Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B05840singletonON2322328051e-109
NDAI0B05910singletonON36089790.13
Suva_4.727.281ON34380648.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05840
         (232 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05840 Chr2 (1417114..1417812) [699 bp, 232 aa] {ON}             314   e-109
NDAI0B05910 Chr2 (1427727..1428809) [1083 bp, 360 aa] {ON}             35   0.13 
Suva_4.72 Chr4 complement(131713..132744) [1032 bp, 343 aa] {ON}...    29   8.1  

>NDAI0B05840 Chr2 (1417114..1417812) [699 bp, 232 aa] {ON} 
          Length = 232

 Score =  314 bits (805), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 184/232 (79%), Positives = 184/232 (79%)

Query: 1   MSFKISNTQCQCSDDNSCGCCPNTVSSSGCRCSSKVQCQCSHEDSTKAKDCDCSLCTCAT 60
           MSFKISNTQCQCSDDNSCGCCPNTVSSSGCRCSSKVQCQCSHEDSTKAKDCDCSLCTCAT
Sbjct: 1   MSFKISNTQCQCSDDNSCGCCPNTVSSSGCRCSSKVQCQCSHEDSTKAKDCDCSLCTCAT 60

Query: 61  NVQCQCPDSTSCNCCTKTASSGGCKCIANIQCRCGHHDSTXXXXXXXXXXXXTVNIXXXX 120
           NVQCQCPDSTSCNCCTKTASSGGCKCIANIQCRCGHHDST            TVNI    
Sbjct: 61  NVQCQCPDSTSCNCCTKTASSGGCKCIANIQCRCGHHDSTKGKKCKCKECKCTVNIQCQC 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTSCNCCNKSISSGDCKCNINVQCQCSH 180
                                           DTSCNCCNKSISSGDCKCNINVQCQCSH
Sbjct: 121 PDCKSSSCCCCDKTSSSGGCNCSSSVQCQCQGDTSCNCCNKSISSGDCKCNINVQCQCSH 180

Query: 181 QTSTTPKNCECGPCKCTANVQGQCPDDNSCNCCDKPVSSDHCRCSSNVHCQC 232
           QTSTTPKNCECGPCKCTANVQGQCPDDNSCNCCDKPVSSDHCRCSSNVHCQC
Sbjct: 181 QTSTTPKNCECGPCKCTANVQGQCPDDNSCNCCDKPVSSDHCRCSSNVHCQC 232

>NDAI0B05910 Chr2 (1427727..1428809) [1083 bp, 360 aa] {ON} 
          Length = 360

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 47/89 (52%), Gaps = 21/89 (23%)

Query: 29  GCRCSSK--VQCQCSHED----------STKAKDCDCSLCTCATNVQCQCPDS--TSCNC 74
           GCRCS+     CQCS ++          S K  DC CS CTC   +QCQCP++  +SC C
Sbjct: 255 GCRCSNTNDSSCQCSTKNNDRKCTDCKCSAKTNDCQCSPCTCKVTMQCQCPNAQQSSCKC 314

Query: 75  CTKTA--SSGGCK-----CIANIQCRCGH 96
            TKT   + G CK     C A+ +C+C  
Sbjct: 315 STKTKDCTCGECKCSSCTCTASAECQCSK 343

>Suva_4.72 Chr4 complement(131713..132744) [1032 bp, 343 aa] {ON}
           YDL175C (REAL)
          Length = 343

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 29/80 (36%), Gaps = 4/80 (5%)

Query: 8   TQCQCSDDNSCGCCPNTVSSSGCRCSSKVQCQCSHEDSTKAKDCDCSLCTCATNVQCQCP 67
           T C   DD+    CP  +  S C      + QC H    K K   CSLC    +++ +CP
Sbjct: 82  TYCGSMDDHYSQHCPKAIKCSQCDEVGHYRSQCPH----KWKKVQCSLCKSKKHLKERCP 137

Query: 68  DSTSCNCCTKTASSGGCKCI 87
                         G  K +
Sbjct: 138 SIWRAYILIDDNQMGKPKVL 157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.127    0.471 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,789,513
Number of extensions: 590262
Number of successful extensions: 2187
Number of sequences better than 10.0: 64
Number of HSP's gapped: 1859
Number of HSP's successfully gapped: 240
Length of query: 232
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 126
Effective length of database: 41,326,803
Effective search space: 5207177178
Effective search space used: 5207177178
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)