Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B058303.488ON32932917560.0
NCAS0F035303.488ON3133347021e-90
TDEL0D055603.488ON3113316646e-85
TBLA0C044503.488ON3093346621e-84
Skud_16.4423.488ON3043336375e-81
YPR147C3.488ON3043336314e-80
Kpol_480.173.488ON3133336107e-77
Smik_16.4003.488ON3043336053e-76
ZYRO0D10076g3.488ON3053316002e-75
Suva_16.4763.488ON3043305976e-75
TPHA0D042203.488ON3163365961e-74
CAGL0L08514g3.488ON3123345751e-71
Kwal_55.212193.488ON3023185384e-66
SAKL0F02860g3.488ON3053325375e-66
KLTH0F14740g3.488ON3023244959e-60
Ecym_12413.488ON3053094393e-51
AFR306C3.488ON3193094369e-51
NCAS0B022608.524ON363176721.6
KLTH0H10252g1.339ON49364694.3
Ecym_70938.598ON654167676.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05830
         (329 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   681   0.0  
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   275   1e-90
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   260   6e-85
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   259   1e-84
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   249   5e-81
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   247   4e-80
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   239   7e-77
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   237   3e-76
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   235   2e-75
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   234   6e-75
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   234   1e-74
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   226   1e-71
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   211   4e-66
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   211   5e-66
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   195   9e-60
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   173   3e-51
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   172   9e-51
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    32   1.6  
KLTH0H10252g Chr8 (880852..882333) [1482 bp, 493 aa] {ON} simila...    31   4.3  
Ecym_7093 Chr7 (178741..180524,180627..180807) [1965 bp, 654 aa]...    30   6.7  

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/329 (100%), Positives = 329/329 (100%)

Query: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60
           MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH
Sbjct: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60

Query: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120
           WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI
Sbjct: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120

Query: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180
           MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH
Sbjct: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180

Query: 181 GYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSL 240
           GYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSL
Sbjct: 181 GYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSL 240

Query: 241 GLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNYKD 300
           GLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNYKD
Sbjct: 241 GLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNYKD 300

Query: 301 ISRLQIEVSSEFPHSFVVNHSDWVVERFF 329
           ISRLQIEVSSEFPHSFVVNHSDWVVERFF
Sbjct: 301 ISRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  275 bits (702), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 150/334 (44%), Positives = 207/334 (61%), Gaps = 26/334 (7%)

Query: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60
           M V++Y + ++PT ++HI   K  E    +NP+F+WIPGNPGIL+YYQ+ L +LH+KHP 
Sbjct: 1   MSVEAYDDDEFPTCVVHILPIKTAE----INPVFVWIPGNPGILEYYQEMLINLHEKHPT 56

Query: 61  WEILAIPHAGMDT---SLPVYRH-PNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKR 116
           WEILAI H GM+T   SL    H  N R++ L EQI+HKI++I  F+  +N         
Sbjct: 57  WEILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNV-------- 108

Query: 117 PLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGL 176
           P+ I GHSVG YM+Q++V + E    +L       K+G ITPTIIDI+LS KG  ++   
Sbjct: 109 PIYISGHSVGAYMVQKIVASDELIGQVL-------KMGLITPTIIDIHLSEKGKSMTRYA 161

Query: 177 QLTHGYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLV 236
           + +   LP+ILS+L Y VF  ++     +R  +I Y+MGC     AAI TE+ LT    V
Sbjct: 162 RWSCRQLPHILSFLCYIVFGWLVPGI--LRSYIIGYVMGCHHDSQAAISTELFLTGPNFV 219

Query: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296
           +QSLGLA  EM  I  +W  Q + +E C  N I++  LF  TDHWV   TR ++I+FYQ 
Sbjct: 220 RQSLGLAQEEMDTIHDDWQFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQE 279

Query: 297 NYKDI-SRLQIEVSSEFPHSFVVNHSDWVVERFF 329
             K   + L+I+VS +FPHSFVV  S +VVE +F
Sbjct: 280 RCKGAKALLKIDVSDQFPHSFVVRRSKYVVEHYF 313

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  260 bits (664), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 131/331 (39%), Positives = 202/331 (61%), Gaps = 25/331 (7%)

Query: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60
           M  + Y +  YPTSI+H ++  +     S  PLF+WIPGNPG+++YY++FL  +H++HP 
Sbjct: 1   MAAREYIKCAYPTSIVHFKSISI--RGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPE 58

Query: 61  WEILAIPHAGMDTSLPVYRHPNDR--IYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPL 118
           WE+L I HAGM T+       ++R  +Y L +QI+HK+E+I  F +           RPL
Sbjct: 59  WEVLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSST---------NRPL 109

Query: 119 VIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQL 178
           +IMGHSVG YM+Q +VL+ +    +        K+G +TPTI+DI+ S KG++++  L  
Sbjct: 110 IIMGHSVGAYMVQHIVLSDKLVGKV-------AKMGLLTPTILDIHTSKKGVVLTKVLYW 162

Query: 179 THGYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQ 238
               LP +  + S  +F   L  F  I R L+++ MGC       + T +LL N   VKQ
Sbjct: 163 LKD-LPQLAGWFSSLLFGFFLPSF--ILRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQ 219

Query: 239 SLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNY 298
           +LGL+  EM+EIR +W  Q++ + +CN   I  WLLF ++DHWV + TR DLIKFY+ +Y
Sbjct: 220 ALGLSVYEMEEIRSDWAFQRRLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHY 279

Query: 299 KDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329
           +   +++I  + + PHSFV+NHS +++  +F
Sbjct: 280 R-ADKIKIH-TCKIPHSFVLNHSKYLISEYF 308

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  259 bits (662), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 199/334 (59%), Gaps = 30/334 (8%)

Query: 1   MLVKSYSESKYPTSIIHIEAEK--LIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKH 58
           M ++ Y +S+YPTSI+H    K   I  D    PLFIWIPGNPG+L+YY + L SLH K+
Sbjct: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITED---TPLFIWIPGNPGLLEYYTKMLRSLHDKY 57

Query: 59  PHWEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPL 118
           P WEIL + HAGM     +    + ++Y L+EQ+ HK+EVI  F +          KR +
Sbjct: 58  PTWEILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSS---------PKRNI 108

Query: 119 VIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQL 178
           +IMGHSVG YM QR+++       ++       K+G +TPT++DI+ S KGI ++    L
Sbjct: 109 IIMGHSVGAYMAQRVIMDSNLIGNVI-------KLGLVTPTVVDIHRSVKGIKMTRAFNL 161

Query: 179 THGYLPYILSYLSYFVFSLILKYFDNI-RRRLIAYIMGCQMTD-FAAIGTEILLTNSVLV 236
               LP  L  LS   FS   K F  I  R L+  IMGC+  D  AA  + + LTN   V
Sbjct: 162 FRE-LPIFLGLLSTLAFS---KLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFV 217

Query: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296
           KQ LGLAS EM+ IR +W+ QK+ ++ CN  ++  W LF  TDHWV++ TR +LI FY++
Sbjct: 218 KQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRT 277

Query: 297 NYK-DISRLQIEVSSEFPHSFVVNHSDWVVERFF 329
           N K DI  L + VS+  PHSFV+N SD+ V  +F
Sbjct: 278 NCKSDI--LDVSVSNIIPHSFVINFSDFTVNSYF 309

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  249 bits (637), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 137/333 (41%), Positives = 201/333 (60%), Gaps = 33/333 (9%)

Query: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60
           M V+ Y++S  P SI++I+     EN+ +  PL +WIPGNPG+L YYQ+ L  LH KHP 
Sbjct: 1   MPVQEYTKSTLPCSILNIKPSVATENEDA--PLLVWIPGNPGLLYYYQEMLQHLHSKHPD 58

Query: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120
           WEIL + HAGM  +     H N  I+ L +Q++H++EVI  F           + R ++I
Sbjct: 59  WEILGVSHAGMTLN----AHSNTPIFSLQDQVDHQVEVINNFS---------HENRKIII 105

Query: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180
           MGHSVG Y++Q++ L+ +   ++       +KIG ITPT++DI+ S  G+ ++  L    
Sbjct: 106 MGHSVGAYILQKVCLSDKLVGSV-------RKIGLITPTVMDIHTSEMGVKMTAVLH--- 155

Query: 181 GYLP---YILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAI-GTEILLTNSVLV 236
            Y+P   +++S LSY  F  IL   + + R +I   MGC  T + A+  T ILLT+   V
Sbjct: 156 -YIPPLAHVVSLLSYVFFYWILS--EGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFV 212

Query: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296
           +QSLGLAS EM+EI  NW+ Q +F+  C  N+I +W LF   DHWV + TRT L  +Y+ 
Sbjct: 213 RQSLGLASQEMKEITTNWEFQDEFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKD 272

Query: 297 NYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329
             K   RL+I+V+ + PHSFVV H+++ V  FF
Sbjct: 273 KIKQ-ERLKIDVTDKIPHSFVVKHAEYAVNTFF 304

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  247 bits (631), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 133/333 (39%), Positives = 197/333 (59%), Gaps = 33/333 (9%)

Query: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60
           M VK Y++SK P SI++I+       + +  PL +WIPGNPG+L YYQ+ L  LH KHP 
Sbjct: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDA--PLLVWIPGNPGLLYYYQEMLHHLHLKHPD 58

Query: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120
           WEIL I HAGM  +     H N  I+ L +Q++H++EVI  F  K          R ++I
Sbjct: 59  WEILGISHAGMTLN----AHSNTPIFSLQDQVDHQVEVINNFSCK---------NRKIII 105

Query: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180
           MGHSVG Y++Q++ L+ +   ++       +K+G +TPT++DI+ S  GI ++  L+   
Sbjct: 106 MGHSVGAYIVQKVCLSNKLVGSV-------QKVGLVTPTVMDIHTSEMGIKMTAALR--- 155

Query: 181 GYLP---YILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAI-GTEILLTNSVLV 236
            Y+P   +++S  SY  F  IL   +   R +I   MGC  T + A+  T I LT+   V
Sbjct: 156 -YIPPLAHVVSLFSYIFFYWILS--EGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFV 212

Query: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296
           +QSLGLA+ EM+EI  NW+ Q +F+  C  N I +W LF   DHWV+  TR+ L  +Y+ 
Sbjct: 213 RQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKD 272

Query: 297 NYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329
             K   RL+I+V+ + PHSFVV H+++ +  FF
Sbjct: 273 KVKQ-ERLKIDVTDKIPHSFVVKHAEYAINAFF 304

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  239 bits (610), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 125/333 (37%), Positives = 202/333 (60%), Gaps = 27/333 (8%)

Query: 2   LVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPHW 61
           LVK + +S YPTSI+H++     E  P  +PLF+WIPGNPG+L+YY  FL  +HKK+P W
Sbjct: 3   LVKVFEDSIYPTSIVHLDPLTK-ELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTW 61

Query: 62  EILAIPHAGMD---TSLPVYRHPNDR--IYHLNEQIEHKIEVITTFLTKANSSDGIMKKR 116
           E+L I HAGM             ND+  ++ L EQ++HK+++I  F +K          R
Sbjct: 62  EVLGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSK---------NR 112

Query: 117 PLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGL 176
           PL+IMGHSVG Y+ QR+++T +    ++       K+G++TPT++DI+LS KGI ++   
Sbjct: 113 PLIIMGHSVGAYLTQRVIMTNKLNGKLI-------KVGYLTPTVVDIHLSDKGIKMTKVF 165

Query: 177 QLTHGYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLV 236
             T   LP+ + ++S F+F  +L  F    +  I+ ++ C     A + +  LL N+ L+
Sbjct: 166 NWTSN-LPHHVGWISQFIFHKLLPLF--FVKFFISKMIKCSEDSNAVLASGTLLRNANLI 222

Query: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296
           +Q+LGLA+ EM+ I  +W   K+ ++ CN   ++ W LF E DHWV + TR ++I FYQ 
Sbjct: 223 EQALGLATYEMEAIHDDWGFHKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQY 282

Query: 297 NYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329
           + K    ++I++ +  PH+FV+  S ++V+++F
Sbjct: 283 HNKP-ENIRIDIDT-IPHAFVIKKSKYIVDQYF 313

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  237 bits (605), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 130/333 (39%), Positives = 192/333 (57%), Gaps = 33/333 (9%)

Query: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60
           M ++ Y++SK+P SI++I+    I        L +WIPGNPG+L YYQ+ L  LH KHP 
Sbjct: 1   MPIQEYTKSKFPCSILNIKPT--ITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPD 58

Query: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120
           WEIL I HAGM  +     H N  +Y L +Q++H++EVI  F           + R ++I
Sbjct: 59  WEILGISHAGMTLN----AHSNTPVYSLQDQVDHQVEVINNFS---------HENRKIII 105

Query: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180
           MGHSVG Y++Q++ L+     T+       +K+G +TPT++DI+ S  G+ ++  L    
Sbjct: 106 MGHSVGAYILQKVCLSHNLVGTV-------QKVGLVTPTVMDIHTSEMGVKLTTALH--- 155

Query: 181 GYLP---YILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAI-GTEILLTNSVLV 236
            Y+P   +++S  SY  F  IL   +   R +I   MGC  T   A+  T I LT+   V
Sbjct: 156 -YIPPLAHVVSLFSYIFFYWILS--EGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFV 212

Query: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296
           +QSLGLAS EM+EI  NW+ Q +F+  C  N   +W LF   DHWV+  TR+ L  +Y+ 
Sbjct: 213 RQSLGLASQEMEEITTNWEFQDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKD 272

Query: 297 NYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329
              D +RL+I+V+ + PHSFVV H+ + +  FF
Sbjct: 273 KV-DQNRLEIDVTDKIPHSFVVKHAKYAINTFF 304

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  235 bits (600), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 126/331 (38%), Positives = 200/331 (60%), Gaps = 28/331 (8%)

Query: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60
           M ++  + ++ PTS++HI+ +         +PLF+WIPGNPGI+QYY++FL  LH+K+  
Sbjct: 1   MSIRYLAGARLPTSVLHIKPKSPS----PSSPLFVWIPGNPGIVQYYEEFLNLLHEKYDS 56

Query: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120
           +EILAI HAGM T  P  +     IY L++QI+HK+E+I  F           K RPL++
Sbjct: 57  FEILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSA---------KDRPLIV 107

Query: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180
           MGHSVG YM Q +VL ++    ++       K+G ITPT++DI+ S KG  ++       
Sbjct: 108 MGHSVGAYMAQHVVLAEKLLGRVV-------KLGLITPTVVDIHRSQKGTQLTRAFYWVK 160

Query: 181 GYLPYILSYLSYFVFSLI--LKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQ 238
            YLP I +++S  +F+ +  + + D +    I+  MG          ++ L+ N  +++Q
Sbjct: 161 -YLPDIAAWVSDMLFNKLSSIMFTDQV----ISLFMGVDKESVPVATSKSLVQNPEIIRQ 215

Query: 239 SLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNY 298
           +LGLA++EMQ+IR  W  QK+ +++CN N+I+   +F   D WV+N TR  L+ FY+ NY
Sbjct: 216 ALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENY 275

Query: 299 KDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329
           +D   L+I VS +  HSF+V HS ++V+ +F
Sbjct: 276 RD-RNLEISVSQDLAHSFIVKHSKYIVDEYF 305

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  234 bits (597), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 125/330 (37%), Positives = 193/330 (58%), Gaps = 27/330 (8%)

Query: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60
           M ++ Y++SK P SI++I+     +N+ +  PL +WIPGNPG+L YYQ+ +  LH KHP 
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDA--PLLVWIPGNPGLLHYYQEMIHHLHLKHPD 58

Query: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120
           WEIL I HAGM ++       N  I+ L +Q++H+++VI  F     S D     R ++I
Sbjct: 59  WEILGISHAGMSSN----ARSNTPIFSLQDQVDHQVKVINNF-----SHDN----RKIII 105

Query: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180
           MGHSVG Y++Q++ L+ E   ++        K+G ITPT++DI+ S  G+ ++       
Sbjct: 106 MGHSVGAYIVQKVCLSNELVGSV-------TKVGLITPTVMDIHASEMGVKMTTAFHYVP 158

Query: 181 GYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAI-GTEILLTNSVLVKQS 239
             L ++LS++SY  F  +L   + + + +I   MGC      A+  T + LT+   V+QS
Sbjct: 159 A-LAHVLSFISYVFFYWVLS--EGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQS 215

Query: 240 LGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNYK 299
           LGLAS E++EI  NW+ Q +F+ +C    I  W LF   DHWVN+ TR  L  +Y    K
Sbjct: 216 LGLASQELKEITTNWEFQDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVK 275

Query: 300 DISRLQIEVSSEFPHSFVVNHSDWVVERFF 329
               L+I+V+ + PHSFVV H+++ +  FF
Sbjct: 276 Q-EHLRIDVTDKMPHSFVVKHAEYAINAFF 304

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  234 bits (596), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 131/336 (38%), Positives = 199/336 (59%), Gaps = 27/336 (8%)

Query: 1   MLVKSYSESKYPTSIIHIE----AEKL---IENDPSLNPLFIWIPGNPGILQYYQQFLCS 53
           M +  + +SK+PTSI+ I+    A++L   +     L+PLF+WIPGNPG+L+YY++FL  
Sbjct: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKL 60

Query: 54  LHKKHPHWEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIM 113
           LH K+P W+IL I HAGM +     +     +Y L+EQI HKIE+I  F           
Sbjct: 61  LHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYG------- 113

Query: 114 KKRPLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILIS 173
             R L++MGHSVG +M Q++V++ + +  +       KKIG + PT+IDI+LS KG  IS
Sbjct: 114 --RELIVMGHSVGAFMAQKVVMSNKLEGKV-------KKIGLLMPTVIDIHLSEKGTQIS 164

Query: 174 HGLQLTHGYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNS 233
             L      LP +  ++S  +F   L     + + +I++ M     + AA  T   L +S
Sbjct: 165 TILNWIPN-LPQLAGWVSEKIFGGFLPI--TLVKFIISFFMELNNENKAAHATYTFLKDS 221

Query: 234 VLVKQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKF 293
             V+QSLGLA  EMQ IR +W+ Q++ V+ CN N I+LW LF E+DHWV+N TR++LI+ 
Sbjct: 222 NFVEQSLGLAKYEMQIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIEL 281

Query: 294 YQSNYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329
           Y+ N  +       ++ + PH+FV+ +S  VV+ +F
Sbjct: 282 YR-NSVNSDYYSYSITDQVPHAFVIKNSCHVVDNYF 316

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  226 bits (575), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 133/334 (39%), Positives = 191/334 (57%), Gaps = 27/334 (8%)

Query: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60
           M V+ Y +S  PT IIHI+    + N+   +PLF+WIPGNPG+L+YYQ+FL  +H K+P 
Sbjct: 1   MSVQGYHDSALPTCIIHIKPT--VTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPT 58

Query: 61  WEILAIPHAGM---DTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRP 117
           WEIL I HAG     + L  +R     IY L +Q +HKI++I       N        R 
Sbjct: 59  WEILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPN--------RE 110

Query: 118 LVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQ 177
           LVIMGHSVG Y+ Q +V + +    +        K+G ITPTI DI+ SS G++ +    
Sbjct: 111 LVIMGHSVGAYIAQHVVSSPDLVGRV-------SKLGLITPTIRDIHKSSHGLIFTRVFN 163

Query: 178 LTHGYLPYILSYLSYFVFS-LILKYFDNIRRRLIAYIMGCQMTDFAAI-GTEILLTNSVL 235
                  Y LS++S  +F+ LI  Y+  +   LI++ MGC   ++  I GT +LLT    
Sbjct: 164 YISNVNEY-LSFISSNIFNKLIPAYWTKL---LISFAMGCSFDEYHIILGTFLLLTQRET 219

Query: 236 VKQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQ 295
           ++Q LGLA+ EM EIR +W  Q+  +  C  N  +LWLLF + DHWV+  T+ +LIKF +
Sbjct: 220 LRQVLGLAAHEMLEIRDDWAFQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLK 279

Query: 296 SNYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329
             Y ++  L+++V  +  HSFVV   D V  R+F
Sbjct: 280 DRYPEL-LLRVDVDKDIKHSFVVKDVDLVTRRYF 312

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  211 bits (538), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 115/318 (36%), Positives = 192/318 (60%), Gaps = 27/318 (8%)

Query: 12  PTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPHWEILAIPHAGM 71
           P S+ H  A   + +     PLF++IPGNPG++++Y+ FL  +H+K+P WEIL I HAGM
Sbjct: 12  PCSLYHRNAG--LNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGM 69

Query: 72  DTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVIMGHSVGTYMIQ 131
           ++           +Y L +QI+HKIE+I  +       DG    +P++IMGHSVG +M+Q
Sbjct: 70  NSC----SEEVSPVYSLEQQIDHKIEIINRYCL-----DG----KPIIIMGHSVGAFMVQ 116

Query: 132 RMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTHGYLPYILSYLS 191
           ++  ++  +  ++       ++G +TPT+IDI+ S KG+ ++   +    +   ++S L+
Sbjct: 117 KITTSRRLKSKVI-------RVGLLTPTVIDIHKSEKGVKLTSITRWCPSF-HNVVSTLN 168

Query: 192 YFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSLGLASIEMQEIR 251
           + +F  +L     I + +I+ ++    +   A  TE+L+TNS  VKQ+LGLA+ E++ IR
Sbjct: 169 WALFEKLLP--TKITKSIISLLVDDPQSCLGAT-TELLVTNSRFVKQALGLAAEEVRVIR 225

Query: 252 KNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNYKDISRLQIEVSSE 311
            +W  QK+F+  C  ND ++W LF E DHWV+  TR D+I FY+  +   +  QI+VSS 
Sbjct: 226 SDWAYQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRNDIIDFYR-QHSSPALSQIDVSST 284

Query: 312 FPHSFVVNHSDWVVERFF 329
             H+FV  H+D V++++F
Sbjct: 285 IEHAFVRRHADLVIKQYF 302

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  211 bits (537), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 125/332 (37%), Positives = 193/332 (58%), Gaps = 32/332 (9%)

Query: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60
           M ++ YS++ + +S+ H++   L +   S  PLF++IPGNPG++++Y+ FL  + KKH +
Sbjct: 1   MHIQPYSKNGFFSSLYHLKP--LNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGN 58

Query: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120
           WEIL I HAGM T     + P  ++Y L +Q++HKI VI  F +           RPL+I
Sbjct: 59  WEILGISHAGMITKCKGLKKPT-KVYSLKDQVQHKIYVINDFCSS---------NRPLII 108

Query: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180
            GHS+G Y++Q++ L      T+       KKI  +TPT+IDI+LS KG      L   +
Sbjct: 109 AGHSIGAYIVQKIALDVSLMGTV-------KKIMLLTPTVIDIHLSEKG----RKLNWIN 157

Query: 181 GYLPYILSYL---SYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVK 237
            + P   SY+   S+ VF  +L     I  ++++  +G + T       ++L+TN   V+
Sbjct: 158 EWCPNFHSYVATASWLVFEKMLP--QTITEKILSLFVGSEQTCVRE-AAKLLVTNYEFVQ 214

Query: 238 QSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSN 297
           QSLGLA  EMQ++R +W+ Q  F++ C   +++L  LF   DHWVN+ TR DL +FY SN
Sbjct: 215 QSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSN 274

Query: 298 -YKDISRLQIEVSSEFPHSFVVNHSDWVVERF 328
            YKD   L I+   +  HSFV+N +  VV+R+
Sbjct: 275 YYKDF--LTIDEDEKISHSFVLNDTKSVVDRY 304

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  195 bits (495), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 184/324 (56%), Gaps = 39/324 (12%)

Query: 12  PTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPHWEILAIPHAGM 71
           P+SI+H+++   + +  S   LF++IPGNPG+++YY  FL  +H+K+P WEIL I HAGM
Sbjct: 12  PSSILHLKSG--VSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGM 69

Query: 72  ----DTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVIMGHSVGT 127
               D + PVY         L EQI HK++VI ++             + + IMGHSVG 
Sbjct: 70  NSCNDIACPVYT--------LQEQINHKVDVINSY---------AQGNKKITIMGHSVGA 112

Query: 128 YMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTHGYLPY-- 185
           ++ Q++V +    D +        ++G +TPT+IDI+ S KG+ ++    +T  +  +  
Sbjct: 113 FIAQKVVTSGLLNDEV-------ARVGLLTPTVIDIHKSEKGLKLT---AITERFPRFHQ 162

Query: 186 ILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSLGLASI 245
           ++S L +  F  +   F  +   +I++      T   A  T +LLTNS  VKQ+LGLA+ 
Sbjct: 163 LVSALDWIAFEKLFPDF--LTSWIISHFADDPKTCLGA-ATRLLLTNSRFVKQALGLATE 219

Query: 246 EMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNYKDISRLQ 305
           EMQ IR +W+ QK F+  C     ++W LF + DHWV++ TR DLI+FY+  +     + 
Sbjct: 220 EMQVIRSDWEYQKDFLHYCETKGAKIWWLFSDNDHWVSSETRKDLIQFYE-RHSSPELVS 278

Query: 306 IEVSSEFPHSFVVNHSDWVVERFF 329
           I+VS+   H+FV  H+  VV+ +F
Sbjct: 279 IDVSTAIEHAFVRRHAQVVVQHYF 302

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  173 bits (439), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 166/309 (53%), Gaps = 37/309 (11%)

Query: 31  NPLFIWIPGNPGILQYYQQFLCSLHKKHPHWEILAIPHAGMDTSLPVYRHPNDRIYHLNE 90
            PL ++IPGNPG++ +Y++FL  +H+++P WE++ I H GM +SL      + R++ L+E
Sbjct: 24  GPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGM-SSLRENNSLSGRVHTLDE 82

Query: 91  QIEHKIEVITTFLTKANSSDGIMKKRPLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYL 150
           QIE K++VI  F+            R + ++GHS+G YM+Q++ L K  +  I       
Sbjct: 83  QIEDKVKVINEFVDAGGD-------RCIKLIGHSIGAYMVQKIALHKGLRGKI------- 128

Query: 151 KKIGFITPTIIDINLSSKGILISHGLQLTH--GYLPYILSYLSYFVFSLILKYF------ 202
             +  +TPTIIDI+ SSKG+      QLT    + P    Y +Y V  ++ K+       
Sbjct: 129 DMVMLLTPTIIDIHRSSKGV------QLTRISDWFPKFYEY-AYVVDRVLFKWILPTSWI 181

Query: 203 DNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSLGLASIEMQEIRKNWDVQKQFVE 262
           + I R+LI     C +        + L++    VKQ+LGLA IEM ++R  WD Q +F+ 
Sbjct: 182 EWIARKLIGGSDECVLQ-----SAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFIS 236

Query: 263 NCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNYKDISR--LQIEVSSEFPHSFVVNH 320
            C  N I++  LF   DHWV+  T  D+I+ Y++ Y    +  L I +     HSFVV  
Sbjct: 237 FCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKD 296

Query: 321 SDWVVERFF 329
           +  VV  +F
Sbjct: 297 TTKVVNIYF 305

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  172 bits (436), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 105/309 (33%), Positives = 169/309 (54%), Gaps = 42/309 (13%)

Query: 33  LFIWIPGNPGILQYYQQFLCSLHKKHPHWEILAIPHAGMDTSLPVYRHPND--RIYHLNE 90
           + I++PGNPG++ +Y++FL S+H+K+P WEI+ I H GM         P D  R+Y L E
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTG----PEDLKRVYTLVE 96

Query: 91  QIEHKIEVITTFLTKANSSDGIMKKRPLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYL 150
           Q+EHK++ I  F+   N  +  +K     ++GHS+G YM Q++V+    +  +       
Sbjct: 97  QVEHKVKAINDFV--ENRGNLAVK-----LVGHSIGAYMAQKVVVHPALRVNV------- 142

Query: 151 KKIGFITPTIIDINLSSKGILISHGLQLTH--GYLPYILSYLSYFVFSLILKYF------ 202
           + +G +TPTIIDI+ S KG+      QLT    + P    Y+S  V  ++L++       
Sbjct: 143 EMVGLLTPTIIDIHRSPKGV------QLTRISEWFPRFYEYVS-IVDRVLLEWLLPATWI 195

Query: 203 DNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSLGLASIEMQEIRKNWDVQKQFVE 262
             + R++I     C +        E L+ N   V+Q+LG+A +EM ++R  WD Q++F++
Sbjct: 196 SWLARKIIGGSDECVLQ-----SAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIK 250

Query: 263 NCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNY--KDISRLQIEVSSEFPHSFVVNH 320
            C      LWLLF   DHWV++ T  D+++FY++ Y     S L+I +     HSFVV  
Sbjct: 251 TCQERRSSLWLLFSGHDHWVHSDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKD 310

Query: 321 SDWVVERFF 329
           +  VV  +F
Sbjct: 311 TTKVVNIYF 319

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 66/176 (37%), Gaps = 26/176 (14%)

Query: 32  PLFIWIPGNPGILQYYQQFLCSLHKKHPHWEILAIPHAGMDTSLPVYRHPNDRIYHLNEQ 91
           PL ++I G  G L  ++  L   H K   +  L +P  G    L  Y           + 
Sbjct: 82  PLHLFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDELESYSM---------KS 132

Query: 92  IEHKIEVITTFLTKANSSDGIMKKRPLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLK 151
           +   I  +    T    S G   +  L++ GHS+G Y      L   F +T   N + ++
Sbjct: 133 VIETIRSVVDLATGNQKSLGENTQLKLILTGHSMGCY------LCLHFFETYSKN-YDIR 185

Query: 152 KIGFIT-PTIIDINLSSKGILISHGLQLTHGYLPYILSYLSYFVFSLILKYFDNIR 206
           KI  ++ P  I  +LS +       L      LP        F+F L   YFD  R
Sbjct: 186 KIALLSPPKPIMTSLSKRNYWTQWALWGVFK-LP--------FIFDLYRNYFDQTR 232

>KLTH0H10252g Chr8 (880852..882333) [1482 bp, 493 aa] {ON} similar
           to uniprot|P37292 Saccharomyces cerevisiae YBR263W SHM1
           Serine hydroxymethyltransferase mitochondrial
          Length = 493

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 5/64 (7%)

Query: 159 TIIDINLSSKGILISHGLQLTHGY-LPY--ILSYLSYFVFSLILKYFDNIRRRLIAYIMG 215
            I+D+N    G+ + HG  L+HGY LP    +SY+S +  +  + Y  NI+  LI Y M 
Sbjct: 140 AILDVNERLMGLDLPHGGHLSHGYQLPSGTKISYISKYFQT--MPYHVNIQTGLIDYEML 197

Query: 216 CQMT 219
            Q +
Sbjct: 198 AQTS 201

>Ecym_7093 Chr7 (178741..180524,180627..180807) [1965 bp, 654 aa]
           {ON} similar to Ashbya gossypii AGR222W
          Length = 654

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 69/167 (41%), Gaps = 13/167 (7%)

Query: 85  IYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVIMGHSVGTYMIQRMVLTKEFQDTIL 144
           ++ L+ +    I+ +  F T +     ++   P+   GH+V  +      + KE   +++
Sbjct: 102 VHQLDTKFLEPIQTVLRFFTLSAVFVPVLLAYPITYFGHTVSIH--GNTTIVKETYGSLI 159

Query: 145 HNSFYLKKIGFITPTIIDIN--LSSKGILISHGLQLTHGYL-----PYILSYL-SYFVFS 196
                 + + F  PT I +     S+  + + GL L    L     P+ L Y     V +
Sbjct: 160 WYQIVRRALEFAGPTFIKLGQWAGSRTDIFAEGLCLELCNLHSNAKPHSLKYTKEQIVKA 219

Query: 197 LILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQSLGLA 243
           L ++ FD+I     A  +GC       +G    LT+ ++ ++ + L 
Sbjct: 220 LGVESFDDIFEEFDAKTLGCGAVAQVYVGK---LTDKIIKQKQIHLG 263

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,999,756
Number of extensions: 1561434
Number of successful extensions: 5746
Number of sequences better than 10.0: 35
Number of HSP's gapped: 5813
Number of HSP's successfully gapped: 35
Length of query: 329
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 219
Effective length of database: 40,868,139
Effective search space: 8950122441
Effective search space used: 8950122441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)