Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B058203.484ON78784003e-52
NCAS0F035203.484ON7652680.084
KLTH0H05896g6.146ON112356710.086
Kpol_YGOB_YLR346C4.178ON9720630.70
NCAS0A020804.178ON12126630.79
NCAS0B039308.247ON92970621.3
KAFR0C023801.369ON37761611.7
TDEL0A045405.587ON144333602.5
YLR346C4.178ON10146566.3
Skud_12.4324.178ON10154567.2
NOTE: 10 genes in the same pillar as NDAI0B05820 were not hit in these BLAST results
LIST: Kpol_YGOB_YPR145C-A KAFR0G03675 Skud_16.440 Smik_16.397 YPR145C-A KNAG0A07925 Suva_16.475 Agos_YGOB_YPR145C-A TPHA0D04205 Cgla_YGOB_Anc_3.484

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05820
         (78 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05820 Chr2 complement(1414176..1414412) [237 bp, 78 aa] {ON}    158   3e-52
NCAS0F03520 Chr6 complement(705454..705684) [231 bp, 76 aa] {ON}       31   0.084
KLTH0H05896g Chr8 complement(518252..521623) [3372 bp, 1123 aa] ...    32   0.086
Kpol_YGOB_YLR346C s499 (21979..22272) [294 bp, 97 aa] {ON} ANNOT...    29   0.70 
NCAS0A02080 Chr1 complement(397735..398100) [366 bp, 121 aa] {ON}      29   0.79 
NCAS0B03930 Chr2 complement(703610..706399) [2790 bp, 929 aa] {O...    28   1.3  
KAFR0C02380 Chr3 complement(463954..465087) [1134 bp, 377 aa] {O...    28   1.7  
TDEL0A04540 Chr1 (807351..811682) [4332 bp, 1443 aa] {ON} Anc_5....    28   2.5  
YLR346C Chr12 complement(822287..822592) [306 bp, 101 aa] {ON} P...    26   6.3  
Skud_12.432 Chr12 complement(762572..762877) [306 bp, 101 aa] {O...    26   7.2  

>NDAI0B05820 Chr2 complement(1414176..1414412) [237 bp, 78 aa]
          {ON}
          Length = 78

 Score =  158 bits (400), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%)

Query: 1  MNYFQMSFLKDISKSVKNIFTSDDKKGSKPTVITRYDLLNSSNVQNRRSFSMERHKNQRH 60
          MNYFQMSFLKDISKSVKNIFTSDDKKGSKPTVITRYDLLNSSNVQNRRSFSMERHKNQRH
Sbjct: 1  MNYFQMSFLKDISKSVKNIFTSDDKKGSKPTVITRYDLLNSSNVQNRRSFSMERHKNQRH 60

Query: 61 RRDTISTEKTMLSSRHTA 78
          RRDTISTEKTMLSSRHTA
Sbjct: 61 RRDTISTEKTMLSSRHTA 78

>NCAS0F03520 Chr6 complement(705454..705684) [231 bp, 76 aa] {ON}
          Length = 76

 Score = 30.8 bits (68), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 10/52 (19%)

Query: 1  MNYFQMSFLKDISKSVKNIFTSDD---------KKGSKPTVITRYDLLNSSN 43
          M YF+ + + +I   +K+IF ++          +K +KP V+TRYDLL+  N
Sbjct: 1  MEYFKNT-MSNIFNKLKHIFETESTTHTDNRHVQKQTKPDVVTRYDLLHGRN 51

>KLTH0H05896g Chr8 complement(518252..521623) [3372 bp, 1123 aa]
           {ON} similar to uniprot|P38329 Saccharomyces cerevisiae
           YBR235W Hypothetical ORF
          Length = 1123

 Score = 32.0 bits (71), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 3   YFQMSFLKDISKSVKNIFTSDDKKGSKP--TVITRYDLLNSSNVQNRRSFSMERHK 56
           + Q+     +   V+N+F      G KP  TVI  +DL N    +N+ S ++ER K
Sbjct: 599 FVQVGTGPTLPWGVRNVFLGSGLGGMKPNITVIGFFDLKNYHETRNKASDALERGK 654

>Kpol_YGOB_YLR346C s499 (21979..22272) [294 bp, 97 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 97

 Score = 28.9 bits (63), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%)

Query: 28 SKPTVITRYDLLNSSNVQNR 47
          +KP +ITR+DLL ++  QNR
Sbjct: 73 TKPNIITRHDLLMAAEAQNR 92

>NCAS0A02080 Chr1 complement(397735..398100) [366 bp, 121 aa] {ON}
          Length = 121

 Score = 28.9 bits (63), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 24 DKKGSKPTVITRYDLLNSSNVQNRRS 49
          ++K   P VITRYDLL ++    R++
Sbjct: 64 EQKAESPRVITRYDLLKAAEENERQA 89

>NCAS0B03930 Chr2 complement(703610..706399) [2790 bp, 929 aa] {ON}
           Anc_8.247
          Length = 929

 Score = 28.5 bits (62), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 38/70 (54%), Gaps = 7/70 (10%)

Query: 12  ISKSVKNIFTSDDKKGSKPTVITRYDLLNSSNVQN-------RRSFSMERHKNQRHRRDT 64
           +   ++ +   ++ +G+  ++I    +L  S+V+        RR FS+ +++  R+ RDT
Sbjct: 550 LPPVIRKLSEENESEGTFASLIGPNKILEVSSVEQSHDSVIIRRGFSLSQNQVGRNNRDT 609

Query: 65  ISTEKTMLSS 74
           I+T  T +SS
Sbjct: 610 ITTVMTTISS 619

>KAFR0C02380 Chr3 complement(463954..465087) [1134 bp, 377 aa] {ON} 
          Length = 377

 Score = 28.1 bits (61), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 20  FTSDDKKGSK---PTVITRYDLLNSSNVQNRRSFSMERHKNQRHRRDTISTEKTMLSSRH 76
           FT D+K   K   P      DLL  S+VQN+   + +    +R   + +S ++T L++  
Sbjct: 250 FTDDEKDFKKIVFPFTYNIADLLEPSSVQNKHILNAQWKNEERGEYEELSEQQTPLATNL 309

Query: 77  T 77
           T
Sbjct: 310 T 310

>TDEL0A04540 Chr1 (807351..811682) [4332 bp, 1443 aa] {ON} Anc_5.587
            YDR464W
          Length = 1443

 Score = 27.7 bits (60), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 21/33 (63%)

Query: 25   KKGSKPTVITRYDLLNSSNVQNRRSFSMERHKN 57
            KK  +P ++  +D+ +  N+Q RR+  ++R KN
Sbjct: 1194 KKAEQPVLLYAFDVPDFKNMQGRRTMLLKRAKN 1226

>YLR346C Chr12 complement(822287..822592) [306 bp, 101 aa] {ON}
          Putative protein of unknown function found in
          mitochondria; expression is regulated by transcription
          factors involved in pleiotropic drug resistance, Pdr1p
          and Yrr1p; YLR346C is not an essential gene
          Length = 101

 Score = 26.2 bits (56), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 21/46 (45%)

Query: 18 NIFTSDDKKGSKPTVITRYDLLNSSNVQNRRSFSMERHKNQRHRRD 63
          N+  S     +KP  ITRYDLL ++     +          RH+R+
Sbjct: 35 NVVGSGRYVSNKPDKITRYDLLKAAQEAEMQELLTRNDMKGRHKRN 80

>Skud_12.432 Chr12 complement(762572..762877) [306 bp, 101 aa]
          {ON} YLR346C (REAL)
          Length = 101

 Score = 26.2 bits (56), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 18 NIFTSDDKKGSKPTVITRYDLLNSSNVQNRRSFSME---RHKNQRHRRDTISTE 68
          N+  S     +KP  ITRYDLL +++    +    E   + K++R +R  ++ E
Sbjct: 35 NVVGSGRYVSNKPDKITRYDLLKAAHDAEMQELLTEGGLKGKSKRKKRTKVTLE 88

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.124    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,985,208
Number of extensions: 276246
Number of successful extensions: 1630
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1630
Number of HSP's successfully gapped: 25
Length of query: 78
Length of database: 53,481,399
Length adjustment: 50
Effective length of query: 28
Effective length of database: 47,748,099
Effective search space: 1336946772
Effective search space used: 1336946772
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)