Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B058903.496ON27827810291e-141
Suva_16.4793.496ON2121383742e-43
YPR151C (SUE1)3.496ON2061433681e-42
Smik_16.4033.496ON2031373662e-42
Skud_16.4453.496ON2151413579e-41
TPHA0D033003.496ON1961403462e-39
KNAG0A079603.496ON1771493442e-39
Kpol_1017.43.496ON1841503417e-39
SAKL0F02618g3.496ON2531403363e-37
KLLA0E03983g3.496ON1911373088e-34
ZYRO0D09812g3.496ON1851582964e-32
Kwal_55.212483.496ON2221392924e-31
KLTH0F14938g3.496ON2291492821e-29
NCAS0F035703.496ON2301492778e-29
CAGL0L08426g3.496ON1401422272e-22
TDEL0D056403.496ON1241432234e-22
TBLA0D029403.496ON71531548e-13
Ecym_12333.496ON87421505e-12
KAFR0G037103.496ON79411347e-10
Kpol_1013.98.682ON2611521296e-08
AFR315C3.496ON77451135e-07
ZYRO0F07480g8.682ON2361361162e-06
TPHA0D012908.682ON2181431126e-06
KNAG0J017608.682ON2581351138e-06
NCAS0C013108.682ON2571361111e-05
TDEL0A062708.682ON2421411031e-04
NDAI0K013208.682ON2581371012e-04
KLLA0D06061g8.682ON249451003e-04
YPL159C (PET20)8.682ON253149994e-04
Suva_16.1518.682ON253135995e-04
Smik_6.3568.682ON253135960.001
Kwal_26.88288.682ON22328950.001
Skud_16.1238.682ON255149950.001
TPHA0G015708.682ON25545920.003
SAKL0H06380g8.682ON21928900.005
Kpol_1072.128.682ON22231880.009
CAGL0M02101g8.682ON26728880.011
KLTH0D11396g8.682ON22528860.018
ZYRO0C02244g3.62ON460134830.051
TBLA0B038008.682ON32428810.092
Skud_14.423.62ON524152810.11
KLLA0A07447g3.62ON486140810.12
TDEL0E007103.62ON476134790.21
KAFR0H023808.682ON22037760.29
Ecym_23908.682ON22734740.51
Smik_14.363.62ON524139740.86
NCAS0A099403.62ON49441721.3
YNL295W3.62ON52437721.5
Kpol_1066.443.62ON47928702.0
Suva_14.443.62ON525147702.4
TBLA0B027208.798ON50234676.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05890
         (278 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   400   e-141
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   148   2e-43
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   146   1e-42
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   145   2e-42
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   142   9e-41
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   137   2e-39
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   137   2e-39
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   135   7e-39
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   134   3e-37
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   123   8e-34
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   118   4e-32
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   117   4e-31
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   113   1e-29
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...   111   8e-29
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    92   2e-22
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    91   4e-22
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    64   8e-13
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    62   5e-12
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    56   7e-10
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    54   6e-08
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    48   5e-07
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    49   2e-06
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    48   6e-06
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    48   8e-06
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    47   1e-05
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    44   1e-04
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    44   2e-04
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    43   3e-04
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    43   4e-04
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    43   5e-04
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    42   0.001
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    41   0.001
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    41   0.001
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    40   0.003
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    39   0.005
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    39   0.009
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    39   0.011
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    38   0.018
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    37   0.051
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    36   0.092
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    36   0.11 
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    36   0.12 
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    35   0.21 
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    34   0.29 
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    33   0.51 
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    33   0.86 
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    32   1.3  
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    32   1.5  
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    32   2.0  
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    32   2.4  
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    30   6.0  

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  400 bits (1029), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 207/278 (74%), Positives = 207/278 (74%)

Query: 1   MIRFQLEFGQELVPIINAMKMKNTHGMVRLFSTLNNRTFQSHRTATNGNIVGSNSKTDPL 60
           MIRFQLEFGQELVPIINAMKMKNTHGMVRLFSTLNNRTFQSHRTATNGNIVGSNSKTDPL
Sbjct: 1   MIRFQLEFGQELVPIINAMKMKNTHGMVRLFSTLNNRTFQSHRTATNGNIVGSNSKTDPL 60

Query: 61  RKKRSYYSYHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLA 120
           RKKRSYYSYHH                                               LA
Sbjct: 61  RKKRSYYSYHHPPNTVPSSSSSSSSSTKRRTISSPTSTSASPPPSSSSSSPTHTTISSLA 120

Query: 121 PCILQNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXX 180
           PCILQNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKN     
Sbjct: 121 PCILQNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSF 180

Query: 181 XXXXXXXXXXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSI 240
                              MKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSI
Sbjct: 181 PFSTTSSSSSEKKKPQQEQMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSI 240

Query: 241 MGMEYYPEWKGVPFNIVKNLKPFDKSRGTVEVMKKPLK 278
           MGMEYYPEWKGVPFNIVKNLKPFDKSRGTVEVMKKPLK
Sbjct: 241 MGMEYYPEWKGVPFNIVKNLKPFDKSRGTVEVMKKPLK 278

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  148 bits (374), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 90/138 (65%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXX 188
           FR++PKVP T+YLE +EL++D+LYSGYRP+MYPVKENPLFR   KK+             
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121

Query: 189 XXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPE 248
                           +   GGIM+GG+NGTW+Y+P +PN LLP   WS S MGMEY+PE
Sbjct: 122 EAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFPE 181

Query: 249 WKGVPFNIVKNLKPFDKS 266
           WK VP  +++ LKPFD++
Sbjct: 182 WKNVPSYMMRKLKPFDRA 199

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  146 bits (368), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 94/143 (65%), Gaps = 10/143 (6%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXX 188
           FR++PKVP T+YLE +EL++D+LYSGYRP+MYPVKENPLFR   +K+             
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114

Query: 189 XXXXXXXXXXXMKKHYDDEYG-----GIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGM 243
                       KKH +  +G     GIM+GG+NGTW+Y+P +PN LLP   WS S MGM
Sbjct: 115 EAKTIDE-----KKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGM 169

Query: 244 EYYPEWKGVPFNIVKNLKPFDKS 266
           EY+PEWK VP  +++ LKPFDK+
Sbjct: 170 EYFPEWKNVPPYMMRKLKPFDKA 192

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  145 bits (366), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 68/137 (49%), Positives = 88/137 (64%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXX 188
           FR++PKVP T+YLE +EL++D+LYSGYRP+MYPVKENPLFR   KK+             
Sbjct: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPIT 112

Query: 189 XXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPE 248
                           +   GGIM+GG+NGTW+Y+P +PN LLP   WS S MGMEY+PE
Sbjct: 113 EAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 172

Query: 249 WKGVPFNIVKNLKPFDK 265
           W+ +P  + + LKPFDK
Sbjct: 173 WRNIPSYMTRKLKPFDK 189

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  142 bits (357), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 90/141 (63%), Gaps = 6/141 (4%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXX 188
           FR++PKVP T+YLE +EL++D+LYSGYRP+MYPVKENPLFR    K              
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR---DKKRDSLQMLLAPDEA 118

Query: 189 XXXXXXXXXXXMKKHY---DDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEY 245
                      M K+    +   GGI +GG+NGTW+Y+P +PN LLP   WS S MGMEY
Sbjct: 119 PAAEAKATEKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEY 178

Query: 246 YPEWKGVPFNIVKNLKPFDKS 266
           +PEWK VP  +++ LKPFDKS
Sbjct: 179 FPEWKNVPSYMMRKLKPFDKS 199

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  137 bits (346), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 68/140 (48%), Positives = 87/140 (62%), Gaps = 1/140 (0%)

Query: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXX 185
           N+IF+ +P+VP T+YLE+ +L+ D+L+SGYRPI YPVKENPLFR   K N          
Sbjct: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQ 107

Query: 186 XXXXXXXXXXXXXXMKKHYDDE-YGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGME 244
                               ++  GGIM+GG+NGTW+Y+P +P NLLP   WS SIMGME
Sbjct: 108 EKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGME 167

Query: 245 YYPEWKGVPFNIVKNLKPFD 264
           YYPEW  VP   +K LKPF+
Sbjct: 168 YYPEWNNVPRRFLKTLKPFE 187

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  137 bits (344), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 90/149 (60%), Gaps = 1/149 (0%)

Query: 127 NIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXX 186
           ++FR +PKVPMTKYLET+EL++D+LYSGYRP+MYPV+ENPLFR +  K            
Sbjct: 30  SMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNS-NKLMAISHPEHDTE 88

Query: 187 XXXXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYY 246
                         +   ++  GGI T G NGTW+Y+P+IP  +LP   WS S + ME Y
Sbjct: 89  GTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVY 148

Query: 247 PEWKGVPFNIVKNLKPFDKSRGTVEVMKK 275
           PEW  VP ++VK LKPFD   G     KK
Sbjct: 149 PEWSSVPKHVVKGLKPFDLLLGVKATQKK 177

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  135 bits (341), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 90/150 (60%), Gaps = 18/150 (12%)

Query: 127 NIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXX 186
           +IFR++P+VP T++LE+  L+ D+L+SGYRPI YPVKENPLFR     N           
Sbjct: 34  HIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFR-----NTGNTKNIFGQD 88

Query: 187 XXXXXXXXXXXXXMKKHY-------------DDEYGGIMTGGINGTWRYSPRIPNNLLPN 233
                        +++H              D   GGI +GG+NGTWR++PR+P+ LLP 
Sbjct: 89  LVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPY 148

Query: 234 KIWSMSIMGMEYYPEWKGVPFNIVKNLKPF 263
             WS SIMGMEYYPEWK +P  +VK+LKP+
Sbjct: 149 SWWSTSIMGMEYYPEWKNIPRKVVKDLKPY 178

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  134 bits (336), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 84/140 (60%), Gaps = 1/140 (0%)

Query: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRL-TLKKNXXXXXXXXX 184
           ++IFR +PKVP T++LE +EL++D+L+SGYRP+ YPVKENP F + T +K          
Sbjct: 20  SDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSAKK 79

Query: 185 XXXXXXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGME 244
                                   GGI++GG+NGTWRY+PRIP  LLP  +WS S M ME
Sbjct: 80  EYKNEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPRIPTKLLPYNLWSSSTMAME 139

Query: 245 YYPEWKGVPFNIVKNLKPFD 264
           YYPEW  VP  I   LKPFD
Sbjct: 140 YYPEWLNVPKTIANKLKPFD 159

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  123 bits (308), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 84/137 (61%)

Query: 127 NIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXX 186
            ++R +P+VP T++L  +EL+ D+L+SGYRPI+ P+++NPLF+  +K+            
Sbjct: 10  QMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGK 69

Query: 187 XXXXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYY 246
                              +  GGI++GG+NGTWRY+PRIPN LL + +WS S MGME+Y
Sbjct: 70  LKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFY 129

Query: 247 PEWKGVPFNIVKNLKPF 263
           PEW  VP  +  +LKP+
Sbjct: 130 PEWNDVPNKVSASLKPY 146

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  118 bits (296), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 93/158 (58%), Gaps = 6/158 (3%)

Query: 123 ILQNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXX 182
              ++IFR+MP+VP T++LE++EL++D+L+SGYRP+MYPVKENPLF+   +         
Sbjct: 19  CCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQ 78

Query: 183 XXXXXXXXXXXXXXXXXMKKHYDDEYGG------IMTGGINGTWRYSPRIPNNLLPNKIW 236
                                      G      I +GG +GTWR   ++P+ LLP   W
Sbjct: 79  SRHNSGLRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASGTWRNGAKMPSKLLPYSWW 138

Query: 237 SMSIMGMEYYPEWKGVPFNIVKNLKPFDKSRGTVEVMK 274
           S + MGME++PEW+GVP ++V+ LKPFD+   T+++++
Sbjct: 139 STTSMGMEFFPEWEGVPRHVVRKLKPFDRGHDTLDILE 176

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  117 bits (292), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 86/139 (61%), Gaps = 3/139 (2%)

Query: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXX 185
           ++IFR++PKVP T+YLE  EL++D+LYSGYRP++YPVKENPLF+ T  K           
Sbjct: 20  SDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSD 79

Query: 186 XXXXXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEY 245
                                  GGI +GG+NGTWRY+PRIP+ LLP  +WS + M MEY
Sbjct: 80  TALTAAKESSKNAMAGPQG---TGGIGSGGVNGTWRYNPRIPSKLLPFSLWSSTSMAMEY 136

Query: 246 YPEWKGVPFNIVKNLKPFD 264
           +PEW  VP  +V  L+PF+
Sbjct: 137 HPEWLAVPRTVVNKLRPFN 155

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  113 bits (282), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 78/149 (52%), Gaps = 23/149 (15%)

Query: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXX 185
           + IFR++PKVP T+YLE  EL++D+LYSGYRP++YPVKENPLF+    K           
Sbjct: 20  SEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGERGAR 79

Query: 186 XXXXXXXXXXXXXXMKKHYDDEYGGIMTGGING----------TWRYSPRIPNNLLPNKI 235
                                     M G +            TWRY+PRIP+ LLP  +
Sbjct: 80  KSSTVPQSSEM-------------NAMAGPLGTGGIGSGGVNGTWRYNPRIPSKLLPYNL 126

Query: 236 WSMSIMGMEYYPEWKGVPFNIVKNLKPFD 264
           WS + M MEY+PEW  VP  +V  L+PF+
Sbjct: 127 WSCTSMAMEYHPEWLAVPRTVVNKLRPFE 155

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score =  111 bits (277), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 87/149 (58%), Gaps = 36/149 (24%)

Query: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXX 185
           NNIFR +PKVPMT+YLETK+LS+++L++GY+PIMYPV+ENPLF+L +K+           
Sbjct: 115 NNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQE---------- 164

Query: 186 XXXXXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEY 245
                          K+   +E   +   G + + +Y            IWS SI+G++ 
Sbjct: 165 -------------DAKRENGNEKRAL---GSSVSHKYK----------GIWSTSILGLQD 198

Query: 246 YPEWKGVPFNIVKNLKPFDKSRGTVEVMK 274
           YPEW  VP+N +KNLKPFD+   ++ + K
Sbjct: 199 YPEWNNVPWNNIKNLKPFDEELASITIKK 227

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 92.0 bits (227), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 79/142 (55%), Gaps = 17/142 (11%)

Query: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXX 185
           N IFR +PKVPMT+YLE + LS+DMLY+GYRPI+YP++ENPL   +  +           
Sbjct: 5   NEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNE 64

Query: 186 XXXXXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKI---WSMSIMG 242
                            +  +  GGI T G+        R+ +   P+K+    S SIMG
Sbjct: 65  LQKKDEEPVNELL----YGPEGRGGISTMGVR-------RMAD---PSKVKLGLSYSIMG 110

Query: 243 MEYYPEWKGVPFNIVKNLKPFD 264
           MEYYPEW+ VP ++VK +KP++
Sbjct: 111 MEYYPEWEKVPRDVVKRIKPYE 132

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score = 90.5 bits (223), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 71/143 (49%), Gaps = 48/143 (33%)

Query: 124 LQNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXX 183
           + +++FRT+P+VP T++LET+ LS D+L+SGYRP+MYPV+ENPLF               
Sbjct: 26  VTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF--------------- 70

Query: 184 XXXXXXXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPN-KIWSMSIMG 242
                                             GT   +P    + LP   +WS + MG
Sbjct: 71  --------------------------------GRGTKTEAPASLESNLPRYDLWSTTTMG 98

Query: 243 MEYYPEWKGVPFNIVKNLKPFDK 265
           +E +PEW  VP  +V+ L+PFD+
Sbjct: 99  LERFPEWSNVPREVVRKLRPFDR 121

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
           YPR151C
          Length = 71

 Score = 63.9 bits (154), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 39/53 (73%), Gaps = 2/53 (3%)

Query: 119 LAPCILQNN--IFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFR 169
           L   +++N+  + R +P+VP T+YLE   L  D+ +SGYRP+MYPVKENPLFR
Sbjct: 4   LKQVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFR 56

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
           Ashbya gossypii AFR315C
          Length = 87

 Score = 62.4 bits (150), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 25/42 (59%), Positives = 34/42 (80%)

Query: 128 IFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFR 169
           I R +P+VP T+YL  +EL  D+ +SGYRP++YPVK+NPLFR
Sbjct: 9   ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFR 50

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
           Anc_3.496 YPR151C
          Length = 79

 Score = 56.2 bits (134), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 33/41 (80%)

Query: 128 IFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLF 168
           + + +P+VP TKYL+  +L  D+LY+GYRP++YP+KENPL 
Sbjct: 7   LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 58/152 (38%), Gaps = 49/152 (32%)

Query: 132 MPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXXXXX 191
           +PKVP T+ L  +E+    LYSGYRPI    K +   +L+                    
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPIYINSKGSGKNKLS-------------------- 151

Query: 192 XXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPEWKG 251
                             G M  G+N T+        N  P   W  S  GME Y EW  
Sbjct: 152 ------------------GTMKNGVNSTFYEIAMKLENPSP---WMSSATGMELYSEWDH 190

Query: 252 VPFNIVKNLKPF--------DKSRGTVEVMKK 275
           VP +++K+LKPF        D S   +E M K
Sbjct: 191 VPLDVLKDLKPFHPPEETNSDPSNSDLESMNK 222

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR151C
           (SUE1)
          Length = 77

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 31/45 (68%)

Query: 125 QNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFR 169
           +   FR +P+VP T++L   ++  D+L+S +RP+ YPV +NPL R
Sbjct: 3   RQQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 51/136 (37%), Gaps = 46/136 (33%)

Query: 132 MPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXXXXX 191
           +P+VP T YL  +++S  +LYSGYRP+      NP                         
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRPLFL----NP------------------------- 118

Query: 192 XXXXXXXXMKKHYDDEYGGIMTGG--INGTWRYSPRIP-NNLLPNKIWSMSIMGMEYYPE 248
                         DE      GG   NG   Y   +    L    +W+ S  G E YPE
Sbjct: 119 --------------DELKTSQDGGNANNGARLYEFAMKLEELGEQSLWTSSATGQEIYPE 164

Query: 249 WKGVPFNIVKNLKPFD 264
           W  VP  + + LKPF+
Sbjct: 165 WDYVPMEVQRKLKPFN 180

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 55/143 (38%), Gaps = 54/143 (37%)

Query: 132 MPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXXXXX 191
           +PKVP T  +  +E++ + LYSGYRP+                                 
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPL--------------------------------- 121

Query: 192 XXXXXXXXMKKHYDDEYGGIMTGGINGT--------WRYSPRIPNNLLPNKIWSMSIMGM 243
                       + D   G + G +N T        + ++ ++ N L     W MS  G+
Sbjct: 122 ------------FIDNKKGTLLGDVNSTAQDANSSIYEFAMKL-NELSEPSPWMMSATGL 168

Query: 244 EYYPEWKGVPFNIVKNLKPFDKS 266
           E Y EW  VP  ++K LKP+D S
Sbjct: 169 ESYSEWDYVPSKVIKKLKPYDLS 191

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 49/135 (36%), Gaps = 33/135 (24%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXX 188
           +  +P VP T+++E  ++  ++LYSGYRP+        L    L++              
Sbjct: 93  YHPLPSVPSTQHIEANDMCTELLYSGYRPLF-------LDSTALERGLLAAKEQASFTQS 145

Query: 189 XXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPE 248
                        K  D                          P  IW+ S  G+E Y E
Sbjct: 146 ASPTGSTFYEIAMKLED--------------------------PACIWANSATGLEKYTE 179

Query: 249 WKGVPFNIVKNLKPF 263
           W  +P+++  +LKPF
Sbjct: 180 WDNIPYSVANSLKPF 194

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 50/136 (36%), Gaps = 31/136 (22%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXX 188
           + T+PKV     L   E+S D+LYSGYRP+    K+                        
Sbjct: 87  YSTLPKVEPITNLRHNEISTDILYSGYRPLFLNFKD------------------------ 122

Query: 189 XXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIW-SMSIMGMEYYP 247
                       K  + +     +          SP   +    +  W S S  GME + 
Sbjct: 123 ------LENSSRKAEFGNSNNSTLYEIAMKLDDLSPEAISGSTSSNFWHSTSATGMEVFD 176

Query: 248 EWKGVPFNIVKNLKPF 263
           EW  VP +I+KNLKPF
Sbjct: 177 EWDNVPNSILKNLKPF 192

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 55/141 (39%), Gaps = 46/141 (32%)

Query: 125 QNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXX 184
           Q + +  +P+VP T  L+ +++S  +LYSGYRP+      NP                  
Sbjct: 89  QRHDYSWLPRVPSTGNLKPRDMSMKVLYSGYRPLFI----NP------------------ 126

Query: 185 XXXXXXXXXXXXXXXMKKHYDDEYGGIMTG-GINGT-WRYSPRIPNNLLPNKIWSMSIMG 242
                                DE      G G  GT + ++ ++   L     W  S  G
Sbjct: 127 ---------------------DEIKTSSEGSGTGGTLYEFAMKL-EELGDQSPWVTSATG 164

Query: 243 MEYYPEWKGVPFNIVKNLKPF 263
           +EYY EW  +P  + K LKPF
Sbjct: 165 LEYYREWDSIPGELQKKLKPF 185

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 49/137 (35%), Gaps = 41/137 (29%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXX 188
           F  +PK+     L  +++S  +LYSGYRP+  P   N  F+   K N             
Sbjct: 91  FSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP---NGSFQQGQKNNGSTLYEFAMKL-- 145

Query: 189 XXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPE 248
                            DE+       I                   W  S  G+E + E
Sbjct: 146 -----------------DEFKKDKNSTI-------------------WDTSATGVETFTE 169

Query: 249 WKGVPFNIVKNLKPFDK 265
           W  VP ++++NLKPF K
Sbjct: 170 WDNVPESVIRNLKPFQK 186

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (66%), Gaps = 3/45 (6%)

Query: 132 MPKVPMTKYLETKELSQDMLYSGYRPIMYP---VKENPLFRLTLK 173
           +P+VP T+++  +E + DMLYSGYRPI+      KEN L +  +K
Sbjct: 112 LPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQFAMK 156

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 236 WSMSIMGMEYYPEWKGVPFNIVKNLKPF 263
           W  S  G E++ EW  VP  I+K+LKPF
Sbjct: 166 WVSSATGQEFFSEWDNVPSEIIKDLKPF 193

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 63/149 (42%), Gaps = 48/149 (32%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXX 188
           F  +P+VP T +L+  +++ ++LYSGYR    P+  NP                      
Sbjct: 100 FSWLPRVPSTSHLKQSDMTTNVLYSGYR----PLFINP---------------------- 133

Query: 189 XXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPE 248
                           +D      TG     + ++ ++ +   P   W  S  G+E++ E
Sbjct: 134 ----------------NDPKLKEDTGST--LYEFAMKLEDLNEPLSPWISSATGLEFFSE 175

Query: 249 WKGVPFNIVKNLKPF----DKSRGTVEVM 273
           W+ +P  ++KNLKPF    +KS  T E++
Sbjct: 176 WENIPSELLKNLKPFHPPKEKSMNTNELI 204

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 56/135 (41%), Gaps = 44/135 (32%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXX 188
           F  +P+VP T +L+  +++ ++LYSGYR    P+  NP                      
Sbjct: 100 FSWLPRVPSTSHLKHSDMTTNVLYSGYR----PIFINP---------------------- 133

Query: 189 XXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPE 248
                           +D      TG     + ++ ++ +   P   W  S  G+E++ E
Sbjct: 134 ----------------NDPKLKEDTGST--LYEFAMKLDDLNEPLSPWISSATGLEFFSE 175

Query: 249 WKGVPFNIVKNLKPF 263
           W+ +P  ++KNLKPF
Sbjct: 176 WENIPSELLKNLKPF 190

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 54/135 (40%), Gaps = 44/135 (32%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXX 188
           F  +PKVP T +L+  +++ ++LYSGYR         PLF                    
Sbjct: 100 FSWLPKVPSTSHLKQSDMTTNVLYSGYR---------PLF-------------------- 130

Query: 189 XXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPE 248
                            ++ G  +       + ++ ++ +   P   W  S  G+E++ E
Sbjct: 131 --------INPNDPKLKEDTGSTL-------YEFAMKLEDLNEPLSPWISSATGLEFFSE 175

Query: 249 WKGVPFNIVKNLKPF 263
           W  +P  +++NLKPF
Sbjct: 176 WDNIPSELLRNLKPF 190

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 236 WSMSIMGMEYYPEWKGVPFNIVKNLKPF 263
           W  S  G E+Y EW GVP +++K L+PF
Sbjct: 141 WISSATGTEFYGEWDGVPADVIKQLRPF 168

 Score = 36.2 bits (82), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRP-IMYPVKE 164
           F  +PK P T +L+ +++S  +LYSGYRP ++ P  +
Sbjct: 82  FSWLPKAPSTDHLKQRDVSTTLLYSGYRPFVLAPADQ 118

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 64/149 (42%), Gaps = 48/149 (32%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXX 188
           F  +P+VP T +L+  +++ ++LYSGYR         PLF   +  N             
Sbjct: 100 FSWLPRVPSTSHLKHTDMTTNVLYSGYR---------PLF---INPN------------- 134

Query: 189 XXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPE 248
                            ++ G  +       + ++ ++ +   P   W  S  G+E++ E
Sbjct: 135 ------------DPKLKEDTGSTL-------YEFAMKLEDLNEPLSPWISSATGLEFFSE 175

Query: 249 WKGVPFNIVKNLKPF----DKSRGTVEVM 273
           W+ +P  ++KNLKPF    +K+  T E++
Sbjct: 176 WENIPSELLKNLKPFHPPNEKALDTDELV 204

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 6/45 (13%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPV------KENPL 167
           + ++PK P T +L + E + D+ YSGYRP+   V      +ENP 
Sbjct: 103 YSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQLASEQENPC 147

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 226 IPNNLLPNKIWSMSIMGMEYYPEWKGVPFNIVKNLKPF 263
           +  NL  +  W  S  G E Y EW  +P +++ NLK F
Sbjct: 159 VKKNLKVSTPWLFSATGSELYKEWDNIPKSVLDNLKCF 196

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 22/28 (78%)

Query: 132 MPKVPMTKYLETKELSQDMLYSGYRPIM 159
           +PK P T++L+ +E+S D+ YSGYRPI 
Sbjct: 83  LPKAPSTEHLKLREISTDVFYSGYRPIF 110

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 236 WSMSIMGMEYYPEWKGVPFNIVKNLKPF 263
           W  S  G E+Y EW  VP  ++K LKPF
Sbjct: 139 WVSSATGTEFYGEWDNVPTEVIKKLKPF 166

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 233 NKIWSMSIMGMEYYPEWKGVPFNIVKNLKPF 263
           N IW+ S  GME Y EW  VP  ++ +L PF
Sbjct: 157 NSIWTSSATGMERYREWHSVPEEVINSLTPF 187

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 132 MPKVPMTKYLETKELSQDMLYSGYRPI 158
           +PKVP  K L  ++++ D+ YSG+RP+
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPL 123

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 236 WSMSIMGMEYYPEWKGVPFNIVKNLKPF 263
           W  S  G E Y EW  VP +++K+LKPF
Sbjct: 174 WVSSATGSEMYAEWDNVPGDVIKDLKPF 201

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVK 163
           + T+P+V      + K +S ++LYSGYRP+ + V+
Sbjct: 113 YSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDVE 147

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 236 WSMSIMGMEYYPEWKGVPFNIVKNLKPF 263
           W  S  G E+Y EW  +P +++K L+PF
Sbjct: 141 WISSATGTEFYGEWDNIPADVIKKLRPF 168

 Score = 35.4 bits (80), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIM 159
           F  +PK P T +L+ +++S  +LYSGYRP +
Sbjct: 82  FSWLPKAPSTDHLKHRDVSTTLLYSGYRPFV 112

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {ON}
           similar to gnl|GLV|KLLA0A07447g Kluyveromyces lactis
           KLLA0A07447g and weakly similar to YNL295W
           uniprot|P48564 Saccharomyces cerevisiae YNL295W
           Hypothetical ORF
          Length = 460

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 59/134 (44%), Gaps = 9/134 (6%)

Query: 131 TMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXXXX 190
            +P+VP T Y+   E+  + L++GYRP+   +  +P+                       
Sbjct: 57  VVPRVPPTDYISAPEIQTEGLFAGYRPLF--LGNSPINDKNGSTPLDNFFTSFANLKVVE 114

Query: 191 XXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPE-W 249
                    +++  +D   GI +G ++ + +   R P  ++P   W  SI GM Y  + +
Sbjct: 115 ESEVVGEVNVQEVIEDLRRGIPSGQMSNS-KGKNRKP--IIP---WDASISGMVYNDDPF 168

Query: 250 KGVPFNIVKNLKPF 263
           K VP N+V  LKPF
Sbjct: 169 KHVPNNVVSKLKPF 182

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 35.8 bits (81), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 236 WSMSIMGMEYYPEWKGVPFNIVKNLKPF 263
           W  S  G+E Y EW  +P  ++K LKP 
Sbjct: 235 WMSSAAGLEVYSEWDSIPIEVLKKLKPL 262

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 21/27 (77%)

Query: 132 MPKVPMTKYLETKELSQDMLYSGYRPI 158
           +PKVP  K L+ +++  ++LYSGYRP+
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPL 193

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 62/152 (40%), Gaps = 20/152 (13%)

Query: 121 PCILQNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLK--KNXXX 178
           P +  +N+   +PKV  T+Y+  KE+  + L++GYRP+      N  F   ++  KN   
Sbjct: 100 PKMFGSNLHLLVPKVASTEYIPIKEVHTEGLFAGYRPLFLG---NSSFSSDMRKGKNFHA 156

Query: 179 XXXXXXXXXXXXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYS------PRIPNNLLP 232
                                +++  +D     +   ++   ++S      P IP     
Sbjct: 157 LDDGLPNIQVIDASEKDGKLDVQEIIEDLQKTSLIENVSDKEQFSSSHKRKPVIP----- 211

Query: 233 NKIWSMSIMGMEYYP-EWKGVPFNIVKNLKPF 263
              W  SI GM Y    +K VP N++  +KPF
Sbjct: 212 ---WDASISGMVYNDMPFKYVPKNVISKMKPF 240

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 56/140 (40%), Gaps = 25/140 (17%)

Query: 132 MPKVPMTKYLETKELSQDMLYSGYRPIMY---PVKENP----LFRLTLKKNXXXXXXXXX 184
           +P+VP T YL  ++L  + L++GY+P+     P++ N     L  L              
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLFLGNSPLESNNNDVLLDGLFSSIRKLKNAQINS 149

Query: 185 XXXXXXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGME 244
                          +KK  + EY  +            P+IP        W  SI G+ 
Sbjct: 150 ENNTVEIDVSDMLDDLKKD-NQEYQRLHEKA--------PKIP--------WDASISGLV 192

Query: 245 YYPE-WKGVPFNIVKNLKPF 263
           Y  E +KGVP ++V  LKPF
Sbjct: 193 YNDEPFKGVPRSVVSKLKPF 212

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 48/134 (35%), Gaps = 11/134 (8%)

Query: 132 MPKVPMTKYLETKELSQDMLYSGYRPIMYPVKE-NPLFRLTLKKNXXXXXXXXXXXXXXX 190
           +P+VP T Y+   E+  + L++GYRP+        P  R     N               
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLFLGNSSLRPETRTNALDNFFTSFANLKVTSESK 134

Query: 191 XXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYP-EW 249
                    + +    +   +      G  R  P IP        W  SI GM Y    +
Sbjct: 135 NSAEEEVQDVIEELKRDSAQLNLKNSKGKNR-KPIIP--------WDASISGMVYNDHSF 185

Query: 250 KGVPFNIVKNLKPF 263
           K VP ++V  LKPF
Sbjct: 186 KDVPKSVVSKLKPF 199

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 33.9 bits (76), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 25/37 (67%)

Query: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKEN 165
           +  +P+VP T  ++ K+L+ ++L+S YRP+   +K +
Sbjct: 88  YSALPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 33.1 bits (74), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 125 QNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPI 158
           Q   +   P  P T++L+  +++ D+LYSGYRP+
Sbjct: 82  QKRDYSWFPVAPKTEHLKEGDIAVDLLYSGYRPL 115

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 236 WSMSIMGMEYYPEWKGVPFNIVKNLKPF 263
           W  +  G   Y EW  VP ++++NL+P+
Sbjct: 145 WVKNATGRVLYDEWDNVPQSVIRNLRPY 172

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 55/139 (39%), Gaps = 16/139 (11%)

Query: 132 MPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNXXXXXXXXXXXXXXXX 191
           +PKV  T +++ KE+  + L++GYRP+       P       KN                
Sbjct: 111 VPKVASTDHIQNKEVHTEGLFAGYRPLFLGNSSFP-SDARKGKNFHELGDVLPNIQVIDA 169

Query: 192 XXXXXXXXMKKHYDDEYGGIMTGGINGTWRYS------PRIPNNLLPNKIWSMSIMGMEY 245
                   M++  +D +   +   I+   ++S      P IP        W  SI GM Y
Sbjct: 170 SEKDGKLNMQEIIEDLHKSSLRDSIHNMEQHSSSHKRKPVIP--------WDASISGMVY 221

Query: 246 YP-EWKGVPFNIVKNLKPF 263
               +K VP ++V  +KPF
Sbjct: 222 NDMPFKHVPKSVVLRMKPF 240

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
           {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 120 APCILQNNIFRTM-PKVPMTKYLETKELSQDMLYSGYRPIM 159
            P  L+ N  RT+ PKVP T Y+ + E+  + L++GY+P+ 
Sbjct: 57  VPVPLKLNGKRTIVPKVPTTDYIPSLEMQTEGLFAGYKPLF 97

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%)

Query: 123 ILQNNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIM 159
           I  +N+   +P+V  T Y+  KE+  + L++GYRP+ 
Sbjct: 102 ISGSNLHLLVPRVASTDYISNKEVHTEGLFAGYRPLF 138

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 132 MPKVPMTKYLETKELSQDMLYSGYRPIM 159
           +P+VP T+ +  +E+  D L++GYRP+ 
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLF 101

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 59/147 (40%), Gaps = 20/147 (13%)

Query: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLK--KNXXXXXXXX 183
           +N+   +PKV  T ++  KE++ + L++GYRP+      N  F   ++  KN        
Sbjct: 106 SNLHLLVPKVASTDHIPKKEVNTEGLFAGYRPLFLG---NSSFPSDVRKGKNFHDLDEVL 162

Query: 184 XXXXXXXXXXXXXXXXMKKHYDDEYGGIMTGGINGTWRYS------PRIPNNLLPNKIWS 237
                           +++  +D     +   I+   + S      P IP        W 
Sbjct: 163 PNIQLVDASEKDGKLNVQEIIEDLQRTSLRESISNMEQSSSSHKRRPVIP--------WD 214

Query: 238 MSIMGMEYYP-EWKGVPFNIVKNLKPF 263
            SI GM Y    +K +P N+V  LKPF
Sbjct: 215 ASISGMVYNDMPFKHIPKNVVSKLKPF 241

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 128 IFRTMPKVPMTKYLETKELSQDMLYSG--YRPIM 159
           I+  +P +P T YL  K L QD++ SG  Y PI 
Sbjct: 272 IYNHLPSLPDTLYLNAKNLGQDIISSGPLYSPIF 305

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,240,844
Number of extensions: 879939
Number of successful extensions: 2407
Number of sequences better than 10.0: 52
Number of HSP's gapped: 2440
Number of HSP's successfully gapped: 85
Length of query: 278
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 170
Effective length of database: 41,097,471
Effective search space: 6986570070
Effective search space used: 6986570070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)