Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B058503.491ON47347315050.0
NCAS0F035403.491ON4442877235e-90
Skud_16.4433.491ON4202966693e-82
Smik_16.4013.491ON4272956581e-80
TDEL0D055903.491ON3442886406e-79
YPR148C3.491ON4352946415e-78
Suva_16.4773.491ON4232836259e-76
KLLA0E04621g3.491ON3892955941e-71
KLTH0F14806g3.491ON3582945702e-68
SAKL0F02794g3.491ON3972885699e-68
Kpol_1017.73.491ON3783005512e-65
Kwal_55.212273.491ON3762945409e-64
ZYRO0D10010g3.491ON3822895392e-63
KAFR0G036803.491ON4152905263e-61
TPHA0D032703.491ON3883005043e-58
KNAG0A079303.491ON4522934926e-56
Ecym_12383.491ON3932954809e-55
TBLA0D029803.491ON4433004751e-53
CAGL0L08492g3.491ON3852914413e-49
AFR309C3.491ON3642924316e-48
KAFR0I019507.221ON3302491683e-12
KNAG0D017607.221ON3422371641e-11
NCAS0A133807.221ON3292441594e-11
ADL115W7.221ON3332451561e-10
Suva_9.1597.221ON3252491542e-10
TBLA0D042007.221ON331641523e-10
Smik_9.1507.221ON3262491506e-10
TBLA0B015807.221ON3862421508e-10
TDEL0H022407.221ON338821481e-09
YIL041W (GVP36)7.221ON3262491481e-09
KLLA0E04511g7.221ON3021121471e-09
Kpol_478.227.221ON3502411462e-09
Skud_9.1287.221ON3292491453e-09
Kwal_47.181487.221ON323701382e-08
KLTH0A03894g7.221ON323701382e-08
NDAI0A026607.221ON364561373e-08
TPHA0B027507.221ON363661364e-08
CAGL0L00891g7.221ON341661355e-08
Kpol_1070.197.221ON311691346e-08
SAKL0F08162g7.221ON330661346e-08
TPHA0C012307.221ON305691292e-07
Ecym_43777.221ON333611284e-07
ZYRO0D16522g7.221ON358851123e-05
KAFR0H017608.434ON93978697.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05850
         (473 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   584   0.0  
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   283   5e-90
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   262   3e-82
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   258   1e-80
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   251   6e-79
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   251   5e-78
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   245   9e-76
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   233   1e-71
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   224   2e-68
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   223   9e-68
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   216   2e-65
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   212   9e-64
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   212   2e-63
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   207   3e-61
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   198   3e-58
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   194   6e-56
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   189   9e-55
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   187   1e-53
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   174   3e-49
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   170   6e-48
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    69   3e-12
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    68   1e-11
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    66   4e-11
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    65   1e-10
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    64   2e-10
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    63   3e-10
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    62   6e-10
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    62   8e-10
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    62   1e-09
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    62   1e-09
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    61   1e-09
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    61   2e-09
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    60   3e-09
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    58   2e-08
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    58   2e-08
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     57   3e-08
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    57   4e-08
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    57   5e-08
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    56   6e-08
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    56   6e-08
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    54   2e-07
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    54   4e-07
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    48   3e-05
KAFR0H01760 Chr8 complement(325473..328292) [2820 bp, 939 aa] {O...    31   7.3  

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/473 (66%), Positives = 314/473 (66%)

Query: 1   MFSSFSLDKITNSIGNAAQKXXXXXXXXXXXXXDPQTKLSIKSQTRLFQEQLGTIHDISK 60
           MFSSFSLDKITNSIGNAAQK             DPQTKLSIKSQTRLFQEQLGTIHDISK
Sbjct: 1   MFSSFSLDKITNSIGNAAQKATNTLNNAINTATDPQTKLSIKSQTRLFQEQLGTIHDISK 60

Query: 61  LPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRKK 120
           LPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRKK
Sbjct: 61  LPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRKK 120

Query: 121 QISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSIQ 180
           QISV                 VEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSIQ
Sbjct: 121 QISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSIQ 180

Query: 181 ETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYKNIDQGKSE 240
           ETATKETTIK                          IQNLIKAFESWSNCYKNIDQGKSE
Sbjct: 181 ETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKNIDQGKSE 240

Query: 241 MDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIXXXXXXXXXXXXX 300
           MDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI             
Sbjct: 241 MDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIKEEEQDQKEKQAQ 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGDNVXXXXXXXXXXXXXXXXXXXXXSG 360
                                           LGDNV                     SG
Sbjct: 301 AQAQAQAQEQEQEQEQGEKAKKEQEEEQEQAQLGDNVIEESKKKEEVIKDEKKKPEIKSG 360

Query: 361 TETTSKQLXXXXXXXXXXXXXXNDTSXXXXXXXXXXXXXXXXXXXXXXXLLEQLEDEFVS 420
           TETTSKQL              NDTS                       LLEQLEDEFVS
Sbjct: 361 TETTSKQLETEAEPKAEVEAKVNDTSKDQLKKEDDAEKQDEQDDSEEHKLLEQLEDEFVS 420

Query: 421 STASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELDHA 473
           STASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELDHA
Sbjct: 421 STASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELDHA 473

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  283 bits (723), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 182/287 (63%), Gaps = 40/287 (13%)

Query: 1   MFSSFSLDKITNSIGNAAQKXXXXXXXXXXXXXDPQTKLSIKSQTRLFQEQLGTIHDISK 60
           MFS+FSLDKITNS+  AAQK             DP TKLS++SQ RLFQE +GT+HDIS 
Sbjct: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDIST 60

Query: 61  LPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRKK 120
           LP+QY +LE +TD+LEK ++RIL+VSKTFEMEGYDYPPNL+ESFSDWW+++ K    ++K
Sbjct: 61  LPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLSSKKKKEQEK 120

Query: 121 QISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSIQ 180
           +                                FLPRSFAQAIS SA DC +IYQ ++  
Sbjct: 121 E----------------------------DKKGFLPRSFAQAISNSAEDCVEIYQHVNDG 152

Query: 181 ETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYKNIDQGKSE 240
           +   KE                              ++NLIK F+SW+ CYKNIDQGK+E
Sbjct: 153 DDEDKEEN------------ANNEEENEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAE 200

Query: 241 MDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287
           MDSMM KEFN KLE L+N EFKKV+TLRK+V DSRLKFDTVR+E+K+
Sbjct: 201 MDSMMMKEFNAKLEKLLNEEFKKVHTLRKRVKDSRLKFDTVRYELKV 247

 Score =  116 bits (291), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 59/62 (95%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLEQLED FVSSTASAVEMM EIT+SS IIGL+KLFQNFQLVYYRQCVQEIEANLKTLNE
Sbjct: 382 LLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNE 441

Query: 470 LD 471
           L+
Sbjct: 442 LE 443

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  262 bits (669), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 147/296 (49%), Positives = 176/296 (59%), Gaps = 40/296 (13%)

Query: 2   FSSFSLDKITNSIGNAAQKXXXXXXXXXXXXX----DPQTKLSIKSQTRLFQEQLGTIHD 57
           FS FSL+KIT+SI  AA K                 DP+T+LSIKS+TR  QE LGT+ D
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLGTVSD 64

Query: 58  ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITK----- 112
           ISKLP QY+ LE K+DSLEK  +RILLVSKTFE+EGYDYPPNLTES SDWW++ K     
Sbjct: 65  ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKDGWFG 124

Query: 113 --KSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDC 170
             KS +  KK++S                             +FLPRSFAQAISK+A+DC
Sbjct: 125 SRKSENANKKKVSNH-------------------------DDAFLPRSFAQAISKAAVDC 159

Query: 171 TDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNC 230
              +Q L   E A     +K                          + NLIK F+SWS C
Sbjct: 160 ECEFQSLKQDEKAG----LKKKSESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTC 215

Query: 231 YKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIK 286
           YKNID+GK+EMDS M KEFN KLE LIN +FKKV+ LRKKV DSRLKFDT+R+E+K
Sbjct: 216 YKNIDEGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVK 271

 Score =  104 bits (260), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 58/63 (92%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLE+LEDEFVS+T +AVE+M EIT+SS I+GL+KLFQNFQLVY+RQCVQE+EANLK LN 
Sbjct: 358 LLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNS 417

Query: 470 LDH 472
           L++
Sbjct: 418 LEN 420

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  258 bits (658), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 150/295 (50%), Positives = 174/295 (58%), Gaps = 32/295 (10%)

Query: 2   FSSFSLDKITNSIGNAAQKXXXXXXXXXXXXX----DPQTKLSIKSQTRLFQEQLGTIHD 57
           FSSFSL+KIT+SI  AA K                 DPQT+LSIKS+TR  QE LGTI D
Sbjct: 5   FSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLGTISD 64

Query: 58  ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSH 117
           ISKLP QY+ LE K+DSLEK  KRILLVSKTFE+EGYDYPPNLTES SDWW++ K     
Sbjct: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG 124

Query: 118 RKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSS----SFLPRSFAQAISKSAMDCTDI 173
            KK                        I N    S    +FLPRSFAQAISK+A+DC   
Sbjct: 125 SKKS----------------------EITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFE 162

Query: 174 YQQLSIQETA--TKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCY 231
           +Q L   E A   K+                              + NLIK F+SWS CY
Sbjct: 163 FQNLENDEKAELKKKRESTKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCY 222

Query: 232 KNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIK 286
           KNID+GK+EMDSMM KEFN KLE LIN +FK+V+ LRKKV  SRLKFDT+R+E+K
Sbjct: 223 KNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVK 277

 Score =  101 bits (252), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 56/63 (88%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLE+LEDEFVS+T +AVE M EI +SS I+GLIKLFQNFQLVY+RQCVQE+EANLK LN 
Sbjct: 365 LLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNG 424

Query: 470 LDH 472
           L++
Sbjct: 425 LEN 427

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  251 bits (640), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 138/288 (47%), Positives = 174/288 (60%), Gaps = 50/288 (17%)

Query: 2   FSSFSLDKITNSIGNAAQKXXXXXXXXXXXXXDPQTKLSIKSQTRLFQEQLGTIHDISKL 61
            S+FSL+KIT+++ NAA K             DPQ KLS+K++TR  QE LGTI D SKL
Sbjct: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDKSKL 64

Query: 62  PDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRKKQ 121
           P QY+SLE K+D+LEK  KRILLV++TFE+EGYDYPPNLTES SDWW++ K      KK 
Sbjct: 65  PPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTKKP 124

Query: 122 ISVXXXXXXXXXXXXXXXXXVEPIENDIT--SSSFLPRSFAQAISKSAMDCTDIYQQLSI 179
                                E  +ND +  S +FLPRSF+QAISK+A DC  ++  L  
Sbjct: 125 ---------------------EKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNL-- 161

Query: 180 QETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYKNIDQGKS 239
           QE   ++                              + N+ K F+SWS CYKNID+GK 
Sbjct: 162 QEHGDEDEE-------------------------DEDVSNVAKMFDSWSKCYKNIDEGKH 196

Query: 240 EMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287
           EMDSM+ KEFN KLE +IN +FKKV+  RKKV +SRLKFDTVR+EIK+
Sbjct: 197 EMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVRYEIKL 244

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 47/54 (87%)

Query: 418 FVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELD 471
           FVS+T +AVE+M E+TES+ I+GL KLFQNFQLVY+RQCVQE+EA+LK L  L+
Sbjct: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  251 bits (641), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 148/294 (50%), Positives = 174/294 (59%), Gaps = 27/294 (9%)

Query: 2   FSSFSLDKITNSIGNAAQKXXXXXXXXXXXXX----DPQTKLSIKSQTRLFQEQLGTIHD 57
           FS FSL+KIT+SI  AA K                 DPQT+LSIKS+TR  QE LGT+ D
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLGTVSD 64

Query: 58  ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSH 117
           ISKLP QY+ LE K+DSLEK  KRILLVSKTFE+EGYDYPPNLTES SDWW++ K     
Sbjct: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG 124

Query: 118 RKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQL 177
            KK  S                             +FLPRSFAQAISK+A+DC   +Q L
Sbjct: 125 SKKSESSTKKKGSNH------------------DDAFLPRSFAQAISKAAVDCECEFQNL 166

Query: 178 ---SIQETATKETTIKXXXXXXXXXXXX--XXXXXXXXXXXXXXIQNLIKAFESWSNCYK 232
                 E   K+ +IK                            + NLIK F+SWS CYK
Sbjct: 167 EHNEKAELKKKKESIKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYK 226

Query: 233 NIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIK 286
           NID+GK+EMDSMM KEFN KLE LIN +FKKV+ LRKKV +SRLKFDT+R+E+K
Sbjct: 227 NIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVK 280

 Score =  103 bits (256), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 56/62 (90%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLE+LEDEFVS+T +AVE M EIT+SS I+GLIKLFQNFQLVY+RQCVQE+EANLK LN 
Sbjct: 373 LLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNG 432

Query: 470 LD 471
           L+
Sbjct: 433 LE 434

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  245 bits (625), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 137/283 (48%), Positives = 164/283 (57%), Gaps = 22/283 (7%)

Query: 8   DKITNSIGNAAQKXXXXXXXXXXXXX----DPQTKLSIKSQTRLFQEQLGTIHDISKLPD 63
           +KIT+SI  AA K                 DPQT+LSIKS+TR  QE LGT+ DISKLP 
Sbjct: 6   NKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLGTVSDISKLPP 65

Query: 64  QYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRKKQIS 123
           QY+ LE K+DSLEK  KRILLVSKTFE+EGYDYPPNLTES SDWW++ K      KK   
Sbjct: 66  QYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGSKKTEH 125

Query: 124 VXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSIQETA 183
                                        +FLPRSFAQAISK+A+DC   ++ L   E  
Sbjct: 126 ASKKKDSNH------------------DDTFLPRSFAQAISKAAVDCESEFKNLEQNEKE 167

Query: 184 TKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYKNIDQGKSEMDS 243
             +   +                          + NLIK F+SWS CYKNID+GK+EMDS
Sbjct: 168 DLKQKKEAKKTTQETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDS 227

Query: 244 MMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIK 286
           MM KEFN KLE LIN +FKKV+ LR+KV +SRLKFDT+R+E K
Sbjct: 228 MMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGK 270

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 44/63 (69%), Positives = 55/63 (87%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLE+LEDEFVS+T +AVE M EIT+SS I+ L+KLFQNFQLVY+RQC QE+EANLK LN 
Sbjct: 361 LLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNG 420

Query: 470 LDH 472
           +++
Sbjct: 421 MEN 423

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  233 bits (594), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 135/295 (45%), Positives = 169/295 (57%), Gaps = 27/295 (9%)

Query: 1   MFSSFSLDKITNSIGNAAQKXXXXXXXXXXXXX--DPQTKLSIKSQTRLFQEQLGTIHDI 58
           MFS  SL+ IT+SI NAAQ+               DP+T+LSI  +    QE LGT+HDI
Sbjct: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDI 60

Query: 59  SKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKS--SS 116
           S+LP QYK LE K+D+LEK  KR+LLV+KTFE+EGYDYPPNLTESF+DWW+  K S  S 
Sbjct: 61  SQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF 120

Query: 117 HRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQ 176
            +KK                     V P   +   +  LPRSFAQA+SK+A D   I +Q
Sbjct: 121 SKKK-------------------AEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQ 161

Query: 177 LSIQETATKETTIKXXXXXXXXXXXXXXXX----XXXXXXXXXXIQNLIKAFESWSNCYK 232
           L  +ET T +   +                              + NLIKAFESW+ C  
Sbjct: 162 LKAEETRTNQEESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQL 221

Query: 233 NIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287
           +IDQ K+EMDS+M KEFN KL  LI  +FKK + LR KV D+RL FDT+RHEIK+
Sbjct: 222 SIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKL 276

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 50/62 (80%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           L E+LED+FVS+T+  VE + E+T+SS II L+KLF NFQL++Y+QCV+ +E +L+ LN 
Sbjct: 324 LFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNS 383

Query: 470 LD 471
           LD
Sbjct: 384 LD 385

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  224 bits (570), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 166/294 (56%), Gaps = 52/294 (17%)

Query: 2   FSSFSLDKITNSIGNAAQKXXXXXXXXXX--XXXDPQTKLSIKSQTRLFQEQLGTIHDIS 59
           F  FSL+K+TNSI N A K               DPQ KLS+K++    QE LGTI DIS
Sbjct: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDIS 64

Query: 60  KLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKK------ 113
           KLP QY+ LE K DSLEK  +R+L+V+KT+E+EGYDYPPNL+ES SDWW+  K+      
Sbjct: 65  KLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFGFV 124

Query: 114 SSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTDI 173
           SSS ++K++                    EP E+  +  + +PRSFAQAISK+A D  ++
Sbjct: 125 SSSKKEKKL--------------------EPAED--SKEALMPRSFAQAISKAAKDSGEV 162

Query: 174 YQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYKN 233
              L  +E                                   I +LIK FE+WS C  N
Sbjct: 163 MTALKTEE----------------------QKASAEEDEEDEDITSLIKMFEAWSACQHN 200

Query: 234 IDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287
           +DQ K+EMD++M KEFN+KL   +  +FK   TLRKKV DSRLKFDT+R+E+K+
Sbjct: 201 MDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKM 254

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 52/62 (83%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLE+LEDEFVS+T  AVE M EIT+S+ II L+KLF NFQL+YY+QCVQ +E ++ +LNE
Sbjct: 293 LLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNE 352

Query: 470 LD 471
           L+
Sbjct: 353 LE 354

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  223 bits (569), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 129/288 (44%), Positives = 165/288 (57%), Gaps = 37/288 (12%)

Query: 2   FSSFSLDKITNSIGNAAQKXXXXXXXXXX--XXXDPQTKLSIKSQTRLFQEQLGTIHDIS 59
           FSSFSLDK+TNSI +AA K               DPQ KLS+K +    QE LG I DIS
Sbjct: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDIS 64

Query: 60  KLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRK 119
           KLP QY+ LE K DSLEK  +R+L+V+KTFE+EGYDYPPNL+ES SDWW       ++R 
Sbjct: 65  KLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWG------ANRS 118

Query: 120 KQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSI 179
             +S                   E  EN+     FLPRSFAQA+SK+A D  D+ + L  
Sbjct: 119 GLLSFMDGKKGEGSRAKAE----EKDENE----GFLPRSFAQALSKAAKDSGDVLRTLKD 170

Query: 180 QETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYKNIDQGKS 239
           ++    +                              I +LI  FE+WS C + IDQ K+
Sbjct: 171 EQKEPPQDE---------------------DEDEDEDINSLITMFEAWSKCEQKIDQEKA 209

Query: 240 EMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287
           EMDS+M KEFN KL+ LIN +FKKV++LRKKV +SRLKFDT+R+E+ +
Sbjct: 210 EMDSLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYELNL 257

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 42/63 (66%), Positives = 53/63 (84%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLE+LEDEFVSST  AVE+M EIT+SS I+ L+KLF  FQL+Y+RQCVQE+EA+ K L+ 
Sbjct: 334 LLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDG 393

Query: 470 LDH 472
           LD+
Sbjct: 394 LDN 396

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  216 bits (551), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/300 (44%), Positives = 163/300 (54%), Gaps = 60/300 (20%)

Query: 1   MFSSFSLDKITNSIGNAAQKXXXXXXXXXXXXX--------DPQTKLSIKSQTRLFQEQL 52
           MFS FS+DK+T+SI N A K                     DP TKLSIKS+ R  QE+L
Sbjct: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60

Query: 53  GTIHD-ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWW--- 108
           GTI+D  SKLP  Y  LELKTD++EK++KR+L V+KT+E EGYDYPPNLTES SDWW   
Sbjct: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTND 120

Query: 109 -NITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSA 167
            N+T                               E  EN  ++ SFLPRSFAQAIS ++
Sbjct: 121 DNVTNTD----------------------------ENDENIQSNKSFLPRSFAQAISNAS 152

Query: 168 MDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESW 227
            D       ++         TIK                            +L K FES 
Sbjct: 153 FDAASNVNSVT--------NTIK-----------LNHKDDEEEEEDDEEWSDLHKIFESL 193

Query: 228 SNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287
            NCY+NID GK+EMD ++  EFNNKL+DLIN EFK V+ LRK V +SRLKFDT+R+E+KI
Sbjct: 194 GNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKI 253

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 55/63 (87%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLE+LEDEFVS+T +AVE M E+T++S II L+KL+QNFQLVYY+QC+QEIE+NLK LN 
Sbjct: 316 LLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNG 375

Query: 470 LDH 472
           L+ 
Sbjct: 376 LEE 378

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  212 bits (540), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 157/294 (53%), Gaps = 52/294 (17%)

Query: 2   FSSFSLDKITNSIGNAAQKXXXXXXXXXX--XXXDPQTKLSIKSQTRLFQEQLGTIHDIS 59
           F  FS +K+T+++ NAA K               DPQ  LS+K++    QE LGTI DIS
Sbjct: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIEDIS 64

Query: 60  KLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKK------ 113
           KLP QY+ LE K DSLEK+ +R+L+V+KTFE+EGYDYPPNL+ES SDWW+  K+      
Sbjct: 65  KLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLM 124

Query: 114 SSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTDI 173
           SSS + K                               S+ +PRSFAQAI+K+A D  D+
Sbjct: 125 SSSKKDKGAESAA----------------------AAKSALMPRSFAQAIAKAAKDSGDV 162

Query: 174 YQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYKN 233
              L  QE                                   I  LIK F +WS C   
Sbjct: 163 LAALKDQE----------------------QQASADEEDEDEDITPLIKMFSAWSECQYK 200

Query: 234 IDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287
           IDQGK+EMD++M KEFN KL  LI  +FK  + LR+KV DSRLKFDT+R+E+K+
Sbjct: 201 IDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKL 254

 Score = 92.8 bits (229), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 54/62 (87%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLE+LEDEFVS+T  AVE M EIT+S+ ++ L+KLF NFQLVY+RQCVQ++EA+L TLNE
Sbjct: 311 LLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNE 370

Query: 470 LD 471
           L+
Sbjct: 371 LE 372

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  212 bits (539), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/289 (41%), Positives = 168/289 (58%), Gaps = 45/289 (15%)

Query: 2   FSSFSLDKITNSIGNAAQKXXXXXXXXXXXXX--DPQTKLSIKSQTRLFQEQLGTIHDIS 59
           FSSFS   + +SI NAA +               DPQT+LSIK++TR  +E LG + +IS
Sbjct: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEIS 64

Query: 60  KLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRK 119
           KLP QY  LE K+D+LEK+ KR+LLV++TFE+EGYDYPPNL ESFSDWW+ +K+      
Sbjct: 65  KLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGST 124

Query: 120 KQISVXXXXXXXXXXXXXXXXXVEPIENDITS-SSFLPRSFAQAISKSAMDCTDIYQQLS 178
           KQ                       I+ D +S    +PRSFAQAI+K++ +C + YQ  +
Sbjct: 125 KQDEDGESK----------------IQTDGSSKDPLMPRSFAQAIAKASHECGEAYQ--N 166

Query: 179 IQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYKNIDQGK 238
            Q++  K+                                NL++ F + S CY+NID+GK
Sbjct: 167 SQKSEKKQIDEDEDDV------------------------NLVEMFNTLSICYRNIDEGK 202

Query: 239 SEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287
            EMD  + +EFN+KLE L+N +FKK++ LR KV +SRLKFDT+R+E+++
Sbjct: 203 DEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRL 251

 Score = 95.5 bits (236), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (85%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLEQLEDEFVS+T+ AVE MT I E S I+ L+KLFQN QLVYYRQCVQE+EA+LK LN+
Sbjct: 320 LLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLND 379

Query: 470 LDH 472
           L++
Sbjct: 380 LEN 382

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  207 bits (526), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 126/290 (43%), Positives = 161/290 (55%), Gaps = 49/290 (16%)

Query: 1   MFSSFSLDKITNSIGNAAQKXXXXXXXXXXXXXDPQTKLSIKSQTRLFQEQLGTIHD--I 58
           MFS+F+ DKITNSI  AAQ              D QTKL  K   R +QE++G I D  I
Sbjct: 1   MFSNFNFDKITNSISTAAQ-SAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEI 59

Query: 59  SKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSD-WWNITKKSSSH 117
           SKLP+ Y +LE K D+LEK +KR+L+V+KT+E+EGYDYPPNL+ES +D WW+  KKS  H
Sbjct: 60  SKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWSDLKKSKKH 119

Query: 118 RKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQL 177
           ++K                               SSF+  SF  AISK+A D   I   L
Sbjct: 120 QEK-------------------------------SSFMNNSFPMAISKAAFDSKSILDDL 148

Query: 178 SIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYKNIDQG 237
             ++    +                                NL++ F S SNCYKNID+ 
Sbjct: 149 KEKQQDLPKEG--------------EEPEEEVEEEDDDEFLNLLEVFNSLSNCYKNIDKS 194

Query: 238 KSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287
           K+EMD+M+ KEFN KLE LINN+FKKV+ LR KV DSRL+FDT+RHEIK+
Sbjct: 195 KAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEIKL 244

 Score = 96.7 bits (239), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 57/62 (91%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLE+LEDEFVS+T +AVE+MTE+TE+S +I L+KLFQNFQL++Y+QCVQEIE N+K L++
Sbjct: 354 LLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQ 413

Query: 470 LD 471
           L+
Sbjct: 414 LE 415

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  198 bits (504), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 124/300 (41%), Positives = 164/300 (54%), Gaps = 53/300 (17%)

Query: 1   MFSSFSLDKITNSIGNAAQKXXXXXXXX--------XXXXXDPQTKLSIKSQTRLFQEQL 52
           MFS+FSLDK+T+SI N A K                     DP TKLSI++++R  QEQL
Sbjct: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60

Query: 53  GTIHD-ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNIT 111
           GT+ D ISKLP QY  LE+KTDS+EK +KR+LLV+ TF  EGYDYPPNLTES SDWW   
Sbjct: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWW--- 117

Query: 112 KKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSS-SFLPRSFAQAISKSAMDC 170
                                             E++ T + +FLPRSFAQA++K+  D 
Sbjct: 118 ---------------------------------AEDETTENKNFLPRSFAQALAKAYSDS 144

Query: 171 ---TDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESW 227
              TD  ++    +T+ K T  K                          +  L KAF++ 
Sbjct: 145 KLITDKAERNIKLQTSPKNTGTK----DENPEAGAEEEVEADDDEEDEDLVTLGKAFKAL 200

Query: 228 SNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287
           SN + NID GK+EMD+M+  EFN KLE L+  EFK+V  LR+ V +SRLKFDT+R+++K+
Sbjct: 201 SNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKL 260

 Score = 99.4 bits (246), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 57/62 (91%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLEQLEDEFVS+T+SAVE M E+T+S+ I+ L+KLFQNFQLVYYRQCVQEIE NLKT+++
Sbjct: 324 LLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISD 383

Query: 470 LD 471
           L+
Sbjct: 384 LE 385

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  194 bits (492), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 117/293 (39%), Positives = 158/293 (53%), Gaps = 39/293 (13%)

Query: 1   MFSSFSLDKITNSIGNAAQKXXXXXXXXXXXXXDPQTKLSIKSQTRLFQEQLGTIHD--I 58
           MFS+FSLDK+T++I NAAQ              D QTKL     TR FQE++GTI +  I
Sbjct: 1   MFSNFSLDKLTSTITNAAQ-SAQDTIHNTILSPDAQTKLQFLKTTRYFQEKVGTISEDEI 59

Query: 59  SKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHR 118
           +KLP+ Y+ L+ K++++EK +KR+L+V+KTFE+EGYDYPPN+TES + WWN       ++
Sbjct: 60  AKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWN----EDENK 115

Query: 119 KKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLS 178
           KK+                          D   SS L RSFA AI K+ +D   I   L 
Sbjct: 116 KKKT------------------------QDFGDSSILNRSFAIAIGKAVLDSQYILSDLK 151

Query: 179 IQE--------TATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNC 230
            Q+           +E   +                          + N+I AF  WSNC
Sbjct: 152 EQQKTRGTEEKKVKREEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNC 211

Query: 231 YKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRH 283
           YKNIDQ K+EMDSM+ KEFN KL D++  +FK V+ L  +V DSRL+FDT+RH
Sbjct: 212 YKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 84.3 bits (207), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 50/56 (89%)

Query: 416 DEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELD 471
           DEFVS+  +AVE MTE+T+SS +I L+KLFQN QLV+YRQCVQE+EA++K+L+EL+
Sbjct: 391 DEFVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  189 bits (480), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 153/295 (51%), Gaps = 38/295 (12%)

Query: 2   FSSFSLDKITNSIGNAAQKXXXXXXXXXXXXX---------DPQTKLSIKSQTRLFQEQL 52
           FS+FSLDKI ++I  AA K                      DPQT LS++++    QE L
Sbjct: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64

Query: 53  GTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITK 112
           GTI DISKLP +Y+ LE K D+ EK   RIL+VSKTFE++GYDYPPNL ES SDWW    
Sbjct: 65  GTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWG--- 121

Query: 113 KSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTD 172
            SSS +                        E   N+     ++P SFAQAISK+A D   
Sbjct: 122 -SSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNE----GYIPPSFAQAISKAADDSIT 176

Query: 173 IYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYK 232
           I ++L+ ++        +                          + +L+   E+W+    
Sbjct: 177 ILKELNEEQLVNPSNGAE---------------------TEDEDVDSLMPILEAWAEAQS 215

Query: 233 NIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287
           NID+ K +MD  M  EFN KL+ L+NN+F KV  LRKKV +SRLKFDT+R+E+++
Sbjct: 216 NIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEM 270

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 49/61 (80%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLE+ EDEFVS+T  AV  MT+IT+S ++  L+KLF NFQL+Y+++CVQE++A+L  +N 
Sbjct: 325 LLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINT 384

Query: 470 L 470
           L
Sbjct: 385 L 385

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  187 bits (475), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 158/300 (52%), Gaps = 51/300 (17%)

Query: 2   FSSFSLDKITNSIGNAAQKXXXXXXXXXXXXX----DPQTKLSIKSQTRLFQEQLGTIHD 57
           FS+FSLDK+ +S+ +AAQK                 DPQT+L++ S+    QE +G I++
Sbjct: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQINE 89

Query: 58  ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWW--------- 108
           ISKLP QY +LE KTD+LEK IKRIL+V+ TFE+EGYDYPPNL+ES S+WW         
Sbjct: 90  ISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPLAFLR 149

Query: 109 ---NITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISK 165
              N   K+ S+     +                          + SSFLPRSF  AISK
Sbjct: 150 DNDNTNDKNKSNSNPPDTKSKSDSD-------------------SESSFLPRSFPHAISK 190

Query: 166 SAMDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFE 225
           ++ D + I   L+  E      T                            IQ LIK F+
Sbjct: 191 ASSDSSAILTNLNNNEKLEFAKT----------------KTEDEEYEDDEDIQLLIKVFD 234

Query: 226 SWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEI 285
           SWS C KNID+ K + D ++ K+FN KL  L++ EFK V  LR KV D+RLKFDT+R+EI
Sbjct: 235 SWSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYEI 294

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 42/63 (66%), Positives = 53/63 (84%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLE LEDEFVS T++AVE M EITESS I+ LIKLFQNFQL++Y+QC++E+E N+K L +
Sbjct: 380 LLEHLEDEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTD 439

Query: 470 LDH 472
           L H
Sbjct: 440 LTH 442

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  174 bits (441), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 150/291 (51%), Gaps = 54/291 (18%)

Query: 1   MFSSFSLDKITNSIGNAAQKXXXXXXXXXXXXXDPQTKLSIKSQTRLFQEQLGTIHDISK 60
           MF  F+L+ IT SI    Q              DP+TKLSIK++TR  QE +G   DISK
Sbjct: 1   MFK-FNLESITQSISEGTQ-------SLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISK 52

Query: 61  LPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWW------NITKKS 114
           LP QY  LE K DS+EK +KRIL+V+KT+E+EGYDYPPN++ES S WW      NI++ +
Sbjct: 53  LPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELT 112

Query: 115 SSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTDIY 174
            +   K  +V                       D   S   P SFA AI+++  D   I+
Sbjct: 113 KNVIPKHGNVEKAGTEASKTL-----------TDKEVSHEGPPSFASAIARAGKDSQLIF 161

Query: 175 QQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYKNI 234
           + +  ++   KE                                 L+K F+ WS+C+  I
Sbjct: 162 ESIETKDEDEKEDI-----------------------------DELVKIFKIWSDCFYEI 192

Query: 235 DQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEI 285
              K+EMD MM KEFN KLED +   F+K++TLR KV +SRL FDT+R+E+
Sbjct: 193 SDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEV 243

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 52/63 (82%)

Query: 410 LLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNE 469
           LLEQLEDEFVS+T  AVE+MTE++E+S ++ LIKLFQ FQL Y++ CV+ +E +LK LN 
Sbjct: 323 LLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNA 382

Query: 470 LDH 472
           +D+
Sbjct: 383 IDN 385

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  170 bits (431), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 110/292 (37%), Positives = 151/292 (51%), Gaps = 45/292 (15%)

Query: 2   FSSFSLDKITNSIGNAAQKXXXXXXXXXXXXX---------DPQTKLSIKSQTRLFQEQL 52
           F + SLDK+ N++ NAAQK                      DP+T LS+K++ R  QE L
Sbjct: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64

Query: 53  GTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITK 112
           G+  DIS+LP QY  LE K D++E+  K+IL+VSKTFE+EGYDYPPN TES SDWWN + 
Sbjct: 65  GSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTST 124

Query: 113 KSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISKSAMDCTD 172
           K +   K                       E  +     SS  P SFA A+ ++A     
Sbjct: 125 KETRFLK-------------FGKGGTDKQKEDKQKQAAGSS-DPPSFAHALHRAAKGSQG 170

Query: 173 IYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFESWSNCYK 232
           I Q+L  Q    +E  ++                          +++LIK F +W++   
Sbjct: 171 IIQELKEQAEEEQEQEVE----------------------IDEDVESLIKMFGTWADAQY 208

Query: 233 NIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHE 284
           N+D  K EMD  M KEFN KL+ L+  EFKK +TLR+KV +SRL FDT+++E
Sbjct: 209 NMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYE 260

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 49/61 (80%)

Query: 411 LEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNEL 470
           LE  EDEFVS+TA AVE MT I +++ +I L+KLFQNFQLVY+R+CVQE+E +L +L  L
Sbjct: 301 LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQELEVSLNSLTSL 360

Query: 471 D 471
           +
Sbjct: 361 E 361

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 105/249 (42%), Gaps = 66/249 (26%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  RL QE+LG + DIS+LP +Y  LE K DS++   +  L V+  +E E YDYP  + 
Sbjct: 38  QSTQRLVQEKLGQVTDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIK 97

Query: 102 ESFSDW--------WNITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSS 153
           +S +D+         +++  SS+   + I +                   PI +      
Sbjct: 98  DSVNDFSKTMAAKITDLSHASSASEAQNILISPG----------------PIRD------ 135

Query: 154 FLPRSFAQAISKSAMDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXX 213
             P++   A+SK ++  +++  Q+    +   E+ +                        
Sbjct: 136 --PKTLNYALSKVSLTASEVINQVG---STPNESALSS---------------------- 168

Query: 214 XXXIQNLIKAFESWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVAD 273
                   K  E +SN    I Q + + D+++  +FN  L D ++    K N  RK+V +
Sbjct: 169 --------KLLE-FSNVQSKIAQARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQN 219

Query: 274 SRLKFDTVR 282
            RL++D  R
Sbjct: 220 KRLQYDVAR 228

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 93/237 (39%), Gaps = 48/237 (20%)

Query: 46  RLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFS 105
           RL QE+LG + DIS+LP +Y  LE + D+L+   +  L V+  +E E YDYP  + +S +
Sbjct: 42  RLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVN 101

Query: 106 DWWNITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQAISK 165
           +W     ++ + R  ++                    E            P++   A+SK
Sbjct: 102 EW----SRTVATRVSELRHVSSAAEAQHVIAAPTQETE------------PKTLHYALSK 145

Query: 166 SAMDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLIKAFE 225
            A++ + +   L    T  +ET                                L     
Sbjct: 146 VALNGSQLVDNLDAPRT-PRET-------------------------------QLSSGLL 173

Query: 226 SWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVR 282
            +S     + Q + E D+ +  +FN KL   ++ E  +    RK+V   RL++D  R
Sbjct: 174 EFSGVEAELAQARLEQDAAVKAQFNEKLRGQLSGEIARAAAARKEVFQKRLQYDVAR 230

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%)

Query: 411 LEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANL 464
           +E LEDEF   T  A  +M E+   + ++G ++     Q  Y+ +    +E  L
Sbjct: 248 METLEDEFAQCTEHATIVMQEVLSQADLLGAVRRLAAAQHAYHERSAAILEGFL 301

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 105/244 (43%), Gaps = 55/244 (22%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  R+ QE+LG + DIS+LP++Y  LE+K DS+++     L VS  +E + YDYP    
Sbjct: 38  QSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAK 97

Query: 102 ESFSDWWNITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFL---PRS 158
           ES  ++     K+++ + +++S                      +N +T+SS     P++
Sbjct: 98  ESLIEF----SKTAASKVEELS--------------HASSAHEAQNILTTSSTQIKEPKT 139

Query: 159 FAQAISKSAMDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQ 218
              A+SK A+  ++   Q +  E                                    +
Sbjct: 140 LNFALSKVALKSSEHLNQFNDNEA----------------------------------FK 165

Query: 219 NLIKAFESWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKF 278
           +   A  ++SN    I Q + + D ++ ++FN+ L   +     K   +RK+V   RL++
Sbjct: 166 SSASALLNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQY 225

Query: 279 DTVR 282
           D  R
Sbjct: 226 DIAR 229

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/245 (21%), Positives = 99/245 (40%), Gaps = 68/245 (27%)

Query: 46  RLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFS 105
           R  QE+LG + DIS++P++Y  LE + D  +      L VS+ +E E YDYP ++++S +
Sbjct: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120

Query: 106 DW--------WNITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPR 157
           D+          +TK +++   + I +                   P  N        P+
Sbjct: 121 DFSKTVTGKVQELTKATTTEEAQSILISPG----------------PARN--------PK 156

Query: 158 SFAQAISKSAMDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXI 217
           +   A+SK A+  ++   +    +  T +  +K                           
Sbjct: 157 TLNYALSKVALTSSEYLSKSGSDDVVTADILLK--------------------------- 189

Query: 218 QNLIKAFESWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLK 277
                    +S+    I Q + + D+++   FN +L + +N +F +    RK+V   RL+
Sbjct: 190 ---------YSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQ 240

Query: 278 FDTVR 282
           +D  R
Sbjct: 241 YDIAR 245

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 103/249 (41%), Gaps = 67/249 (26%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  R+ QE+LG + DIS+LP +Y  LE K D+++      L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 102 ESFSDWWN--------ITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSS 153
           ES +++ +        +T  +S+ + + I V                   PI+       
Sbjct: 93  ESVNEFSSSLASKLTELTHATSASQAQNILVAPG----------------PIKE------ 130

Query: 154 FLPRSFAQAISKSAMDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXX 213
             P++   A+SK A++ ++   ++   E                                
Sbjct: 131 --PKTLNYALSKVALNSSECLNKMFPTEE------------------------------- 157

Query: 214 XXXIQNLIKAFESWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVAD 273
               Q L  +   +S+    I Q + + D+++  +FN KL + ++ E  K +  RK+V  
Sbjct: 158 ----QPLASSLLQFSDVQAKIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHS 213

Query: 274 SRLKFDTVR 282
            RL++D  R
Sbjct: 214 MRLRYDVAR 222

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%)

Query: 44  QTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTES 103
           Q RL QE+LG I DIS++P +Y  LE + D+L+ SI+ +L V++ +E   YD+P +  ES
Sbjct: 39  QQRLAQEKLGQITDISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQES 98

Query: 104 FSDW 107
             DW
Sbjct: 99  VQDW 102

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (52%)

Query: 226 SWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVR 282
           ++S+    + Q +   D+ +  +FN +L +++NN   K N  RK V   R+ +D  R
Sbjct: 172 AYSDTQAKLAQIRIAQDTQVQTKFNKQLREILNNPIAKANKYRKDVQYKRVLYDIAR 228

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 101/249 (40%), Gaps = 67/249 (26%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  R+ QE+LG + DIS+LP +Y  LE K D+++      L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 102 ESFSDW--------WNITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSS 153
           ES +++          +T  +S+   + I V                   PI+       
Sbjct: 93  ESVNEFSRSVASKLTELTHATSASEAQNILVAPG----------------PIKE------ 130

Query: 154 FLPRSFAQAISKSAMDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXX 213
             P++   A+SK A++ ++   ++      T+E                           
Sbjct: 131 --PKTLNYALSKVALNSSECLNKM----LPTEE--------------------------- 157

Query: 214 XXXIQNLIKAFESWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVAD 273
               Q L  A   +S+    I Q + + D+++  +FN  L + ++ E  K +  RK V  
Sbjct: 158 ----QPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHS 213

Query: 274 SRLKFDTVR 282
            RL++D  R
Sbjct: 214 MRLRYDVAR 222

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 101/242 (41%), Gaps = 54/242 (22%)

Query: 48  FQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDW 107
            QE+ G + DIS LP +Y  LE + DS++      L ++  +E E YDYP ++ +S +++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 108 WNITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFL-------PRSFA 160
               +K++S R +++                   VEP+   ++S   +       PR+  
Sbjct: 61  ----QKTASSRVQELQT---KISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNSPRTLN 113

Query: 161 QAISKSAMDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNL 220
            A+SK+A+      +QL + + ++                                    
Sbjct: 114 NALSKAALFAA---EQLKMDKDSS------------------------------------ 134

Query: 221 IKAFESWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDT 280
              F S+S     I   + + D ++ K FN +L++++ N     N  RK V + RL++D 
Sbjct: 135 -TVFHSFSEAESIISDERIKQDKIIQKSFNTELKNVLTNRIDVANKHRKDVQNKRLQYDI 193

Query: 281 VR 282
            R
Sbjct: 194 SR 195

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 4/82 (4%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  RL QE+LG + DIS+LP +Y  LE K D+++   +  L V+  +E E YDYP  +T
Sbjct: 38  QSTQRLVQERLGQVTDISQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVT 97

Query: 102 ESFSDWWNITKKSSSHRKKQIS 123
           ES +D+  I     +H+ +++S
Sbjct: 98  ESVNDFSKIV----AHKVQELS 115

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%)

Query: 227 WSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVR 282
           +S+    + Q + + D+M+   FN +L+D + + FKK    RK V   RL++D  R
Sbjct: 172 YSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVAR 227

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 411 LEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIE 461
           +E LED+F  +T  A  +M E+  ++     IK   N QL Y++     IE
Sbjct: 245 METLEDQFAQATEDATIIMQEVLSNAKFTEEIKEMANAQLTYHQTSASLIE 295

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 99/249 (39%), Gaps = 67/249 (26%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  R+ QE+LG + DIS+LP +Y  LE K D+++      L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 102 ESFSDW--------WNITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSS 153
           ES +++          +T  +S+   + I V                   PI+       
Sbjct: 93  ESVNEFSRSVASKLTELTHATSASEAQNILVAPG----------------PIKE------ 130

Query: 154 FLPRSFAQAISKSAMDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXX 213
             P++   A+SK A++ ++   ++   E                                
Sbjct: 131 --PKTLNYALSKVALNSSECLNKMFPTEE------------------------------- 157

Query: 214 XXXIQNLIKAFESWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVAD 273
               Q L  A   +S+    I Q + + D+++  +FN  L + ++ E  K +  RK V  
Sbjct: 158 ----QPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHS 213

Query: 274 SRLKFDTVR 282
            RL++D  R
Sbjct: 214 MRLRYDVAR 222

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 59/112 (52%), Gaps = 5/112 (4%)

Query: 2   FSSFS--LDKITNSIGNAAQKXXXXXXXXXXXXXDPQTKLSIKSQTRLFQEQLGTIHDIS 59
           F SFS  + +++ S+   AQ+              P   L   S  R+ QE+LG + DIS
Sbjct: 5   FDSFSKKVQELSTSVSQKAQEAQLDQKFKDLKTNLP---LLANSTQRMLQEKLGQVTDIS 61

Query: 60  KLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNIT 111
           +LPD+Y  LE + ++++   +  L V+K +E E YDYP N+ ES  ++  + 
Sbjct: 62  QLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKLV 113

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 30/56 (53%)

Query: 227 WSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVR 282
           +S+    I Q + + D+M+  +FN  +++ +  + +     RK V   RL++D VR
Sbjct: 172 YSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVVR 227

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 96/241 (39%), Gaps = 59/241 (24%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  R+ +E+LG + DIS LP +Y  LELK D+ +   +  L ++  +E E YDYP   +
Sbjct: 33  QSTHRMVKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFS 92

Query: 102 ESFSDWWNITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSSFLPRSFAQ 161
           ES +++ +            +S                           SS   PR+   
Sbjct: 93  ESVNEFTDSIGNKMYEFSNGVSTE------------------------GSSGKTPRTLNY 128

Query: 162 AISKSAMDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXXXXXIQNLI 221
           A+SK +M  ++ +Q+L   +T  K                               I NL+
Sbjct: 129 AVSKVSMGASEQFQKL--HDTDDKR------------------------------IANLL 156

Query: 222 KAFESWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTV 281
               +  N   +I + +   D  +  +FN +L + I    ++ +  RK+V   RLK+D  
Sbjct: 157 T---NVGNAEASIAEARLLQDHSIQAKFNFQLREEIAQSIERASKYRKEVYHKRLKYDIA 213

Query: 282 R 282
           R
Sbjct: 214 R 214

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 98/249 (39%), Gaps = 67/249 (26%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  R+ QE+LG + DIS+LP +Y  LE K D+++      L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 102 ESF--------SDWWNITKKSSSHRKKQISVXXXXXXXXXXXXXXXXXVEPIENDITSSS 153
           ES         S    +T  +S+   + I V                   PI+       
Sbjct: 93  ESVNEFSRSVASKLTELTHATSASEAQNILVAPG----------------PIKE------ 130

Query: 154 FLPRSFAQAISKSAMDCTDIYQQLSIQETATKETTIKXXXXXXXXXXXXXXXXXXXXXXX 213
             P++   A+SK +++ ++   ++   E                                
Sbjct: 131 --PKTLNYALSKVSLNSSECLNKMFPAEE------------------------------- 157

Query: 214 XXXIQNLIKAFESWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVAD 273
               Q L  A   +S+    I Q + + D+++  +FN KL + ++ E  K +  RK V  
Sbjct: 158 ----QPLASALLQFSDVQAKIAQTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDVHS 213

Query: 274 SRLKFDTVR 282
            RL++D  R
Sbjct: 214 MRLRYDVAR 222

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  RL QE+LG + DIS+LP  Y  LE K D ++   +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVR 116

Query: 102 ESFSDWWNIT 111
           +S +++ +I 
Sbjct: 117 DSVNEFSSIV 126

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 411 LEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQ 458
           +E LEDEF  +T  AV +M ++ ESS ++  ++     Q  YY+Q  +
Sbjct: 264 MESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAE 311

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 44/70 (62%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  RL QE+LG + DIS+LP +Y  LE K D +    +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVR 116

Query: 102 ESFSDWWNIT 111
           +S +++ ++ 
Sbjct: 117 DSVNEFSSVV 126

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%)

Query: 411 LEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQC 456
           +E LEDEF  +T  AV +M ++  SS ++  ++     Q  Y++Q 
Sbjct: 264 MESLEDEFAQATDDAVVVMQKVAGSSELLKELRELVAAQADYHKQS 309

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON}
          Anc_7.221
          Length = 364

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%)

Query: 42 KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYP 97
          +S  R+ QE+LG + DIS+LP++Y  LE K D+++      L V+ TFE + YDYP
Sbjct: 41 QSTQRMVQERLGQVTDISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYP 96

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 33/56 (58%)

Query: 227 WSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVR 282
           +S+    I Q + + D ++ ++FNN L + +N  F++   +RK V + RL++D  R
Sbjct: 184 FSDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYDVAR 239

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 411 LEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYR 454
           +E LED+F  +T  A  +M EI E+S+ +  +      QL YY+
Sbjct: 257 MELLEDQFAQATEHATLVMNEIIENSNFMEYLNELARAQLAYYQ 300

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 46  RLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFS 105
           RL +E+LG   DIS LP +Y  LE K D++++  +  L V+  +E E YDYP    ESF 
Sbjct: 37  RLMKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESF- 95

Query: 106 DWWNIT 111
             W  T
Sbjct: 96  --WEFT 99

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  R+ QE+LG + DIS+LP +Y  LE K D+++   +  L V+  +E E YDYP  ++
Sbjct: 38  QSTQRMVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVS 97

Query: 102 ESFSDW 107
           ES +++
Sbjct: 98  ESVNEF 103

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 411 LEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQ 458
           +E LED+F  +T  A  +M E+  S++ +  +K     QL YY Q  +
Sbjct: 246 METLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAK 293

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 44/69 (63%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  RL QE+LG + DIS+LP +Y  LE + D+++   +  L ++  +E E YDYP  ++
Sbjct: 37  ESTQRLVQEKLGNVTDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVS 96

Query: 102 ESFSDWWNI 110
           +S +D+  +
Sbjct: 97  DSVNDFSKV 105

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 42  KSQTRLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLT 101
           +S  RL QE+LG + DIS+LP +Y  LE + D +    +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVR 116

Query: 102 ESFSDW 107
           +S +++
Sbjct: 117 DSVNEF 122

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 33/60 (55%)

Query: 223 AFESWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVR 282
           A   +S+    I Q + + D+++  +FN KL + + ++  K    RK+V + RL++D  R
Sbjct: 186 ALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIAR 245

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 411 LEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYR 454
           +E LEDEF  +T  A  +M ++  SS  +  +    + QL YY+
Sbjct: 263 MESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQLAYYK 306

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 40  SIKSQT-RLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPP 98
           SI S T RL QE+LG + DIS+LP +Y  LE + D+++   +  L ++  ++ E YDYP 
Sbjct: 34  SIASSTQRLVQEKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPK 93

Query: 99  NLTESFSDW 107
            +++S +D+
Sbjct: 94  YVSDSVNDY 102

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 41/61 (67%)

Query: 46  RLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFS 105
           R+ QE+LG I DIS++P++Y  +E + D +    +  L V++ +E E YDYP +++ES +
Sbjct: 61  RMVQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESVN 120

Query: 106 D 106
           +
Sbjct: 121 E 121

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%)

Query: 227 WSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVR 282
           +S+    I Q + + D ++   FN +L++ +NNEF      RK+V + RL++D  R
Sbjct: 190 YSDIQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIAR 245

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 8/85 (9%)

Query: 46  RLFQEQLGTIHDISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFS 105
           R  QE+LG   DIS++P +Y  L  K D+++      L V++ ++ E YDYP  + ES +
Sbjct: 37  RYMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESIN 96

Query: 106 DW--------WNITKKSSSHRKKQI 122
           ++          ++  SS+H    I
Sbjct: 97  EFSRTVGSKIQELSHASSAHEAHSI 121

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%)

Query: 227 WSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVR 282
           +S+    + Q +   DS++   FN KL + I+   K+ + +R+ V + RL +D  R
Sbjct: 167 YSDIQSRVAQARLHQDSLVQTHFNAKLREEIDGNLKRAHRVRRDVENKRLTYDASR 222

>KAFR0H01760 Chr8 complement(325473..328292) [2820 bp, 939 aa] {ON}
           Anc_8.434 YLR223C
          Length = 939

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 8/78 (10%)

Query: 55  IHDISKLPDQYKSLEL-KTDSLEK------SIKRILLVSKTFEMEGYDYPPNLTESFSDW 107
           IH+  +L ++ +S EL +  S E+      ++  +L +S+  E EG D P + T S SDW
Sbjct: 613 IHEHQQLQERSQSPELAEPPSTEQQSGEDMTLNELLNMSELEEGEGEDTPSHQTLSVSDW 672

Query: 108 WNITKKS-SSHRKKQISV 124
           +N  K   S+ R K +S+
Sbjct: 673 YNKPKVPLSAFRNKGVSI 690

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.126    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,585,586
Number of extensions: 1002318
Number of successful extensions: 4025
Number of sequences better than 10.0: 48
Number of HSP's gapped: 4073
Number of HSP's successfully gapped: 110
Length of query: 473
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 360
Effective length of database: 40,524,141
Effective search space: 14588690760
Effective search space used: 14588690760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)