbjct: 121 DCQCSPCSCKVTVECHCPNAPQSSCRCSPCTCSAIVECQCSKPKNSVCKCSANTKDCKCT 180

Query: 181 XXXXXNGQLPXXXXXXXXXXXXXXXXXXXXXXXXVTMXXXXXXXXXXXXXXXNXXXXXXX 240
                NGQLP                        VTM               N       
Sbjct: 181 DCQCTNGQLPSCECSSKTKDCKCTDCQCSQCTCKVTMQCQCQNAQQSSCKCSNKTKDCTC 240

Query: 241 XXXXXSPCMCTETIGCRCSNTNDSSCQCSTKNNDRKCTDCKCSAKTNDCQCSPCTCKVTM 300
                SPCMCTETIGCRCSNTNDSSCQCSTKNNDRKCTDCKCSAKTNDCQCSPCTCKVTM
Sbjct: 241 GKCKCSPCMCTETIGCRCSNTNDSSCQCSTKNNDRKCTDCKCSAKTNDCQCSPCTCKVTM 300

Query: 301 QCQCPNAQQXXXXXXXXXXXXXXGXXXXXXXXXXXXXXXXXXKPKPSACKCVGKTNDCKC 360
           QCQCPNAQQ              G                  KPKPSACKCVGKTNDCKC
Sbjct: 301 QCQCPNAQQSSCKCSTKTKDCTCGECKCSSCTCTASAECQCSKPKPSACKCVGKTNDCKC 360

>NDAI0B05840 Chr2 (1417114..1417812) [699 bp, 232 aa] {ON} 
          Length = 232

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 12/53 (22%)

Query: 255 GCRCSNTNDSSCQCSTKNNDRKCTDCKCSAKTNDCQCSPCTCKVTMQCQCPNA 307
           GCRCS+     CQCS ++          S K  DC CS CTC   +QCQCP++
Sbjct: 29  GCRCSSK--VQCQCSHED----------STKAKDCDCSLCTCATNVQCQCPDS 69

>KAFR0E02580 Chr5 (528871..529788) [918 bp, 305 aa] {ON} 
          Length = 305

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 36/67 (53%), Gaps = 15/67 (22%)

Query: 103 CECTDCKCSTNSNDRKCSDCQCSPCSCKVTVECHCPNAPQSSCRCSPCTCSAIVECQCSK 162
           C C DCKCS    D KCSDC+CS C C      HC N+     RCS C CS    C+CS 
Sbjct: 187 CHCFDCKCS----DCKCSDCKCSDCGCV-----HCFNSQS---RCSDCKCS---HCKCSD 231

Query: 163 PKNSVCK 169
            K S CK
Sbjct: 232 CKCSDCK 238

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.124    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,258,264
Number of extensions: 781436
Number of successful extensions: 3789
Number of sequences better than 10.0: 57
Number of HSP's gapped: 3040
Number of HSP's successfully gapped: 168
Length of query: 360
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 249
Effective length of database: 40,753,473
Effective search space: 10147614777
Effective search space used: 10147614777
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)