Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B058803.493ON1821829331e-130
Skud_16.4443.493ON1731825923e-78
Smik_16.4023.493ON1731825792e-76
YPR149W (NCE102)3.493ON1731825784e-76
NCAS0F035603.493ON1831845551e-72
Suva_16.4783.493ON1661825497e-72
CAGL0I10494g3.493ON1721835323e-69
NCAS0E008003.493ON1741825262e-68
NDAI0G009303.493ON1761825263e-68
KNAG0B008003.493ON1821835134e-66
YGR131W (FHN1)3.493ON1741825091e-65
KAFR0C019703.493ON1791835021e-64
CAGL0L08448g3.493ON1731825003e-64
Suva_7.4193.493ON1741824854e-62
TDEL0D056103.493ON1751824803e-61
KNAG0A079503.493ON1821844771e-60
Skud_7.4423.493ON1741824682e-59
Smik_6.2273.493ON1741824647e-59
Kpol_1017.63.493ON1871874659e-59
TBLA0C044903.493ON1861684543e-57
SAKL0F02750g3.493ON1701824463e-56
TPHA0D032803.493ON1841844412e-55
KAFR0G037003.493ON1861874344e-54
TBLA0D029603.493ON1891954222e-52
KLLA0D16280g3.493ON1691824091e-50
KLTH0F14850g3.493ON1711834082e-50
ZYRO0D09966g3.493ON1781834082e-50
Kwal_55.212383.493ON1701823892e-47
Ecym_12363.493ON1691823264e-38
AFR312W3.493ON1681463064e-35
Suva_4.272.61ON32291840.014
Smik_4.212.61ON31691810.036
KAFR0F003402.61ON311195760.17
YDL218W2.61ON31791710.63
NDAI0H038002.61ON354109710.66
Skud_4.352.61ON317178700.87
KLLA0F14278g1.275ON44687691.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05880
         (182 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   363   e-130
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   232   3e-78
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   227   2e-76
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   227   4e-76
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   218   1e-72
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   216   7e-72
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   209   3e-69
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   207   2e-68
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   207   3e-68
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   202   4e-66
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   200   1e-65
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   197   1e-64
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   197   3e-64
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   191   4e-62
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   189   3e-61
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   188   1e-60
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   184   2e-59
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   183   7e-59
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   183   9e-59
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   179   3e-57
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   176   3e-56
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   174   2e-55
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   171   4e-54
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   167   2e-52
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   162   1e-50
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   161   2e-50
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   161   2e-50
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   154   2e-47
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   130   4e-38
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   122   4e-35
Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)     37   0.014
Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)     36   0.036
KAFR0F00340 Chr6 (83466..84401) [936 bp, 311 aa] {ON} Anc_2.61 Y...    34   0.17 
YDL218W Chr4 (66493..67446) [954 bp, 317 aa] {ON} Putative prote...    32   0.63 
NDAI0H03800 Chr8 complement(928498..929562) [1065 bp, 354 aa] {O...    32   0.66 
Skud_4.35 Chr4 (62864..63817) [954 bp, 317 aa] {ON} YDL218W (REAL)     32   0.87 
KLLA0F14278g Chr6 complement(1324216..1325556) [1341 bp, 446 aa]...    31   1.6  

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  363 bits (933), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 182/182 (100%), Positives = 182/182 (100%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
           MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 181 QV 182
           QV
Sbjct: 181 QV 182

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  232 bits (592), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 142/182 (78%), Gaps = 9/182 (4%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           ML+  DNILR+IN +FLV+ +  IS+LLNTQ  NSSR+NFCMFAAA+G+ TDS +GV  N
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
            F+ LA WP++LF  DFLNFVFTFTAGTVLAV IRAHSC N  YV+SN ITQGS  RCR 
Sbjct: 61  FFEPLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQ 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           +QAAVAF YFSC IFLAK +MS  NM SNG FGSG++    SKRR  R+G  +VGVPTIS
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSF----SKRR--RTG--QVGVPTIS 171

Query: 181 QV 182
           QV
Sbjct: 172 QV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  227 bits (579), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 142/182 (78%), Gaps = 9/182 (4%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           ML+  DNILR+IN +FLV+++A IS+LLNTQ  +SSR+N+CMFA A+G+ TDS +GV  N
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
             + LA WP++LF  DFLNFVFTFTAGTVLAV IRAHSC N  YV+SN ITQGS  RCR 
Sbjct: 61  FIEPLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           +QAAVAF YFSC IFLAK +MS  NM SNG FGSG++    SKRR  R+G  +VGVPTIS
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSF----SKRR--RTG--QVGVPTIS 171

Query: 181 QV 182
           QV
Sbjct: 172 QV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  227 bits (578), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 118/182 (64%), Positives = 141/182 (77%), Gaps = 9/182 (4%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           ML+  DNILR+IN +FLV+++  IS+LLNTQ  +SSR+N+CMFA A+G+ TDS +GV  N
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
             + LA WP++LF  DFLNFVFTFTAGTVLAV IRAHSC N  YV+SN ITQGS  RCR 
Sbjct: 61  FIEPLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           +QAAVAF YFSC IFLAK +MS  NM SNG FGSG++    SKRR  R+G  +VGVPTIS
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSF----SKRR--RTG--QVGVPTIS 171

Query: 181 QV 182
           QV
Sbjct: 172 QV 173

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  218 bits (555), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 130/184 (70%), Positives = 149/184 (80%), Gaps = 3/184 (1%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLSKVDN LR  N IFLVL +AFIS LL+TQ + SSR+N+CMFAAAFGLLTDSFFG+A N
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
           + D L+SWPI+LF+FDFLNFVFTFTAGTVLAV IR HSC N RY+ SN I QGS  RCR+
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRT--NRSGANEVGVPT 178
           SQAAVAFFYF+ F+FLAKMIMS I+MASNG FGSG++  SR KRR+     G    GVPT
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFM-SRRKRRSGAGVGGTTGGGVPT 179

Query: 179 ISQV 182
           IS+V
Sbjct: 180 ISEV 183

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  216 bits (549), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 116/182 (63%), Positives = 140/182 (76%), Gaps = 16/182 (8%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           ML+ VDNILR+IN +FLV+++  IS+LLNTQ  NSSRIN+CMFA A+ ++TDS +GV  N
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
            F+ LA WP++LF  DFLNFVFTFTA       IRAHSC+N+ Y+ SNSITQGS NRCR 
Sbjct: 61  FFEPLA-WPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           +QAAVAF YFSC IFLAK +MS  NM SNG FGSG++    SKRR  R+G  +VGVPTIS
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSF----SKRR--RTG--QVGVPTIS 164

Query: 181 QV 182
           QV
Sbjct: 165 QV 166

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  209 bits (532), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 136/183 (74%), Gaps = 12/183 (6%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS  DN+LR++NA+FL++ +   S+L+NT++ +SSR+NFC+FAAA+G+ TDS +G+  N
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNS-ITQGSENRCR 119
            F+ LA WP++LF+ DFLNFVFTFTAGTVLAV IRAHSC N+RY+   + I QGS  RCR
Sbjct: 61  FFEPLA-WPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119

Query: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTI 179
            +QA VAFFYFS  IFLAKMIMS +++ SNG FG+          +  R    EVGVP+I
Sbjct: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGA----------KLRRKHHTEVGVPSI 169

Query: 180 SQV 182
           SQV
Sbjct: 170 SQV 172

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  207 bits (526), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 111/182 (60%), Positives = 130/182 (71%), Gaps = 8/182 (4%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           ML   DN+LR++NA+FLV+ +   SALLNT+ +N+SRIN+CMF  A+ L TDS +G+  N
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
            FD LA  P L F  DFLNF FTF AGTVLA  IRAHSCK+E YVNSN ITQG +NRCR 
Sbjct: 61  FFDILA-LPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           SQA VAFFYFS  IFLAK+IMS INM  NG F   T    R +RR     A E+GVP+IS
Sbjct: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAF---TQHIGRRRRR----NAAEIGVPSIS 172

Query: 181 QV 182
           QV
Sbjct: 173 QV 174

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  207 bits (526), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 135/182 (74%), Gaps = 6/182 (3%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS  DN+LR++NA+FLV+ +   SALLNTQ+ ++SRIN+CMF   + LLTDSFFG+  N
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
            F+ L S+P +LF  DFLNF FTF AGTVLA  IR+HSC N+ Y++ N ITQGS NRCR 
Sbjct: 61  FFEFL-SFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           SQA VAFFYFS FIFL K+ MS I+M  NG F S T+    + RR  R+GA EVGVP+IS
Sbjct: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAF-SNTF----TSRRRRRNGAAEVGVPSIS 174

Query: 181 QV 182
           QV
Sbjct: 175 QV 176

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  202 bits (513), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 134/183 (73%), Gaps = 2/183 (1%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           ML   DN+LR++N  FLV+ +AFIS L+NTQ+ + SR+N+CMFAAA+G+ TD  +G+  N
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
            ++ LA WP++LF  DFLNF FT TAG VLAV IRAHSCKN RY   N I QGSENRCR+
Sbjct: 61  FWEPLA-WPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEV-GVPTI 179
           SQAA AFF+FS  IF+AKM+MSGIN+ASNG F + +    R +R     G  E  GVP+I
Sbjct: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSI 179

Query: 180 SQV 182
           SQV
Sbjct: 180 SQV 182

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  200 bits (509), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 129/182 (70%), Gaps = 8/182 (4%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS  DN++R+INA+FL++++  IS L+ TQ  +SSR+NFCMFAA +GL+TDS +G   N
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
            + +L ++P +L + DFLNF+FTF A T LAV IR HSCKN+ Y+  N I QGS +RC  
Sbjct: 61  FWTSL-TYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           SQAAVAFFYFSCF+FL K+ ++ + M  NG FGS T    R  RR       ++G+PTIS
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARR-------QMGIPTIS 172

Query: 181 QV 182
           QV
Sbjct: 173 QV 174

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  197 bits (502), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 129/183 (70%), Gaps = 5/183 (2%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQR-NNSSRINFCMFAAAFGLLTDSFFGVAF 59
           ML   DNILR+INA+FL++ +A  SAL+NTQ  +++SR+N+CMFA AFGL  DS +G+  
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119
           N F  LA WP+LLF  DFLNF FTF+A T LAV IRAHSC N+ Y++SN I +GS  RCR
Sbjct: 61  NFFQVLA-WPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119

Query: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTI 179
            +QA VAF YFS  IF+AKMIMS IN+  NG F SG+   SR   R  +   +  GVP I
Sbjct: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGS---SRFISRRKKHATDVGGVPNI 176

Query: 180 SQV 182
           SQV
Sbjct: 177 SQV 179

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  197 bits (500), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 103/182 (56%), Positives = 131/182 (71%), Gaps = 9/182 (4%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           ML+  DN+LR++N +F+V+ +  IS L+ T+  +SSR+N+CMFAAA+G+ TDS +GV  N
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
            F+ LA WP++LF  DFLNF F  TAG VLAV IRAHSC N  Y  +N I QGSE RCR 
Sbjct: 61  FFEILA-WPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           SQAAVAFF+FS  IFLAKMIMS +N+ SNG FG+        +RR N +   EVGVP++S
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFI-----RRRRNNA---EVGVPSVS 171

Query: 181 QV 182
           QV
Sbjct: 172 QV 173

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  191 bits (485), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 98/182 (53%), Positives = 136/182 (74%), Gaps = 8/182 (4%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS  DNI+R+INAIFL++++  +S L+++Q  +SSR+NFCMFAAA+GLLTDSF+G   N
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
           ++ +L ++P+++F+ DFLNF+FTF AGT LAV IR HSC N+ Y+++N ITQGS +RC  
Sbjct: 61  LWSSL-TYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           ++AAV FFYFSC +FL K+++S   M  NG FG G   G R  RR       ++G+PTIS
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARR-------QMGIPTIS 172

Query: 181 QV 182
           QV
Sbjct: 173 QV 174

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  189 bits (480), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 103/182 (56%), Positives = 138/182 (75%), Gaps = 7/182 (3%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           ML+ VDN LR++N  FLV+ +  +  L++++  +SSR+NFCMFAAAFG++TDSF+G+  N
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
           +++  A WP++LF  DFLNF FTF+A T LAV IR HSCKN+ Y++SN+ITQGS  RCR+
Sbjct: 61  IWEVFA-WPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           +QA+VAFFYFS FIFLAKMIMS I + +NG F S T   SR ++      + +VGVPTIS
Sbjct: 120 AQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRK------SAQVGVPTIS 173

Query: 181 QV 182
           QV
Sbjct: 174 QV 175

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  188 bits (477), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 132/184 (71%), Gaps = 4/184 (2%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           ML+  D  LR++N +FLV+ M  ISALLNTQ  +SSRIN+CMF AA+G+ TDSF+GV  N
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
            ++ L SWP+LL   DFLNFVFT TAG VLAV IRAHSCKN  Y N N I QGSENRCR 
Sbjct: 61  FWEPL-SWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSG--TWAGSRSKRRTNRSGANEVGVPT 178
           +QAAVAFF+FS  IFLAK IMS +N+ +NG FGS   +  GSR  +R    G  + GVP 
Sbjct: 120 AQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQ-GVPN 178

Query: 179 ISQV 182
           IS V
Sbjct: 179 ISTV 182

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  184 bits (468), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 100/182 (54%), Positives = 131/182 (71%), Gaps = 8/182 (4%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS  DN++R+++A+FL++++  I  L+ TQ N SSR+NFCMFAAA+GL+TDSF+G   N
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
            + +L ++P +L + DFLNF+FTF A T LAV IR HSCKN+ Y+  N+ITQGS +RC  
Sbjct: 61  FWSSL-TYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           SQAAVAFFYFSCF+FL K+ +S   M  NG FG  T  G R  RR       ++GVPTIS
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARR-------QMGVPTIS 172

Query: 181 QV 182
           QV
Sbjct: 173 QV 174

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  183 bits (464), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 126/182 (69%), Gaps = 8/182 (4%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS  DN++R+INA+FL++++  IS L++TQ  +SSR+NFCMF AA+GL+TDS +G   N
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
            + +L ++P +L   D LNF+FTF A T LAV IR HSCKN+ Y+  N ITQ S +RC  
Sbjct: 61  FWSSL-TYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           SQAAVAFFYFSCF+FL K+ ++      NG FG  +  G R  RR       ++GVPTIS
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARR-------QLGVPTIS 172

Query: 181 QV 182
           QV
Sbjct: 173 QV 174

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  183 bits (465), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 99/187 (52%), Positives = 130/187 (69%), Gaps = 5/187 (2%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS  DNI+R IN  F V+ M  I +LL T++ +SSR+N+CMF   F ++TDSF+G+  N
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
           ++    +WPI+LF FDFLNF FTFTAGTVL+V IR HSCKN  Y+++N I QGS +RCR 
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSG-----ANEVG 175
           +QA++AFFYFS FIF  K++MS IN+ SNG  G  T +  R +  T   G     + +VG
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 176 VPTISQV 182
           VP ISQV
Sbjct: 181 VPNISQV 187

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  179 bits (454), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 87/168 (51%), Positives = 119/168 (70%), Gaps = 3/168 (1%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQ-RNNSSRINFCMFAAAFGLLTDSFFGVAF 59
           MLS+  N+LR+IN  FLV+    I  L+ ++ R +S R+N+CMFAA F L+TDSF+ +  
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119
           N + +  +WPILL+ FDFLNF FTFTAGTVL+V IR HSC N+ Y+ SN ITQGS  RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGS--RSKRR 165
           ++QA++AF+YFS FI+L +++ S + M  NGLF      G+  R+ RR
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPEERGGASFRNSRR 168

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  176 bits (446), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 100/182 (54%), Positives = 124/182 (68%), Gaps = 12/182 (6%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS +DN LR++N  FLV+ +    +L+ TQ  +S R+NF +F AAF L+TDSF+ V  N
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
           +F A A WPILL  +DFLNFVFTF+A T LAV IR HSC NE Y+ SN+ITQGS +RCR 
Sbjct: 61  LFSAFA-WPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           +QA VAF YFS FIFL K+++S IN+ S     SG +      RR N      VGVPTIS
Sbjct: 120 AQATVAFLYFSFFIFLTKLVLSVINVFS-----SGAFGSGSGSRRAN------VGVPTIS 168

Query: 181 QV 182
           QV
Sbjct: 169 QV 170

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  174 bits (441), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 128/184 (69%), Gaps = 2/184 (1%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           ML   DNILR +N  F V+ +  + +LL TQ  +SSR+N+C+F   F L+TD+F+G   N
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
           ++    +WPI+LF FDFLNF FTFTAGTVLAV  R HSC N+ Y++SN+ITQGS +RCR 
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTW--AGSRSKRRTNRSGANEVGVPT 178
           +QAA AFFYFS FIFLAK+IMS IN+ +NG  GS ++      +      + + ++GVP 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 179 ISQV 182
           ISQV
Sbjct: 181 ISQV 184

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  171 bits (434), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 137/187 (73%), Gaps = 6/187 (3%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNT-QRNNSSRINFCMFAAAFGLLTDSFFGVAF 59
           ML+  DN LR++N  F+V+TMAFI+ LLNT Q +NS+R+N+CMFA AFG+LTDS +G+  
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119
           N F+ LA WPI+LF+FDFLNFVF FTAGTVLAV IRAH+C NE Y NSN I +GSE RCR
Sbjct: 61  NFFEQLA-WPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119

Query: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNG--LFGSGTWAGSRSKRRTNRSG--ANEVG 175
           ++QAAVAFFYFS  IFL K + S +   S G    GS    GSR KRR+  +G      G
Sbjct: 120 VAQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTG 179

Query: 176 VPTISQV 182
           VPT+S+V
Sbjct: 180 VPTVSEV 186

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  167 bits (422), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 120/195 (61%), Gaps = 19/195 (9%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQR-NNSSRINFCMFAAAFGLLTDSFFGVAF 59
           ML   DN+ R+ N  F V+T   I  LLNT+  ++SSR+N+CMF  A+GL++DSF+G+  
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119
           N+     ++P +LF FDFLNFVFTFTAGTVLAV IR HSC N+ Y   N I QGSE RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGS------------GTWAGSRSKRRTN 167
            +QA +AFFYFS F+FL K++++ +   + G  G             G    +R+  + N
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQTGYGGGYGGRSFGRRPRTRAPPQMN 180

Query: 168 RSGANEVGVPTISQV 182
           + G       +ISQV
Sbjct: 181 KGGI------SISQV 189

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  162 bits (409), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 120/182 (65%), Gaps = 13/182 (7%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS +DN LR +N +FL++ +  +  L+ TQ ++SSR+NF +FAA FG++ DS + +  N
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
              ALA WPI+L   DFLN+VFTF+A T LAV IR  SC N+ + + N I +GS++RCR 
Sbjct: 61  FISALA-WPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           +QA+  F YFS  IFL K I+S +N  ++G F      G+ S R+T      +VGVPTIS
Sbjct: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAF------GTSSNRKT------QVGVPTIS 167

Query: 181 QV 182
           QV
Sbjct: 168 QV 169

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  161 bits (408), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/183 (53%), Positives = 127/183 (69%), Gaps = 13/183 (7%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQR-NNSSRINFCMFAAAFGLLTDSFFGVAF 59
           MLS +DN LR +N  FLV+ +    +L  T + +N+ ++NF +F AAFGLL DS + +  
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119
           N   ALA WP+L+ +FDFLNFVFTF A T LAVAIR HSC N+ Y++SN++TQGS +RCR
Sbjct: 61  NFVSALA-WPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCR 119

Query: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTI 179
            +QA+VAF YFS FIFLAK+ +S +N+ S G FG+G      S RRT       VGVPTI
Sbjct: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAG------SSRRT-----GNVGVPTI 168

Query: 180 SQV 182
           SQV
Sbjct: 169 SQV 171

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  161 bits (408), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 129/183 (70%), Gaps = 6/183 (3%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRN-NSSRINFCMFAAAFGLLTDSFFGVAF 59
           ML+  DNILR +N  F V+ +  +  L+ ++++ ++SR+NFCMFAAAFG++ DSF+G+  
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119
           N+F   A +P++LFI DFLNFVFTFTA T LAV IR HSC N  Y++SN ITQGS +RCR
Sbjct: 61  NIFVPFA-FPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119

Query: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTI 179
            +QA VAFFYF+ FIFL KM+MS +++ SNG       + S    R  R+    VGVPTI
Sbjct: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNG----AFGSSSGFSSRRRRTQQANVGVPTI 175

Query: 180 SQV 182
           SQV
Sbjct: 176 SQV 178

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  154 bits (389), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/182 (50%), Positives = 123/182 (67%), Gaps = 12/182 (6%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS +DN LR  N +FL++ +    +L  T+ NN+ ++NF +FAAAFGLL D+ + +  N
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
              ALA WP+L+ +FDFLNFVFTF A T LAVAIR HSC N  YV++N +TQGS +RCR 
Sbjct: 61  FISALA-WPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRK 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
           +QA+VAF YF+ F+FL K+ +S +N+ S G F +           + R  AN VGVPTIS
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTS----------SGRKSAN-VGVPTIS 168

Query: 181 QV 182
           QV
Sbjct: 169 QV 170

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  130 bits (326), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 87/182 (47%), Positives = 110/182 (60%), Gaps = 13/182 (7%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS +DN LR  N +FL++ +A   +L+N Q  + SR+NF +F A F LL DS + V  N
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
              ALA WPILL   D LN +FTF A T L  AI  HSC N  ++  N I++G E RCR 
Sbjct: 61  FISALA-WPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRK 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180
            QA+  F +FS FIFLAK ++SG+N+ S G F SG      S R+T        GVPTIS
Sbjct: 120 VQASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSG------SGRKTGG------GVPTIS 167

Query: 181 QV 182
           QV
Sbjct: 168 QV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  122 bits (306), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 67/146 (45%), Positives = 97/146 (66%), Gaps = 1/146 (0%)

Query: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60
           MLS +DN LR +N +FL++ +    +L++ QRN+ SR+NF +F A F L+TDSF+ +  N
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120
              A A WPI+    D LN +FTF A T L  +I AHSC N  +++ N+I++ S +RCR 
Sbjct: 61  FISAFA-WPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119

Query: 121 SQAAVAFFYFSCFIFLAKMIMSGINM 146
            QA+  F +FS FIFLAK + SG+N+
Sbjct: 120 VQASSTFLFFSFFIFLAKAVFSGLNI 145

>Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)
          Length = 322

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 41/91 (45%), Gaps = 15/91 (16%)

Query: 89  VLAVAIRAHSCKNE----RYVNSNS---ITQGSENRCRMSQAAVAFFYFSCFIFLAKMIM 141
           VLA A   HSCK+      Y +  S    T      C  SQAA+AF      +FL  +++
Sbjct: 92  VLAKAQGQHSCKSRNSSGEYYDPYSGQYTTTNHRRACNSSQAAIAFAGLCFLLFLTSVVL 151

Query: 142 SGINM--------ASNGLFGSGTWAGSRSKR 164
            G+N+         S GL+ +G   G+R  R
Sbjct: 152 LGVNILTPIMGRYKSQGLWRTGASMGTRLHR 182

>Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)
          Length = 316

 Score = 35.8 bits (81), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 42/91 (46%), Gaps = 15/91 (16%)

Query: 89  VLAVAIRAHSC----KNERYVN--SNSITQGSENR-CRMSQAAVAFFYFSCFIFLAKMIM 141
           VLA A   HSC     N  Y N  S   T  S  R C  SQAA+AF      +FL  +I+
Sbjct: 92  VLAKAQGEHSCGSTNANGLYYNPYSGQYTANSHRRACNSSQAAIAFSGLCFLLFLTSVIL 151

Query: 142 SGINM--------ASNGLFGSGTWAGSRSKR 164
            GIN+         + G++ SG   G++  R
Sbjct: 152 LGINVLTPIRKRYQTQGMWRSGASMGTKLHR 182

>KAFR0F00340 Chr6 (83466..84401) [936 bp, 311 aa] {ON} Anc_2.61
           YDL218W
          Length = 311

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 81/195 (41%), Gaps = 38/195 (19%)

Query: 6   DNILRVINAIFLVLTMAFISALLNTQRNNSSR-INFCMFAAAFGLLTDSFFGVAFNMFDA 64
           ++ILR +      + +  I+  L++  N+ SR  NF +   A G+    F+ +A      
Sbjct: 24  NSILRFLQFASTSIVLGLIAFALHSYHNHGSRRANFALAVGAIGV----FYCLAVFFLTL 79

Query: 65  LASWPILLFIFDFLNFVFT--FTAGTVLAVAI-RAHSCKNERYVNSNS------------ 109
           +A   +L  IF     + T  F  G ++A  +   HSC      + N             
Sbjct: 80  IAPQLVLGGIFLIAEIIMTLLFLCGFIVAAKVFGQHSCGTHVVSSYNPAYGSFADFQSTG 139

Query: 110 ----------ITQGSENRCRMSQAAVAFFYFS-------CFIFLAKMIMSGI-NMASNGL 151
                      T+   N CR S+A++AF   +       C +   +++M  I +  S+G+
Sbjct: 140 GQYDPFKGTYTTKSYTNACRSSKASIAFLGLAFVLSAICCILIGIRVLMPIIRDYGSSGI 199

Query: 152 FGSGTWAGSRSKRRT 166
           + SGT  G++ +R T
Sbjct: 200 WKSGTSIGAKLQRAT 214

>YDL218W Chr4 (66493..67446) [954 bp, 317 aa] {ON} Putative protein
           of unknown function; YDL218W transcription is regulated
           by Azf1p and induced by starvation and aerobic
           conditions; expression also induced in cells treated
           with the mycotoxin patulin
          Length = 317

 Score = 32.0 bits (71), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 41/91 (45%), Gaps = 15/91 (16%)

Query: 89  VLAVAIRAHSCKNER----YVN--SNSITQGSENR-CRMSQAAVAFFYFSCFIFLAKMIM 141
           VLA A    SC N      Y N  S   T  S  R C  SQAA+AF      +FL  +I+
Sbjct: 92  VLAKAQGERSCSNTNADGLYYNPYSGQYTADSHRRACNSSQAAIAFSGLCFVLFLISVIL 151

Query: 142 SGINM--------ASNGLFGSGTWAGSRSKR 164
            GIN+         + G++ SG   G++  R
Sbjct: 152 LGINVLTPIRKRYQTQGMWRSGASMGTKLHR 182

>NDAI0H03800 Chr8 complement(928498..929562) [1065 bp, 354 aa] {ON}
           Anc_2.61
          Length = 354

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 44/109 (40%), Gaps = 32/109 (29%)

Query: 89  VLAVAIRAHSCKNERYVNSNSITQGS-----------------------ENRCRMSQAAV 125
           V+A  +  HSC N R VN  +   GS                          C  S+ A+
Sbjct: 144 VIAKTVGEHSCSNSR-VNQYNPAYGSISSFQQSGGTYNPYTGEYTTSNYHRACNTSKTAI 202

Query: 126 AFFYFSCFIFLAKMIMSGINM--------ASNGLFGSGTWAGSRSKRRT 166
           AF  F+  +F+   I+ G+N+           GL+  G++ GS+ +R T
Sbjct: 203 AFAGFAFVLFVITCILLGLNVLKPIVRNFGGQGLWKDGSYIGSKLQRFT 251

>Skud_4.35 Chr4 (62864..63817) [954 bp, 317 aa] {ON} YDL218W (REAL)
          Length = 317

 Score = 31.6 bits (70), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 78/178 (43%), Gaps = 27/178 (15%)

Query: 8   ILRVINAIFLVLTMAFISALLNTQRN-NSSRINFCMFAAAFGLLTDSFFGVAFNMFDALA 66
           ILR +     VL M+ ++  ++   N  + + NF +   A G+++  F+ +A  +     
Sbjct: 11  ILRFLQFASSVLVMSLLAYAIHAYGNRGNKKTNFTL---ATGVIS-VFYLIALGIL--CL 64

Query: 67  SWPILLFI-----FDFLNFVFTFTAGTVLAVAIRAHSCKNER----YVN--SNSITQGSE 115
           + P L++I      + +  +    A  VLA A    SC N      Y N  S   T    
Sbjct: 65  ALPTLIYIGMYFCAELIMCMLWLAAFVVLAKAQGERSCGNTNAQGLYYNPYSGEYTADRH 124

Query: 116 NR-CRMSQAAVAFFYFSCFIFLAKMIMSGINM--------ASNGLFGSGTWAGSRSKR 164
            R C  SQAA+AF      +FL  +I+ G+N+         + G++ SG   G++  R
Sbjct: 125 RRACNASQAAIAFSGLCFVLFLTSVILLGVNVLTPIRRRYKTQGMWKSGASMGTKLHR 182

>KLLA0F14278g Chr6 complement(1324216..1325556) [1341 bp, 446 aa]
           {ON} similar to uniprot|P47026 Saccharomyces cerevisiae
           YJL091C GWT1 Protein involved in the inositol acylation
           of glucosaminyl phosphatidylinositol (GlcN-PI) to form
           glucosaminyl(acyl)phosphatidylinositol (GlcN(acyl)PI) an
           intermediate in the biosynthesis of
           glycosylphosphatidylinositol (GPI) anchors
          Length = 446

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 9/87 (10%)

Query: 55  FGVAFNMFDALASWPILLFIFDFLN----FVFTFTAGTVLAVAIRAHSCKNERYVNSNSI 110
           +G+ +N F  L+  P+ + IFDF N    FV    A  +  + +  H    +  +N+  I
Sbjct: 221 YGIHWNFFFTLSLLPLAMIIFDFYNMRLRFVIGLIAAIIYELCLIYHPTFLDYLLNAERI 280

Query: 111 TQGSENRCRMSQAAVAFFYFSCFIFLA 137
              S NR       +  F   C I+LA
Sbjct: 281 DFISANR-----EGIFSFVGYCIIYLA 302

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,967,582
Number of extensions: 572600
Number of successful extensions: 1994
Number of sequences better than 10.0: 52
Number of HSP's gapped: 1980
Number of HSP's successfully gapped: 53
Length of query: 182
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 79
Effective length of database: 41,670,801
Effective search space: 3291993279
Effective search space used: 3291993279
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 62 (28.5 bits)