Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B058603.492ON68168130690.0
NCAS0F035503.492ON4413204264e-45
KNAG0A079403.492ON2752151302e-07
KLTH0F14828g3.492ON8361381136e-05
SAKL0F02772g3.492ON7731041111e-04
TPHA0D042503.492ON629741092e-04
Suva_7.4183.492ON831921082e-04
ZYRO0D09988g3.492ON9941301074e-04
YGR130C3.492ON8161411064e-04
Smik_6.2263.492ON839841000.002
NDAI0G009403.492ON656243970.006
Skud_7.4413.492ON807150940.011
NCAS0E008103.492ON692282930.017
Kwal_55.212293.492ON787152880.060
CAGL0I10516g3.492ON813117860.10
KLLA0D16236g3.492ON87180850.15
TDEL0D056003.492ON70095830.22
TBLA0C044803.492ON80298830.26
KNAG0B008103.492ON75751810.43
TDEL0C064201.60ON75741761.6
AFR310C3.492ON62385761.6
CAGL0J04708g4.301ON630109752.0
KAFR0G036903.492ON363187723.5
ZYRO0A03762g3.235ON56741715.6
Kpol_480.143.492ON69937716.1
NOTE: 2 genes in the same pillar as NDAI0B05860 were not hit in these BLAST results
LIST: KAFR0C01960 Ecym_1237

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05860
         (681 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...  1186   0.0  
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...   168   4e-45
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    55   2e-07
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...    48   6e-05
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...    47   1e-04
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    47   2e-04
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...    46   2e-04
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    46   4e-04
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...    45   4e-04
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...    43   0.002
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...    42   0.006
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...    41   0.011
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...    40   0.017
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...    39   0.060
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...    38   0.10 
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...    37   0.15 
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...    37   0.22 
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    37   0.26 
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    36   0.43 
TDEL0C06420 Chr3 complement(1174443..1176716) [2274 bp, 757 aa] ...    34   1.6  
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    34   1.6  
CAGL0J04708g Chr10 (447836..449728) [1893 bp, 630 aa] {ON} simil...    33   2.0  
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    32   3.5  
ZYRO0A03762g Chr1 complement(298936..300639) [1704 bp, 567 aa] {...    32   5.6  
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...    32   6.1  

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 1186 bits (3069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/681 (87%), Positives = 598/681 (87%)

Query: 1   MRTXXXXXXXXXXXXVMGDVTCVLDIKGPSITTTAEMFGCLWKGGGGTKRGDTFXXXXXX 60
           MRT            VMGDVTCVLDIKGPSITTTAEMFGCLWKGGGGTKRGDTF      
Sbjct: 1   MRTAMAMAMAMAMAMVMGDVTCVLDIKGPSITTTAEMFGCLWKGGGGTKRGDTFRGDDPP 60

Query: 61  XXXXXXXXXXLCRCVQKGGHPDNPDIPFLCHQTPKVSISDVGHSGLVIDRVENLLTRINH 120
                     LCRCVQKGGHPDNPDIPFLCHQTPKVSISDVGHSGLVIDRVENLLTRINH
Sbjct: 61  GMRGRERRGRLCRCVQKGGHPDNPDIPFLCHQTPKVSISDVGHSGLVIDRVENLLTRINH 120

Query: 121 SHSLTVNTSVYVYISFIPQLKQSFFFCKIISVASRVPEGIIDRYHNPSFTTNQEKGSKHK 180
           SHSLTVNTSVYVYISFIPQLKQSFFFCKIISVASRVPEGIIDRYHNPSFTTNQEKGSKHK
Sbjct: 121 SHSLTVNTSVYVYISFIPQLKQSFFFCKIISVASRVPEGIIDRYHNPSFTTNQEKGSKHK 180

Query: 181 MSVLTSKERSIAYQSDQEHFDQFYDRYLAQINRXXXXXXXXXXXXXXXXXFSTQLRTNKE 240
           MSVLTSKERSIAYQSDQEHFDQFYDRYLAQINR                 FSTQLRTNKE
Sbjct: 181 MSVLTSKERSIAYQSDQEHFDQFYDRYLAQINRQQQVSQEKKSKENKQNVFSTQLRTNKE 240

Query: 241 NKKPNKQFVSQFRHNLIDNEFYENHLNYMRSQRHQSTTKNQLQNKEKITPNFLIENDSKQ 300
           NKKPNKQFVSQFRHNLIDNEFYENHLNYMRSQRHQSTTKNQLQNKEKITPNFLIENDSKQ
Sbjct: 241 NKKPNKQFVSQFRHNLIDNEFYENHLNYMRSQRHQSTTKNQLQNKEKITPNFLIENDSKQ 300

Query: 301 HRILQDIITRETNFNHLKNLQKIISQSELESQDLTPTMQKIKDSKIYPKVYYKNFNMTKH 360
           HRILQDIITRETNFNHLKNLQKIISQSELESQDLTPTMQKIKDSKIYPKVYYKNFNMTKH
Sbjct: 301 HRILQDIITRETNFNHLKNLQKIISQSELESQDLTPTMQKIKDSKIYPKVYYKNFNMTKH 360

Query: 361 PPNINQQLSQNQKIYPPFNPQLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHA 420
           PPNINQQLSQNQKIYPPFNPQLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHA
Sbjct: 361 PPNINQQLSQNQKIYPPFNPQLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHA 420

Query: 421 NWMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNK 480
           NWMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNK
Sbjct: 421 NWMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNK 480

Query: 481 RFQLFSLLNHEKYVLNNNKLALCDQLDNTELLQRHIKDPKDSLQQKLKDNDRKRKATQLK 540
           RFQLFSLLNHEKYVLNNNKLALCDQLDNTELLQRHIKDPKDSLQQKLKDNDRKRKATQLK
Sbjct: 481 RFQLFSLLNHEKYVLNNNKLALCDQLDNTELLQRHIKDPKDSLQQKLKDNDRKRKATQLK 540

Query: 541 NKREXXXXXXXXXXXXXHQKDNKDSLNERVKEKDKNTQINATKLKNREATXXXXXXXXXX 600
           NKRE             HQKDNKDSLNERVKEKDKNTQINATKLKNREAT          
Sbjct: 541 NKRESVCDSSTSSICSSHQKDNKDSLNERVKEKDKNTQINATKLKNREATVCNSSSSSVC 600

Query: 601 XXYQKKQGNLGSTTADQRHEMEVNDSELEPEPVVRTIEKNERLFEVKTNEQEDMEXXXXX 660
             YQKKQGNLGSTTADQRHEMEVNDSELEPEPVVRTIEKNERLFEVKTNEQEDME     
Sbjct: 601 SSYQKKQGNLGSTTADQRHEMEVNDSELEPEPVVRTIEKNERLFEVKTNEQEDMENNDND 660

Query: 661 XXXXXXXXLYEYETKEEIVYV 681
                   LYEYETKEEIVYV
Sbjct: 661 NDDDDDDDLYEYETKEEIVYV 681

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  168 bits (426), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 111/320 (34%), Positives = 184/320 (57%), Gaps = 27/320 (8%)

Query: 183 VLTSKERSIAYQSDQEHFDQFYDRYLAQINRXXXXXXXXXXXXXXXXXFSTQLRT--NKE 240
           ++T+K+RS   Q DQEHFDQFYD+Y+ ++N                    TQ     N+E
Sbjct: 1   MITAKQRSQTIQLDQEHFDQFYDQYVTELNESRRRGTHI-----------TQFNAVENEE 49

Query: 241 NKKPNKQFVSQFRHNLIDNEFYENHLNYMRSQRHQSTTKNQLQNKEKITPNFLIENDSKQ 300
           +  PN +FVS FR  L++N +Y N+L +M+ QRH S  K + +N   +TP FL   + KQ
Sbjct: 50  SLTPNARFVSTFREPLMNNRYYANYLYHMKQQRHPSLRKYESRNPNIVTPEFLKGKEEKQ 109

Query: 301 HRILQDIITRETNFNHLKNLQKIISQSELESQDLTPTMQKIKDSKIYPKVYYKNFNMTKH 360
              L ++  +E N   LKN Q+II+ S   +    P  Q      IYPKVYY++ +  + 
Sbjct: 110 KNDLFNLQMKEQNLQRLKNSQRIITSSTART---YPQQQ-----NIYPKVYYEH-SKKRT 160

Query: 361 PPNINQQLSQNQKIYPPFNPQLNPIATTTNPEILIKLNDDKT-IITKQTYDKLLELNQDH 419
           PP   +Q  +   + PP +P+  PIAT  NPEIL++L +++  I++K+TYD+L+++  +H
Sbjct: 161 PPTEQEQFHRG--MNPP-SPKY-PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEH 216

Query: 420 ANWMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTN 479
             W+ + N E+   YN + + YQ++++ L+E+I ++  + ++++ D L+  E+N      
Sbjct: 217 DAWLKSYNAENMANYNQRHQWYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALV 276

Query: 480 KRFQLFSLLNHEKYVLNNNK 499
           KRFQ+  L+  EK +L  N+
Sbjct: 277 KRFQINKLIGEEKILLMKNR 296

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 103/215 (47%), Gaps = 30/215 (13%)

Query: 290 PNFLIENDSKQHRILQDIITRETNFNHLKNLQKIIS-QSELESQDLTPTMQKIKDSKIYP 348
           P  L EN+ +Q  ILQD+  +E + +HLK  Q+++     +E +D+   +++  D +  P
Sbjct: 47  PAELTENEMRQRAILQDLDEKEQHLDHLKKSQRVVYIDKPVEKEDV---VREPVDIQKVP 103

Query: 349 KVYYKNFNMTKHPPNINQQLSQNQKIYPPFNPQLNPIATTTNPEILI---KLNDDKTIIT 405
           K+ Y  +               N+  +       NP+AT   PE ++    LN      +
Sbjct: 104 KIPYSEYGQC------------NEAEF------RNPVATPETPEEVVIYKHLNGTNKAYS 145

Query: 406 KQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKD 465
           K+ +D +     +H  W+++  G++++   TK + Y ++L  L++QI      ++ +++ 
Sbjct: 146 KEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRK 205

Query: 466 TLKNKELNDAILTNKRFQLFSLLNHEKYVLNNNKL 500
             +  +LN+  LT K F    LL  +++    NK+
Sbjct: 206 QQRAIDLNENRLT-KTF----LLQTQQFTAEKNKI 235

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 6/138 (4%)

Query: 384 PIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQE 443
           P+A+  +PE ++K   DK  ++K  YD L      H   M +   E    Y  K   Y++
Sbjct: 376 PVASPNDPEFIVKF--DKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYED 433

Query: 444 KLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQLFSLLNHEKYVL----NNNK 499
           +L  L  QI      +  ++KDT +  E+++A L+ +   L +  +  K V+     N K
Sbjct: 434 RLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMK 493

Query: 500 LALCDQLDNTELLQRHIK 517
            A  ++ +  E  Q  +K
Sbjct: 494 AAKVEEKEGVEAKQEDVK 511

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 2/104 (1%)

Query: 381 QLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKT 440
           Q  P+AT  +PE +++   DK  ++K  YDKL    Q H N +   N E ++ Y+   K 
Sbjct: 347 QDQPLATPQDPEYIVRT--DKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKE 404

Query: 441 YQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQL 484
           Y +KL  L  QI+     +  ++ DT +  +++++ L+ K   L
Sbjct: 405 YNDKLTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDL 448

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 380 PQLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFK 439
           P+ + +A+  NPE L++ N+   I++K  YD++    + H+ W+ N N      YNTK +
Sbjct: 310 PETHAVASPENPEYLVRTNE-YNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQ 368

Query: 440 TYQEKLNKLNEQIN 453
            Y++KL +L +Q++
Sbjct: 369 EYEDKLVELQKQLD 382

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 382 LNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTY 441
           LNP+AT  NPE+++K  +    ++K  YDK+    + H  W+++        Y+ K   Y
Sbjct: 410 LNPVATPENPELIVKTKE-HGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEY 468

Query: 442 QEKLNKLNEQINHHNLIISMIKKDTLKNKELN 473
           +EKL  L  QI+     +  ++++T +  E+N
Sbjct: 469 KEKLQDLQNQIDEIENSMKQLREETSQKIEVN 500

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 11/130 (8%)

Query: 383 NPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQ 442
           NP+AT  NPEIL+K  D +  ++K  YDK+   N  H+ W+          Y  K   Y 
Sbjct: 487 NPLATPENPEILVK-TDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYD 545

Query: 443 EKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQLFSLLNHEKYVLNNNKL-- 500
            +L +L +++      +  IK D  +  E+    L+ K+F    L + ++Y+   N +  
Sbjct: 546 NRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLS-KKF----LESTQQYIEKKNAIFH 600

Query: 501 ---ALCDQLD 507
              A+ DQ D
Sbjct: 601 ETKAIQDQKD 610

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 70/141 (49%), Gaps = 8/141 (5%)

Query: 355 FNMTKHPPNINQQLSQNQKIYPPFNPQLNPIATTTNPEILIKLNDDKTIITKQTYDKLLE 414
           F + K P + + Q S   K   P NP    +AT  NPE+++K  +    ++K  YDK+  
Sbjct: 376 FALWKSPTSSSTQKS---KTAAPSNP----VATPENPELIVKTKE-HGYLSKAVYDKINY 427

Query: 415 LNQDHANWMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELND 474
             + H  W+ +   +  + Y+ K K Y+EKL  L  QI+     +  ++++T +  E++ 
Sbjct: 428 DEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSK 487

Query: 475 AILTNKRFQLFSLLNHEKYVL 495
             L  K   + +  N++K ++
Sbjct: 488 NRLVKKIIDVNAEHNNKKLMI 508

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 1/84 (1%)

Query: 383 NPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQ 442
           NP+AT   PE+++K  +    ++K  YDK+    + H  W+ +        Y+ K K Y+
Sbjct: 420 NPVATPEKPELIVKTKE-HGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYE 478

Query: 443 EKLNKLNEQINHHNLIISMIKKDT 466
           EKL  L  QI+     +  ++K+T
Sbjct: 479 EKLQDLQNQIDEVEDSMKAMRKET 502

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 111/243 (45%), Gaps = 28/243 (11%)

Query: 290 PNFLIENDSKQHRILQDIITRETNFNHLKNLQKIISQSELESQDLT------------PT 337
           P++L +N+ +Q   L  ++  E +  + K+ Q II  ++  SQ  +            P 
Sbjct: 127 PSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKQPSQSQSPSPLDDSANAEKPP 186

Query: 338 MQKIKDSKIYPKVYYKNFNMTKHPPNINQQLSQNQKIYPPFNPQLNPIATTTNPEILIKL 397
           ++K  D K+ P V ++       PP +N +  + Q +      + NP AT  + E ++K 
Sbjct: 187 LEKPIDPKLTPMVSFQ----LSTPP-VNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKT 241

Query: 398 NDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNL 457
                I++K  YD+L    Q H  ++ +   E    Y+ K + Y+ +L  L+E+I   N 
Sbjct: 242 KK-FGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVASNE 300

Query: 458 IISMIKKDTLKNKELNDAILTNKRFQLFSLLNHEKYVLNNNKLALCDQLDNTELLQRHIK 517
           +I   KKDT       DA L     +L   +  E+ V  ++K+ +  +   T+L++R   
Sbjct: 301 LIEQCKKDT-------DAKLDIMNAELVKRMFDERSVQTDDKMKIFSE---TKLIKREKI 350

Query: 518 DPK 520
           D K
Sbjct: 351 DEK 353

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 65/150 (43%), Gaps = 23/150 (15%)

Query: 327 SELES-QDLTPTMQKIKDSKIYPKVYYKN---------FNMTKHPPNINQQLSQNQKIYP 376
           SE ES +D  P      D    PKV +K          F + K P + +   +Q   +  
Sbjct: 334 SEAESVEDKAPI-----DPSKAPKVPFKERPKKERTGIFALWKSPTSSS---AQKGGVTA 385

Query: 377 PFNPQLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNT 436
           P NP    +AT  NPE+++K  +    ++K  YDK+    + H  W+ +   +    Y+ 
Sbjct: 386 PSNP----VATPENPELIVKTKE-HGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDA 440

Query: 437 KFKTYQEKLNKLNEQINHHNLIISMIKKDT 466
               Y E+L  L  QI+     +  ++K+T
Sbjct: 441 TSTGYSERLQDLQNQIDEIENSMKAMRKET 470

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 60/282 (21%), Positives = 113/282 (40%), Gaps = 63/282 (22%)

Query: 290 PNFLIENDSKQHRILQDIITRETNFNHLKNLQKIISQSELESQDLTP-----TMQKIKDS 344
           PN+L EN+ +Q   L  +  +E +  +L++ Q II  ++ +     P     T ++I D 
Sbjct: 129 PNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDLTKKQEPKKAPTPVASTTEEI-DE 187

Query: 345 KIYPKVYYKNFNMTKHPPNINQQLSQNQK------------------IYPPFNPQL---- 382
             +P   + N +   +P   +++ S  Q                   + PP +P L    
Sbjct: 188 ATFP---HSNISEEINPDYEDEEQSSAQNNEQLVLVQSEEEIHTPNVVEPPIDPALAPMV 244

Query: 383 ----------------------NPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHA 420
                                 NP+A+ TN E ++K       ++K  YDK+    Q H 
Sbjct: 245 PFSLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTA-QFGYLSKAVYDKIQYDEQQHK 303

Query: 421 NWMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNK 480
            W+ +   + +  Y  K + Y++ L  ++ Q++  N +I   + DT +  ++    L  K
Sbjct: 304 KWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKK 363

Query: 481 RFQLFSL-LNHEKYVLNNNKLALCDQL--------DNTELLQ 513
            F    + +N +  + N  K    ++L        DNTE+ Q
Sbjct: 364 VFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQ 405

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 68/152 (44%), Gaps = 6/152 (3%)

Query: 384 PIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQE 443
           P+A+  +PE ++K   DK  ++K  YD L      H   M     E+++ Y+ K + Y++
Sbjct: 348 PVASPDDPEFIVKF--DKGYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYED 405

Query: 444 KLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQLFSLLNHEKYVL----NNNK 499
            L  L  QI      +  ++ DT     ++ A L+ +  +  +  ++ K V+     N+K
Sbjct: 406 HLTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSK 465

Query: 500 LALCDQLDNTELLQRHIKDPKDSLQQKLKDND 531
            A  D+       Q  +K   + L+ +  + D
Sbjct: 466 AAKIDEKAAVVAKQDEVKAENEELEAQRAEAD 497

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 61/117 (52%), Gaps = 2/117 (1%)

Query: 377 PFNPQLN-PIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYN 435
           P   QL+ PIAT  NPE++ K  ++   ++K  YDK++    +H  W+          Y+
Sbjct: 410 PDQSQLDFPIATPENPELIAK-TEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYD 468

Query: 436 TKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQLFSLLNHEK 492
            K + Y  +L +L ++I+  N  +  +KK+T    E+++  L  K F+  +L N +K
Sbjct: 469 DKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQK 525

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 384 PIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQE 443
           P+AT  +PE++++  +    ++K  YDKL      H   +   + E    Y TK + Y+E
Sbjct: 444 PVATPEDPELIVRTQE--GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEE 501

Query: 444 KLNKLNEQINHHNLIISMIK 463
           K+  +  +I   +  +  ++
Sbjct: 502 KIQSIQAEIAELDAQMEQVR 521

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 390 NPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQEKLNKLN 449
           NPE ++K  D    +TK  YDK+   ++ H  W+     +    ++ K      K+N L 
Sbjct: 347 NPEHVVKTKD--GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLR 404

Query: 450 EQINHHNLIISMIKKDTLKNKELNDAILTNKRFQL 484
            QI      ++ ++ DT    E+++  LT K F++
Sbjct: 405 AQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEM 439

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 51/98 (52%), Gaps = 9/98 (9%)

Query: 382 LNPIATTTNPEILIKL--NDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFK 439
           +NP AT  NPE+L+K   N++  I++K  YD L+  N    N  + +    SN+      
Sbjct: 375 INPKATPKNPELLVKTRYNNNSIILSKSVYD-LVNYNIKVHNKRVKDYINDSNIK----- 428

Query: 440 TYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAIL 477
            Y+EK  + N  IN  +L I  I+KD +  K   D+++
Sbjct: 429 -YKEKNEEFNNSINELDLKIKSIEKDIIDYKAKIDSLM 465

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 31/51 (60%)

Query: 277 TTKNQLQNKEKITPNFLIENDSKQHRILQDIITRETNFNHLKNLQKIISQS 327
            T +Q + ++ + P +L+EN+ +Q  IL+D+  RE    HL+  Q ++ ++
Sbjct: 95  VTDDQRRARDIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRT 145

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 66/138 (47%), Gaps = 11/138 (7%)

Query: 315 NHLKNLQKIISQSELESQDLTPTMQKIKDSKIYPKVYYKNFNMTK-HPPNINQQLSQNQK 373
           N L + Q++  Q+E+E        +K  D    PK+Y    ++    P +    +S  Q+
Sbjct: 237 NQLVDAQQMALQNEIE-------WRKPVDPATQPKLYVDLDSLQLIDPGSTAVGVSTKQR 289

Query: 374 IYPPFNPQLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNL 433
           +     P  NP AT   PE+L+KL      ++   ++K+L  ++ H   M +   E  + 
Sbjct: 290 LMD--TPVTNPQATEDTPELLLKLP-KYGHVSAAVFNKVLYDDKVHKAEMADYQREQESK 346

Query: 434 YNTKFKTYQEKLNKLNEQ 451
           +  K + Y++KL +++++
Sbjct: 347 FAKKLQEYEQKLAQVDDR 364

>TDEL0C06420 Chr3 complement(1174443..1176716) [2274 bp, 757 aa]
           {ON} Anc_1.60 YLR182W
          Length = 757

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (65%)

Query: 434 YNTKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELND 474
           YNT+ K +QEKLNKL++++N H  +++  +      K+L D
Sbjct: 524 YNTEIKEHQEKLNKLHKELNSHRELLAASRDRLAHAKQLQD 564

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 382 LNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTY 441
           L P  T   PE+++  N  +  ++K  YD+L +  + H   ++N++ +++  Y    + Y
Sbjct: 277 LVPNGTPEEPEVVLLTN--RGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHY 334

Query: 442 QEKLNKLNEQINHHNLIISMIKKDT 466
           ++++  L+ +I+     I+ ++ +T
Sbjct: 335 EKEIADLDAEISKLRADITALQAET 359

>CAGL0J04708g Chr10 (447836..449728) [1893 bp, 630 aa] {ON} similar
           to uniprot|Q06411 Saccharomyces cerevisiae YLR424w
          Length = 630

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 14/109 (12%)

Query: 110 RVENLLTRINHSHSLTVNTSVYVYISFIPQLKQSFFFCKIIS----------VASRVPE- 158
           R+E  +T I+  +S +V++ +Y+ + +   LK    + K+I           +    PE 
Sbjct: 245 RIEAAITEIDFKNSDSVDSIIYILVEYELILKYIMMYDKLIDKFLMPRLLGLIKEWAPER 304

Query: 159 -GIIDRYHNPSFTTNQEKGSK--HKMSVLTSKERSIAYQSDQEHFDQFY 204
            GI   +++     NQE+  K    + V+ S   S  Y  D  HFD  Y
Sbjct: 305 NGIDHHFYDFYILLNQEQRKKLQDALKVIFSDYCSGWYHKDAFHFDCHY 353

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 83/187 (44%), Gaps = 38/187 (20%)

Query: 290 PNFLIENDSKQHRILQDIITRETNFNHLKNLQKIISQSELESQDLTPTMQKI--KDSKIY 347
           P  L EN+  Q   L ++ T+E N   LK+ Q ++   E +      +  KI  K   IY
Sbjct: 101 PRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDEDDISYEGDSKYKIIEKPINIY 160

Query: 348 --PKVYYKNFNMTKHPPNINQQLSQNQKIYPPFNPQLNPIATTTNPEILIKLNDDKTII- 404
             PK+   ++  TK P N  ++L              N +AT  N E +I L     ++ 
Sbjct: 161 SVPKI--PSYVFTKVPGNKKKELK-------------NSLATPQNKEQVIVLRKKDGLLY 205

Query: 405 --TKQTY-----------DKLLELN----QDHANWMINNNGESSNLYNTKFKTYQEKLNK 447
             +K+ +           DKL +LN    + HA+ +   + + SNL NTK     EK+ K
Sbjct: 206 YFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNL-NTKIDIENEKIRK 264

Query: 448 LNEQINH 454
           LN +I+H
Sbjct: 265 LNSKISH 271

>ZYRO0A03762g Chr1 complement(298936..300639) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|Q99359 Saccharomyces
           cerevisiae YDR014W RAD61 Protein of unknown function
           mutation confers radiation sensitivity
          Length = 567

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 4/41 (9%)

Query: 603 YQKKQGNLG-STTADQRHEMEVNDSELEPEPVVRTIEKNER 642
           Y K+ G+LG   + +   E+E++D E EPEP+   +E NER
Sbjct: 4   YGKRSGSLGIYASQNNSSEVELSDYESEPEPI---LESNER 41

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 25/37 (67%)

Query: 290 PNFLIENDSKQHRILQDIITRETNFNHLKNLQKIISQ 326
           P+FLI N+ +Q  I+ D+  +E N  +L+N Q ++++
Sbjct: 97  PSFLIANERRQGGIITDLELKEANLKYLRNSQILLNE 133

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,950,697
Number of extensions: 3331311
Number of successful extensions: 14187
Number of sequences better than 10.0: 531
Number of HSP's gapped: 14873
Number of HSP's successfully gapped: 606
Length of query: 681
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 565
Effective length of database: 40,180,143
Effective search space: 22701780795
Effective search space used: 22701780795
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)