Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B058103.483ON57757730500.0
NCAS0F035103.483ON57557727450.0
Kpol_480.193.483ON57457626750.0
CAGL0I10648g3.483ON57457726640.0
KAFR0G036703.483ON57257626170.0
TDEL0D055203.483ON57357526050.0
Suva_16.4743.483ON57257626050.0
Suva_7.4103.483ON57257726040.0
YGR124W (ASN2)3.483ON57257725910.0
Skud_7.4353.483ON57257725860.0
SAKL0F02970g3.483ON57357625840.0
TPHA0D042003.483ON57457725830.0
KNAG0A079203.483ON57857625810.0
YPR145W (ASN1)3.483ON57257625800.0
Smik_6.2203.483ON57257725790.0
Smik_16.3963.483ON57257625780.0
Skud_16.4393.483ON57257525720.0
Kwal_55.211873.483ON57357625620.0
TBLA0C044303.483ON58058025560.0
KLLA0B10868g3.483ON57457625450.0
KLTH0F14630g3.483ON57357625410.0
AFR303W3.483ON57157724720.0
ZYRO0B04136g3.483ON57257624450.0
Ecym_12443.483ON57357623690.0
KNAG0J002008.875ON5154571706e-12
ZYRO0A00528g8.875ON5124351601e-10
Smik_13.398.875ON5214831367e-08
TPHA0C049508.875ON525991341e-07
Kpol_455.78.875ON5181061332e-07
KLLA0D10285g8.875ON5154401279e-07
KAFR0L021108.875ON514951261e-06
Skud_13.468.875ON5191041261e-06
NDAI0K001808.875ON522941251e-06
TDEL0B004408.875ON516941224e-06
ADL350C8.875ON508681181e-05
Suva_13.528.875ON519861171e-05
YML096W8.875ON525951171e-05
NCAS0C001908.875ON5171051172e-05
SAKL0D00352g8.875ON515731143e-05
TBLA0C063008.875ON518941143e-05
Ecym_81558.875ON5134061135e-05
Skud_7.311singletonON8189953e-04
Kwal_27.97058.875ON515691054e-04
CAGL0H06963g8.875ON517951000.002
KLTH0E16412g8.875ON51595980.003
SAKL0E13200g2.59ON152102750.58
YGL014W (PUF4)4.114ON888118706.2
TPHA0M019806.361ON36896696.8
Skud_7.2734.114ON890118698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05810
         (577 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...  1179   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...  1061   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1035   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...  1030   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...  1012   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...  1008   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1008   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...  1007   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...  1002   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...  1000   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...   999   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   999   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...   998   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...   998   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...   998   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...   997   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   995   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   991   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   989   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...   984   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   983   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   956   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   946   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   917   0.0  
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    70   6e-12
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    66   1e-10
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    57   7e-08
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    56   1e-07
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    56   2e-07
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    54   9e-07
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    53   1e-06
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    53   1e-06
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    53   1e-06
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    52   4e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    50   1e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    50   1e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    50   1e-05
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    50   2e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    49   3e-05
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    49   3e-05
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    48   5e-05
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    41   3e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    45   4e-04
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    43   0.002
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    42   0.003
SAKL0E13200g Chr5 complement(1087744..1088137,1088221..1088285) ...    33   0.58 
YGL014W Chr7 (466141..468807) [2667 bp, 888 aa] {ON}  PUF4Member...    32   6.2  
TPHA0M01980 Chr13 complement(410969..412075) [1107 bp, 368 aa] {...    31   6.8  
Skud_7.273 Chr7 (469226..471898) [2673 bp, 890 aa] {ON} YGL014W ...    31   8.7  

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score = 1179 bits (3050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/577 (97%), Positives = 565/577 (97%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPF          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577
           QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score = 1061 bits (2745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/577 (86%), Positives = 531/577 (92%), Gaps = 3/577 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAAF+HEDV A+KP+ALQL+KRIRHRGPDWSGNV+KNTTILAHERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITSPCGNYTLCVNGEIYNHIQIRE+  DY FKTLSDCEPIIPLYLK+D+D PKHLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AWCLYD+KQDRI+AARDPIGITTLYMGR SKTPQTV+FASELKCLTDDCDSI+AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TDQITRYF PDWLDE RIP   +DL AIRE+LE AVRKRLMAEVP+          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARETEKA     +++EN        HLTGVDDEGHLH GGWS+LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHK---HLTGVDDEGHLHTGGWSRLHSFAIGLPN 297

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 298 APDLQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 357

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHLADCLRANKSTMAWG
Sbjct: 358 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 417

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLD++FLQLCMNIDPK+KMI+QA G+IEKYILRKAFDT+DDPE KPYLP+EILW
Sbjct: 418 LEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILW 477

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPK HWG D+PTTKEAYWYRLKFDALYP
Sbjct: 478 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYP 537

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577
           QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV+ 
Sbjct: 538 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDG 574

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1035 bits (2675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/576 (84%), Positives = 524/576 (90%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+  AFKPRALQLSKRIRHRGPDWSGNV+KN+TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITSPCG+Y LCVNGEIYNHIQ+RE  PDY +KTLSDCEPIIPLYLKHDID PK+LDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AWCLYD+K+DRIIAARDPIGITTLYMGRNSK+P+TVFFASELKCLTDDCDSI+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDQITRYF+PDW+DEQRIP   +   AIRESLE AVRKRLMAEVP+          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARETEKA  +      ++ D+    HLTG+DD+G+LH  GWS+LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDK----HLTGIDDQGNLHTAGWSRLHSFAIGLPN 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHLADCLRANKSTM+WG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDR+FLQLCMNIDP EKMIN +EGRIEKYILRKAFDTSD+P+ KPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKDTAERVISD +F  PK+HWG DIPTTKEAYWYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
           QKTAA+TVMRWIPKADWGCAEDPSGRYAKIHE+H+ 
Sbjct: 537 QKTAAETVMRWIPKADWGCAEDPSGRYAKIHEQHIG 572

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score = 1030 bits (2664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/577 (83%), Positives = 521/577 (90%), Gaps = 3/577 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAA+KH+DVHAFKP+ALQLSKRIRHRGPDWSGNV+KN+TI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITS  G+YTLCVNGEIYNHIQ+REQFPDY FKTLSDCEPIIP YL+HDID PK+LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AWCLYD+KQDRI+AARDP+GITTLYMGR S +P+TVFFASELKCLTDDCD I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDQITRYFTPDW+DE RIP   ++   IRESLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARETEKAN +   ++   ND ++   L G+D++GHLH  GWS+LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANEE---NDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPN 297

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 298 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 357

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESVKRV NLHLADCLRANKSTMAWG
Sbjct: 358 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWG 417

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLD++FLQLCMNIDPK+KMI+Q+ GRIEKYILRKAFDTSD+P+ KPYLPEEILW
Sbjct: 418 LEARVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILW 477

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKDTAERVISD MF NPK  WG DIPTTKEAYWYRLKFDAL+P
Sbjct: 478 RQKEQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFP 537

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577
           QKTAA TVMRWIPKADWGCAEDPSGRYAKIHE+HV A
Sbjct: 538 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHVTA 574

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score = 1012 bits (2617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/576 (82%), Positives = 516/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAAF+HEDV +FK +ALQLSKRIRHRGPDWSGNV+KN+TI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITSPCGNYTLCVNGEIYNHIQ+REQFPDY FKTLSDCEPIIPLYL+ DID PK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AW LYDSK+DRI+AARDPIG+TTLYMGR+S +P+TVFFASELKCL DDCDSI+AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRYFTP+W+DE +IP   +D TAIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARETE AN +  LD     +E S  HL G+DDEGHL   GWS+LHSFAIGLP 
Sbjct: 241 SLIASIAARETEAANRE--LDASQYAEEGS--HLAGIDDEGHLRTSGWSRLHSFAIGLPG 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLIAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDR+FL LCMNIDP +K+INQ EGRIEKYILRKAFDT DDP AKPYLP+EILW
Sbjct: 417 LEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWID LKDTAE+VISD MF NPK HWG DIPTTKEAYWYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
           Q TAA+TVMRWIPKADWGCAEDPSGRYA+IHEKH+ 
Sbjct: 537 QPTAAETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/575 (82%), Positives = 520/575 (90%), Gaps = 4/575 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAA KHEDV A+K +ALQLSKRIRHRGPDWSGNV++N T+L HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITSPCGNYTLCVNGEIYNHI++RE+F DY F TLSDCEPIIPLY K+DIDTPK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AWCLYD+KQDRIIAARDP+GITTLYMGRNS +P+TVFFASELKCLTDDCD+I+AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTD+ITRYFTPDWLDE RIP N +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARETEKANA+      ++ D+    HL G+DD G+LH+ GWS+LHSFAIGLP 
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDK----HLAGIDDSGNLHSAGWSRLHSFAIGLPG 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL+AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLKAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDR+FLQLCMNIDPK+KMIN+ EGR+EKYILRKAFDT+D+P+ KPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKDTAERVISD +F  PK  WG D+PTTKEA+WYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 575
           QKTAADTVMRW+PKADWGCAEDPSGR+A+IH++HV
Sbjct: 537 QKTAADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/576 (82%), Positives = 511/576 (88%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDVH +KP+ALQLSKRIRHRGPDWSGN +KN+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+RE+ PDY FKTLSDCEPIIP+YLKHDID PK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AW LYD+KQDRIIAARDPIGITTLYMGR+S +P+TV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTD+ITRYFTPDWLDE+RIP   +D  AIR SLE AVRKRLMAEVPF          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IA+IAARET    A+AT D E +  +    HL GVDDEG+LH  GW+ LHSFAIGLPN
Sbjct: 241 SLIAAIAARET----AKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPN 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDR+FLQLCMNIDP EKMI   EGRIEKYILRKAFDT+D+PE KPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWID LKDTAE VISD MF NPK  WG DIPTTKEAYWYRLKFD L+P
Sbjct: 477 RQKEQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
           QKT ADTVMRW+PKADWGCAEDPSGRYA+IHEKH++
Sbjct: 537 QKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1007 bits (2604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/577 (82%), Positives = 517/577 (89%), Gaps = 5/577 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAAFKHED+  FKP+ALQLSKRIRHRGPDWSGN I N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITS  G+Y L VNGEIYNHIQ+REQ  DY F+T SDCEPIIPLYL+HDID PK+LDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           A+CLYDSK+DR+IAARDPIG+ TLYMGR SK+P+TV+FASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRYFTPDWLDE+R+P   +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IA+IAARETE AN +A   NE A+ E SK  L G+DD+GHLH  GWS+LHSFA+GLPN
Sbjct: 241 SLIAAIAARETETANVEA---NEEASAEKSK--LAGIDDQGHLHTSGWSRLHSFAVGLPN 295

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKST+AWG
Sbjct: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWG 415

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLD+DFLQLCMNIDPK+KMIN  EGRIEKYILRKAFDT+D+P+ KPYLPEEILW
Sbjct: 416 LEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 475

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWID L+DTAERVISDAMF NPK  WG DIPTTKEAYWYRLKFDA +P
Sbjct: 476 RQKEQFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFP 535

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577
           QKTAADTVMRW+PKADWGCAEDPSGRYA+IHEKHVNA
Sbjct: 536 QKTAADTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/577 (82%), Positives = 512/577 (88%), Gaps = 5/577 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAAFKHED+H FKP+ALQLSK+IRHRGPDWSGN + N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITS  G Y L VNGEIYNHIQ+RE   DY F+T SDCEPIIPLYL+HDID PK+LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           A+CLYDSK+DRI+AARDPIG+ TLYMGR+S++P+TV+FASELKCLTD CDSII+FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRYFTPDWLDE+RIP   +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IA+IAARETEKANA A  DN        +  L G+DD+GHLH  GWS+LHSFAIGLPN
Sbjct: 241 SLIAAIAARETEKANADANEDNN-----VDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPN 295

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLD+DFLQLCMNIDP EKMI   EGRIEKYILRKAFDT+D+P+ KPYLPEEILW
Sbjct: 416 LEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 475

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGL+DTAER ISDAMF NPK  WG DIPTTKEAYWYRLKFDA +P
Sbjct: 476 RQKEQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFP 535

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577
           QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV+A
Sbjct: 536 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1000 bits (2586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/577 (81%), Positives = 514/577 (89%), Gaps = 5/577 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAAFKHED+++FKP+ALQLSKRIRHRGPDWSGN + N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PI S  G Y L VNGEIYNHIQ+RE+   Y F+T SDCEPIIPLYL+HDID PKHLDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           A+CLYD+K+DR++AARDPIG+ TLYMGR+SK+P+TV+FASELKCLTD CDSII+FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRYFTP+WLDE+RIP   +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IA+IAARETEKANA A  D    N +     L G+DD+GHLH  GWS+LHSFA+GLPN
Sbjct: 241 SLIAAIAARETEKANADADGDASVNNKQ-----LAGIDDQGHLHTSGWSRLHSFAVGLPN 295

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDRDFLQLCMNIDPK+KMIN  EGRIEKYILRKAFDT+D+PE KPYLPEEILW
Sbjct: 416 LEARVPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILW 475

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGL+DTAERVISD MF NPK  WG DIPTTKEAYWYRLKFDA +P
Sbjct: 476 RQKEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFP 535

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577
           QKTAADTVMRW+PKADWGCAEDPSGRYAKIHEKHV+A
Sbjct: 536 QKTAADTVMRWVPKADWGCAEDPSGRYAKIHEKHVSA 572

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/576 (82%), Positives = 509/576 (88%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA +KHE V  FKP+ALQLSKRIRHRGPDWSGNV+KNTTILAHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITS  G+YTLCVNGEIYNHI++RE+   YPFKTLSDCEPIIPLY K+DIDTPK+LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AWCLYD+K+DRIIAARDPIGITTLYMGR+S +P TVFFASELKCL DDCD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TD+ITRY+TPDWLDE+RIP+  LD   IR SLESAVRKRLMAEVP+          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IA+IAARETEKAN    LD    +DE    HL GVDD+G+LH  GWS+LHSFAIGLPN
Sbjct: 241 SLIAAIAARETEKANKD--LDPVAYDDEDK--HLAGVDDKGNLHAAGWSRLHSFAIGLPN 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDRDFL +CMNIDP EKMINQ+EGRIEKYILRKAFDT+D+P+ KPYLPEEILW
Sbjct: 417 LEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKD AE  ISD  F  PK  WG DIPTTKEAYWYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
           QKTAA TVMRWIPKADWGCAEDPSGRYAKIHE+H+ 
Sbjct: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQ 572

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/577 (82%), Positives = 515/577 (89%), Gaps = 4/577 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIF  +KHE+  AFKPRALQLSKRIRHRGPDWSGNV+KN+TI+AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITS  G++ LCVNGEIYNHIQIREQFPDY FKTLSDCEPIIPLY+K+  + PKHLDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AW LYD+KQDRIIAARDPIGITTLYMGR+SK+P+TV+FASELKCLTDDCDSI+AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TDQITRY+TPDW+DE RI    LDL  IR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARETEKA   A+    + +  +S   LTG+DD G+L + GWS+LHSFAIGLP 
Sbjct: 241 SLIASIAARETEKAMKTAS----SDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPG 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AA+KVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLIAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDR+FL LCMNIDP EKMINQ EGRIEKYILRKAFDT+D+P  KPYLP+EILW
Sbjct: 417 LEARVPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKDTAERVISD +FENP++HWG+DIPTTKEAYWYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577
           Q TAA TVMRWIPKADWGCAEDPSGRYAKIHE+H+ A
Sbjct: 537 QPTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHIGA 573

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score =  998 bits (2581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/576 (81%), Positives = 515/576 (89%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA F+HEDV AFKPRALQLSKRIRHRGPDWSGN+IKN+TI+AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITSPCG+Y L VNGEIYNHIQ+RE+ P+Y +K+LSDCEPIIP+YLK+D+D PKHLDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AWCLYD+K+DRI+AARDPIGITTLYMGR+S  P+TVFFASELKCLTDDCD+IIAFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE +IP   +DL  IR +LE AVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IA+IAARETEKAN +      +  +E    HL G+DDEG+L +  WS+LHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLD++FL LCMNIDPK+K+INQ EGRIEKYILRKAFDT D+P+ KPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKDTAE VISD MF  PK HWG D+PTTKEA+WYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
           Q TAA+TVMRWIPKADWGCAEDPSGR+AKIHE+HV 
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/576 (81%), Positives = 511/576 (88%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAAF+HEDVH +KP+ALQLSKRIRHRGPDWSGN IKN+TI  HERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITS  G Y LCVNGEIYNHIQ+RE+  DY F TLSDCEPIIP+YLKHDID PK+LDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AW LYD+KQDRI+AARDPIGITTLYMGR+S +P+TV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTD+ITRYFTPDWLDE+RIP   +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARET    A+AT D E +  ++   HL G+DD+G LH  GW+ LHSFAIGLPN
Sbjct: 241 SLIASIAARET----AKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPN 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDR+FLQLCMNIDP EKMI   EGRIEKYILRKAFDT+ +P+AKPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKDTAE VISD MF +PK  WG+DIPTTKEA+WYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
           QKT ADTVMRWIPKADWGCAEDPSGRYA+IHEKH+ 
Sbjct: 537 QKTVADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/577 (81%), Positives = 517/577 (89%), Gaps = 5/577 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAAFKH+D+H+FKP+ALQLSKRIRHRGPDWSGN + N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITS  G Y L VNGEIYNHIQ+RE+  DY F+T SDCEPIIPLYL+HDID PK+LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           A+C+YD+K+DRI+AARDPIG+ TLYMGR+SK+P+TV+FASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRYFTPDWLDE+RIP   +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IA+IAARETEKANA   ++ E++ DE     L G+DD+GHLH  GWS+LHSFAIGLPN
Sbjct: 241 SLIAAIAARETEKANAD--VNEESSVDEK---QLAGIDDQGHLHTSGWSRLHSFAIGLPN 295

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLD+DFLQLCMNIDPK+KMI   EG+IEKYILRKAFDT+++P+ KPYLPEEILW
Sbjct: 416 LEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILW 475

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGL+DTAERVISD MF NPK  WG DIPTTKEAYWYRLKFDA +P
Sbjct: 476 RQKEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFP 535

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577
           QKTAA+TVMRW+PKADWGCAEDPSGRYAKIHEKHV A
Sbjct: 536 QKTAANTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/576 (81%), Positives = 513/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDVH +KP+ALQLSKRIRHRGPDWSGN IKN+TI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+RE+ P+Y FKTLSDCEPIIP+YLKHDID PK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AW LYD+KQDRI+AARDPIGITTLYMGR+S +P+TV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTD+ITRYFTPDWLDE+RIP   +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARET    A AT D + +  ++   HL GVDD+G LH  GW+ LHSFAIGLPN
Sbjct: 241 SLIASIAARET----ANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPN 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLD++FLQLCMNIDP EKMI   EGRIEKYILRKAFDT+ +P+AKPYLPEEILW
Sbjct: 417 LEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKDTAE VISD MF +PK  WG+DIP+TKEA+WYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
           QKT ADTVMRWIPKADWGCAEDPSGRYA+IHEKH++
Sbjct: 537 QKTVADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  995 bits (2572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/575 (81%), Positives = 510/575 (88%), Gaps = 4/575 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAA+KHEDVH +K +ALQLSKRIRHRGPDWSGN  KN+TI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+RE+ PDY FKTLSDCEPIIP+YLKHDI+ PK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AW LYD+KQDRI+AARDPIGITTLYMGR+S +P+TV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTD+ITRYFTPDWLDE+RIP   +D  AIR SLE AVRKRLMAEVPF          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARET    A AT D E +  ++   HL GVDD+G+LH  GW+ LHSFAIGLPN
Sbjct: 241 SLIASIAARET----ANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPN 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDR+FLQLCMNIDPKEKMI   EGRIEKYILRKAFDT+ +P+AKPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWID LKD AE VISD MF +PK  WG+DIPTTKEA+WYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 575
           QKT ADTVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 537 QKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  991 bits (2562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/576 (81%), Positives = 512/576 (88%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIF  F+HEDV  FKP ALQL+KRIRHRGPDWSGNVI+N+T+LAHERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           P+ S   +Y L VNGEIYNHIQ+RE+F DYPFKTLSDCEPIIPLY K+ ID PK+LDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AW LYD+K+DR+IAARDPIGITTLYMGR+SK+P+TV+FASELKCLTD+CDSIIAFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDQITRY+TP+WLDE RIP   LDL  IR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IA+IAARETEKAN +      ++ D+    HL GVDD G LH+ GWS+LHSFA+GLPN
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDK----HLAGVDDSGKLHSAGWSRLHSFAVGLPN 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL+AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLEAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDR+FL LCMN+DPKEKMINQAEGRIEKYILRKAFDTSD+P AKPYLPEEILW
Sbjct: 417 LEARVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKDTAE  ISD  F+ PK  WG DIPTTKEAYWYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
           QKTAA TVMRWIPKADWGCAEDPSGRYAKIH++H++
Sbjct: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHDQHIS 572

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/580 (80%), Positives = 512/580 (88%), Gaps = 3/580 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAA+KH +V+AFKPRALQL+KRIRHRGPDWSGNV+KNTT+ AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITSPCGNY L VNGEIYNHIQ+RE+  DY +KTL DCEPIIP+YLK+D+D P HLDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           A+ LYDS++DR+IAARDP+GITTLYMGRNSKTP+TV+FASELKCL DDCDSIIAFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+I RYF P+W+DE  IP   +DL  +RE+LE AVRKRLMAEVP+          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKA-NAQATLDNENANDETSKA--HLTGVDDEGHLHNGGWSKLHSFAIG 297
             IASIAARETEK  +   T+D E  +D+ + A   LTG+DD G+L    WSKLHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 298 LPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 357
           LP APDL+AARKVA FIGSIHHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 358 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTM 417
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRV NLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 418 AWGLEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEE 477
           AWGLEARVPFLDRDFL LCMNIDP +KMI   EG+IEKY+LRKAFDTSD+P+ KPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 478 ILWRQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDA 537
           ILWRQKEQFSDGVGYSWID LKDTAERVISD MF NPKDHWG+DIPTTKEAYWYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 538 LYPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577
           L+PQKTAADTVMRWIPKADWGCAEDPSGRYAKIHE+H++ 
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHIDG 580

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score =  984 bits (2545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/576 (80%), Positives = 508/576 (88%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA+F++ DV A+KP+ALQLSKRIRHRGPDWSGN++KN+TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PITS  G+YTL VNGEIYNHI +RE+   YPFKTLSDCEPIIPLY K+DID PKHLDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AWCLYDSK+DRIIAARDPIGITTLYMGR+S +P++V+F+SELKCLTDDCD IIAFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD++TRYFTPDWLDE RIP   +D  A+RESLE AVRKRLMAEVP+          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IA+IAARETEK NA+     +    ++    L G+D++GHLH  GWS+LHSFA+GLPN
Sbjct: 241 SLIAAIAARETEKTNAEL----DPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPN 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDRDFLQLCMNIDP +KMI  AEG+IEKYILRKAFDT+D+P+ KPYLPEEILW
Sbjct: 417 LEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKD AE  ISD  F  PK  WG DIPTTKEAYWYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
           QKTAA TVMRWIPKADWGCAEDPSGRYAKIHE+HV+
Sbjct: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/576 (81%), Positives = 505/576 (87%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIF  F+H+ V  FKP AL+L KRIRHRGPDWSGN+IKN+T++AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           P  S   NY L VNGE+YNHIQ+RE+F  YPFKTLSDCEPIIPLY K+ ID PK+LDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AW LYD+K+DRI+AARDPIGITTLYMGR+SK+P+TV+FASELKCLTD+CDSIIAFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDQITRYF PDW+DE RIP   LDL  IR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARETEKAN+Q      ++ D+    HL GVDD G+L + GWS LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDK----HLAGVDDAGNLRSAGWSHLHSFAIGLPN 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDR+FLQLCMN+DPKEKMIN AEGRIEKYILRKAFDTSD+P AKPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKD AE  ISD  F+ PK  WG DIPTTKEAYWYRLKFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
           QKTAA TVMRWIPKADWGCAEDPSGRYAKIHE+H++
Sbjct: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/577 (77%), Positives = 498/577 (86%), Gaps = 6/577 (1%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA ++ +D+ +FKP AL+LSKR+RHRGPDWSGNVIKN TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PI SP GNY LCVNGEIYNHI +RE+  DY F +LSDCEPIIPLYLK+D++TP+HLDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AWCLYD ++DRI+AARDPIG+TTLYMG++S +P+T +FASELKCL D+CD I AFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TD++TRYF PDW+DE RIP   +D  A+R +LE AVRKRLMAEVP+          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARETE+AN +A       +      HL G+DD G LH GGWS+LHSFAIGLPN
Sbjct: 241 SLIASIAARETERANREA------GDVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPN 294

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKI
Sbjct: 295 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKI 354

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRVNNLHLADCLRANKSTMAWG
Sbjct: 355 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWG 414

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDR+FLQLCMNIDP EKMI   +GRIEKYILRKAFDTSD+P   PYLPEEILW
Sbjct: 415 LEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILW 474

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKD AER ISD  F NP   WG DIPTTKEA+WYRLKFDAL+P
Sbjct: 475 RQKEQFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFP 534

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577
           Q TAA TVMRW+PKADWGCAEDPSGRYAKIH++H+++
Sbjct: 535 QPTAAATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/576 (77%), Positives = 492/576 (85%), Gaps = 5/576 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFAAF+H DV  ++P ALQLSKRIRHRGPDWSGNV+KN+TIL HERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PI SPCGNYTLCVNGEIYNHIQ+RE+  DYPF++LSDCEPIIPLYLK+ +D PK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AWCLYDSK+DRI+AARDPIGITTLYMG++SK+P+T FFASELKCL DDCD I+AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDSK+DQITRYF P WLDE  +P   LD   +R SLE +VRKRLMAEVP+          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IASIAARETE+AN +  LD  N + E  + HL G+D +G+LH GGWS+LHSFAIGLP 
Sbjct: 241 SLIASIAARETERANEE--LDPVNYDSE--EKHLAGIDAQGNLHTGGWSRLHSFAIGLPG 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDRDFL LCM +DP EKMI   EGRIEKYILRKAFDT+D+P  KPYLPE+ILW
Sbjct: 417 LEARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWIDGLKD AE  ISD M   P+  WG D PTTKEAYWYRLKFD  +P
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
            K+AA+TVMRWIPKADWGC  DPSGR+AKIHE+H++
Sbjct: 537 -KSAANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/576 (74%), Positives = 485/576 (84%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA ++ + + +FKP ALQLSKRIRHRGPDWSGNV+KN TI  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120
           PI S  GNY LCVNGEIYNHI +R+   DYPF TLSDCEPIIPL+ K+ ++TP +LDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180
           AWCLYD+K DRI+AARDPIG+TTLYMG+ SK+P+T +FASELKCL ++CD II+FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TDQITRYF P WL +   P   +D   +R  LE AVRKRLM EVP+          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300
             IA+IAARETEKAN +  +       ++   +L GVDDE HLH  GWSKLHSFAIGLPN
Sbjct: 241 SLIAAIAARETEKANKEMDV----VKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPN 296

Query: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLQAARKVAKFIGSIHHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           KAQG+KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RV NLHLADCLRANKSTMAWG
Sbjct: 357 KAQGIKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480
           LEARVPFLDRDFL+LCMNIDP+EKMI   EG+IEKYILRKAFDTSD+P+ +PYLP+EILW
Sbjct: 417 LEARVPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540
           RQKEQFSDGVGYSWID LKD AE  ISD  F  PK  WG DIP+TKEAYWYR+KFDAL+P
Sbjct: 477 RQKEQFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFP 536

Query: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576
           Q TAA TVMRW+PKA+WGC+EDPSGR+AKIHEKH++
Sbjct: 537 QPTAASTVMRWVPKAEWGCSEDPSGRFAKIHEKHIS 572

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 109/457 (23%), Positives = 179/457 (39%), Gaps = 69/457 (15%)

Query: 27  IRHRGPD---WSGNVIKNTTILAHERLAIVGLDSGAQPITSPC----GNYTLCVNGEIYN 79
           I  RGP+   W G+   +T   +    +++ L    QP T       G Y L  NGE+YN
Sbjct: 47  IAARGPNFASWRGSAEYSTAWFS----SVLSL---RQPFTKQSLVVDGRYVLQFNGELYN 99

Query: 80  HIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMFAWCLYDSKQDRIIAARDPI 139
             +I      Y    L+  E  IP       D    LDG FA+ +YD++  +    RD I
Sbjct: 100 D-EIEFNDTQYIADMLARGEASIP-------DIIARLDGEFAYTIYDTEDQKYYFGRDAI 151

Query: 140 GITTLYMGRNSKTPQTVFFASELKCLTD----DCDSIIAFPPGHVYDSK------TDQIT 189
           G  +L    N+   Q ++ +S    + D    DC + I +    +YD+K      ++ I+
Sbjct: 152 GKRSLSYYVNTSKDQ-LYVSSVTGRVEDIEFRDCIAGIIY----IYDAKNQHLDDSNHIS 206

Query: 190 RYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRL-------MAEVPFXXXXXXXXXXXX 242
             +T   L ++   E    +  +   L  AV KR+       +   P             
Sbjct: 207 DPYTVSPLVDENFTERGEHIEKLHFQLNLAVEKRINSIHPNHIENSPISVLFSGGLDCSV 266

Query: 243 IASIAARETEKANAQATLDNENANDETSKAHLTGVDD-EGHLHNGGWSKLHSF------- 294
           I ++   +     A+ T++  N   E  +  L   D  +  L    +  L          
Sbjct: 267 IVALICNQL-SGKARKTVELLNVGFENPRTGLVPSDSPDRKLAIESYKTLQHLYPDIDIR 325

Query: 295 --AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTP 352
              I +P    L+A  KV   +        F  Q  +D    + ++  +    +I   + 
Sbjct: 326 LIEIDVPYEEYLRAKPKVIDLM--------FPKQTEMDLSIAIAFYFASKGEGSITDKST 377

Query: 353 MFLLSRKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLR 411
                 KI  Q   +VL SG G+DE++GGY  FA   S  +   E  +++NN+H  +  R
Sbjct: 378 ----KGKIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNR 432

Query: 412 ANKSTMAWGLEARVPFLDRDFLQLCMNIDPKEKMINQ 448
            +K   + G+E R PFLD   ++      P    IN+
Sbjct: 433 DDKVIASNGVEIRYPFLDSSVVKFSTEDLPINYKINK 469

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 101/435 (23%), Positives = 174/435 (40%), Gaps = 94/435 (21%)

Query: 69  YTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHD----IDTPKHLDGMFAWCL 124
           Y L  NGE+YN             + L +    +   L++D     +    L+G FA+ +
Sbjct: 88  YILQFNGELYNE------------EILDNDTSFVASLLENDKMSVFEVISFLEGEFAYTI 135

Query: 125 YDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFAS---ELKCLTDDCDSIIAFPPGHVY 181
           YD  + ++   RD IG  +L   R  +    ++ AS   + +  TD    I+     ++Y
Sbjct: 136 YDMHEHKLYFGRDDIGKRSLSY-RLDQAIGDIYVASVTGQQEGFTDCLAGIV-----YIY 189

Query: 182 DSKTDQITRYFTPDWLDE--QRIPENKLDLT----AIRESLESAVRKRL-------MAEV 228
           D +   + +   P    E    I E++ +      A+ E L+SA+ KR+       +   
Sbjct: 190 DVEDKSLNQQMLPILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRVESIHPMHLENS 249

Query: 229 PFXXXXXXXXXXXXIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGW 288
           P             IA++  ++ E   ++ T++  N + E  +  L+  D          
Sbjct: 250 PIAVLFSGGLDCSVIAAMICQQLENQPSRRTVELLNVSFENYRTGLSPHD---------- 299

Query: 289 SKLHSFAIGLPNAPDLQAARKVAKFIGSIHHEHTF----------TLQEGLDALDDVIYH 338
                        PD + A K A  +  +                T +E    + D++Y 
Sbjct: 300 ------------TPDRKLAVKSANALKQLFPSVDIKLVEIDVPYETYEEHRPKVIDLMYP 347

Query: 339 LETYDVTTIRASTPMFLLSR-------------KIKAQGVKMVLSGEGSDEIFGGYLYFA 385
             T    +I  S   +  S+             K + QG+ ++ SG G+DE++GGY  FA
Sbjct: 348 KNTEMDLSI--SIAFYFASKGSGYIDCGNGQRKKYQRQGI-VLFSGLGADELYGGYYKFA 404

Query: 386 QAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWGLEARVPFLDRDFLQLCMNIDPKEKM 445
           +  S  E   E  +++NN++  +  R +K   A G+E R PFLDR  ++  M   P    
Sbjct: 405 R-KSTDELVEELTRQINNIYNRNLNRDDKVIAANGVEVRYPFLDRHVIEFSMQSIP---- 459

Query: 446 INQAEGRIEKYILRK 460
           IN    +I K ILRK
Sbjct: 460 IN---WKINKLILRK 471

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 108/483 (22%), Positives = 184/483 (38%), Gaps = 98/483 (20%)

Query: 27  IRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQPITSPCGN----YTLCVNGEIYNHIQ 82
           I  RGP++S       T+ A+       + S  +P T    N    Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNK-E 101

Query: 83  IREQFPD--YPFKTLSDCEPIIPLYLKHDIDTPKHLDGMFAWCLYDSKQDRIIAARDPIG 140
           +     D  Y    L D E    +     ID  K L+G +A+ +YD K  +    RDPIG
Sbjct: 102 VSHWGNDSLYIASLLKDLEDDGSV-----IDVIKSLEGEYAYTVYDVKSAKFYFGRDPIG 156

Query: 141 ITTLYMGRNSKTPQTVF-FASELKCLTDDCDSIIAFPPGHVYDSKTDQI--TRYFTPDWL 197
             +L     +     V      ++C  D     +     + YD++T  +   +   P + 
Sbjct: 157 RRSLSYSVTANNELYVASVTGAVECFHDCIGGTV-----YEYDTQTKSLHDNQRLRPPYE 211

Query: 198 DEQRIPENKLDLTAIRESLESAVRKRLMAEV-----------PFXXXXXXXXXXXXIASI 246
              ++    + L+ + ++L S +R+ +   +           P             IA++
Sbjct: 212 VTPKLDMEFVSLSIVSKNLYSVLRESVKKRIESIHPAHIENSPIAVLFSGGIDCSVIAAL 271

Query: 247 AA---RETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPNAPD 303
                +E      + T++  N + E  +  L   D                       PD
Sbjct: 272 VCEVLQENSYKCGKPTIELLNVSFENPRTGLLPSD----------------------TPD 309

Query: 304 LQAARKVAKFIGSIHHEHTFTLQEGLD-----------ALDDVIYHLETYDVTTIRASTP 352
            + +   A+ I  ++ E    L E +D           ++ D++Y  +T     +  +  
Sbjct: 310 RKLSINSARIIQKLYPEIDIKLVE-IDVPYEEYLKFRPSVIDLMYSKQT--EMDLSIAIA 366

Query: 353 MFLLSRK-------------IKAQGVKMVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESV 398
            F  SR               +  G+ + LSG G+DE++GGY  FA +AP   E   E  
Sbjct: 367 FFFASRGKGFLTLPHGERKPYQRHGIVL-LSGLGADELYGGYHKFANKAPH--ELVEELT 423

Query: 399 KRVNNLHLADCLRANKSTMAWGLEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYIL 458
           K++NN++  +  R +K     G+E R PFLD    +  +     E  IN    ++ K IL
Sbjct: 424 KQINNIYERNLNRDDKVIAHNGVEVRYPFLD----EYVIKFSTVEIPINY---KVNKLIL 476

Query: 459 RKA 461
           RK 
Sbjct: 477 RKV 479

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (55%), Gaps = 9/99 (9%)

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  K++NN+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILR 459
           +E R PFLD    +  +N   KE  IN    +I K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKEIPINY---KINKKILR 477

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 76/174 (43%), Gaps = 28/174 (16%)

Query: 69  YTLCVNGEIYNH----IQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMFAWCL 124
           Y L  NGE+YN+    I     F +   KT  D + II +         + L+G FA+ +
Sbjct: 89  YILQFNGELYNNEIHGISDTTYFVN-CLKTALDEKDIINIL--------RTLEGEFAYTI 139

Query: 125 YDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPG--HVYD 182
           +DSK+  +   RD IG  +L    + +T +    ++     T D +       G  ++Y+
Sbjct: 140 FDSKKKLVYFGRDTIGKRSLGYKLDYETNELYISSA-----TGDVEGFKNCVGGIVYIYN 194

Query: 183 SKTDQITR-------YFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVP 229
            +  Q+         Y     +DE     N+L +  + +SL  +V KR+++  P
Sbjct: 195 IEKKQLDEENMIREPYTVSAEVDEGESRANEL-IAKLYDSLYESVEKRVLSIHP 247

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 7/106 (6%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  FA   S  E   E  +++NN+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 427 FLDRDFLQLCMNIDPKEKMINQAEGR---IEKYILRKAFDTSDDPE 469
           FLD + +Q  ++  P    +N+   R   +EK  LR   D + +P+
Sbjct: 450 FLDEEVIQYSVSQIPISYKVNKGILRKLALEKLQLR---DIAQEPK 492

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 71/168 (42%), Gaps = 20/168 (11%)

Query: 69  YTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMFAWCLYDSK 128
           Y L  NGE+YN  +I      Y    L  C+  +       +   + LDG FA+ +YD K
Sbjct: 92  YVLQFNGELYNS-EISGNDTQYIVSLLKSCDGDV-------VSLVRKLDGGFAYTIYDLK 143

Query: 129 QDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHVYDSKTDQI 188
           +  I   RD IG  +L    +  + + +F +S         D +      + YD+KT  +
Sbjct: 144 EGNIYFGRDTIGKRSLCYSIDENSGE-LFISSVTGTRGTFVDCLGGVI--YTYDTKTHTL 200

Query: 189 -------TRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVP 229
                   +Y   D  DE       ++L  +  +L  +V+KR+++  P
Sbjct: 201 DDTKVIRDKYVVTDMTDELENESQYMEL--LYGTLYESVKKRVLSIHP 246

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 108/440 (24%), Positives = 172/440 (39%), Gaps = 78/440 (17%)

Query: 69  YTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDID-TPKHLDGMFAWCLYDS 127
           Y L  NGE+YN   +            SD E I  L  KH ++   +   G FA+ + D 
Sbjct: 90  YLLQYNGELYNDDTVENC-------EHSDTEYISSLLEKHSVEEVVRKCYGEFAYAITDL 142

Query: 128 KQDRIIAARDPIGITTLYMGRNSKTPQTVFFASEL--KCLTDDCDSIIAFPPG--HVYDS 183
           ++ ++   RD IG  +L           +    EL    ++  CD       G  +++D 
Sbjct: 143 QERKVYFGRDSIGKRSL---------SYILLDDELYITSVSGRCDGFQNCLAGVIYIFDI 193

Query: 184 KTDQITR--------YFTPDWLDE--QRIPENKLDLTAIRESLESAVRKRLMAEVPFXXX 233
            T Q+T         Y   D +D   Q + E K+ L    E L  +V +R++   P    
Sbjct: 194 NTKQLTGSVKIHDEPYIVSDQIDNDFQLLEEYKIKLY---ECLRRSVYQRIVTIHPMHLE 250

Query: 234 XXXXXXXXX----IASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWS 289
                         + I A   E+      L   N N ET    L  V  E    N    
Sbjct: 251 NGNISILFSGGLDCSVITALLCEQ------LIKINRNSETI-IELLNVGFE----NPRTG 299

Query: 290 KLHSFAIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLET-----YDV 344
           K+ S      ++PD   A K A+ +  ++ +    L E      D + H +T     Y  
Sbjct: 300 KMPS------DSPDRILAIKSAQLLSELYPQVNIKLIEVDVPYTDYLSHKDTVIDLMYPK 353

Query: 345 TT---IRASTPMFLLSR---KIKAQGVK--------MVLSGEGSDEIFGGYLYFAQAPSA 390
            T   +  +   +  SR   K+   G          ++ SG G+DE++GGY  F+   S 
Sbjct: 354 NTEMDLSIAIAFYFASRGRGKVTENGESKPYNRSGIVMFSGLGADELYGGYHKFSNK-SN 412

Query: 391 AEFHTESVKRVNNLHLADCLRANKSTMAWGLEARVPFLDRDFLQLCMNIDPKEKMINQAE 450
            E   E  K++  +H  +  R +K     G+E R PFLD   +Q  +++ P    +N+  
Sbjct: 413 EELVIELQKQIAQIHDRNLNRDDKVISNHGIEVRYPFLDERVVQFSVDL-PLNYKVNKHI 471

Query: 451 GRI-EKYILRKAFDTSDDPE 469
            R+  K ILR  F  S++P+
Sbjct: 472 LRVMAKDILRLDF-ISEEPK 490

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 8/95 (8%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  F    S  E   E   ++NN+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 427 FLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKA 461
           FLD + +Q       +E  IN    ++ K ILRK 
Sbjct: 447 FLDHNVVQF----STQEIPINY---KVNKLILRKV 474

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 38/78 (48%), Gaps = 11/78 (14%)

Query: 69  YTLCVNGEIYNHIQIREQFPDYPF--KTLSDCEPIIPLYLKHDIDTPKHLDGMFAWCLYD 126
           Y L  NGE+YN  +I++   D  F    LS    +I         T   LDG FA+ +YD
Sbjct: 88  YVLQFNGELYNK-EIKQDQNDTQFIASLLSSSTDVI--------HTLTQLDGEFAYTIYD 138

Query: 127 SKQDRIIAARDPIGITTL 144
            ++ +I   RD IG  +L
Sbjct: 139 LRETKIYFGRDSIGKRSL 156

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 57/104 (54%), Gaps = 9/104 (8%)

Query: 358 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTM 417
           +  + QGV ++LSG G+DE++GGY  FA   +  E   E  +++NN++  +  R +K   
Sbjct: 385 KSYQRQGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIA 442

Query: 418 AWGLEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKA 461
             G+E R PFLD    +  +N+   E  IN    ++ K ILRK 
Sbjct: 443 HNGVEVRYPFLD----EYVINLSTLEIPINY---KVNKLILRKV 479

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 57/124 (45%), Gaps = 16/124 (12%)

Query: 27  IRHRGPDWSG-NVIKNTTILAHERLAIVGLDSGAQPITSPCGN----YTLCVNGEIYNHI 81
           I  RGP++S   VIK     AH+      + S  +P T    N    Y L  NGE+YN  
Sbjct: 47  IAARGPNYSSLRVIK-----AHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN-- 99

Query: 82  QIREQFPDYPFKTLSDCEPIIPLY-LKHDIDTPKHLDGMFAWCLYDSKQDRIIAARDPIG 140
              ++  D+   +L     +  L   ++ +D  + L+G +A+ +YD K       RDPIG
Sbjct: 100 ---KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIG 156

Query: 141 ITTL 144
             +L
Sbjct: 157 KRSL 160

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 8/94 (8%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  FA   S  E   E  K++NN++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 427 FLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRK 460
           FLD D ++       +E  IN    +I K ILRK
Sbjct: 455 FLDIDVIKF----STEELPINY---KINKLILRK 481

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 92/215 (42%), Gaps = 29/215 (13%)

Query: 27  IRHRGPDWSG-NVIKNTTILAHERLAIVGLDSGAQPITSPC----GNYTLCVNGEIYNHI 81
           I  RGP++S   V K  +I     +      S  +P T  C      Y +  NGE+YN  
Sbjct: 49  IAARGPNYSSFKVSKQYSITWFSSVL-----SLREPFTKQCVEIKDRYVVQFNGELYND- 102

Query: 82  QIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMFAWCLYDSKQDRIIAARDPIGI 141
           +I+     Y  + L + + II        D  + LDG FA+ +YD +       RDPIG 
Sbjct: 103 EIQYNDTQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQNRMFYFGRDPIGR 154

Query: 142 TTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHVYDSKTDQITR-------YFTP 194
             L    +++T + ++ +S   C T   D I      + YD +  ++         ++  
Sbjct: 155 RCLSFSIDNETGE-LYISSVTGCKTGFQDCIAG--TIYKYDCQLKELNTDSKISKPFYVS 211

Query: 195 DWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVP 229
           + LD++ +     ++  +   L  +V KR+++  P
Sbjct: 212 EELDDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY   A   S +E   E  +++NN+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 427 FLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRK 460
           FLD D ++      P    IN    ++ K ILR+
Sbjct: 449 FLDHDVIKFSTEEIP----INY---KVNKMILRR 475

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 95/223 (42%), Gaps = 41/223 (18%)

Query: 27  IRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQPITS---PCGN-YTLCVNGEIYNHIQ 82
           I+ RGPD+S   + +     H       + S  +P TS     GN + L  NGE+YN  +
Sbjct: 47  IKSRGPDYSSLRVSS----EHSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYNQ-E 101

Query: 83  IREQFPDYPFKTLSDCEPIIPLYLKHDI-DTPKHLDGMFAWCLYDSKQDRIIAARDPIGI 141
           I     D  F      E        HD+    + L G FA+ LYD +Q +    RD +G 
Sbjct: 102 ITAHDNDTQFIVSKLQEGY------HDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNVGK 155

Query: 142 TTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHVYDSKTDQI-------TRYFTP 194
            +L    ++ T + ++ +S    +    D I      +VYD+++  +       ++YF  
Sbjct: 156 RSLSYHLSAITGE-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQYFIT 212

Query: 195 DWLDEQRIPENKLDLTAIRESLES-------AVRKRLMAEVPF 230
             LDE+        LT +  ++E        AVRKR+++  P 
Sbjct: 213 KKLDEE--------LTCLDSTVEQLYGMLSLAVRKRVLSIHPL 247

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWGLEARVP 426
           ++ +G G+DE++GGY  FA   S  E   E  +++NN+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 427 FLDRDFLQ 434
           FLD   ++
Sbjct: 441 FLDEKVIK 448

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 363 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWGLE 422
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++NN++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 423 ARVPFLDRDFLQLCMNIDPKEKMINQ 448
            R PFLD   ++      P    IN+
Sbjct: 448 VRYPFLDEHVIKFSAVDIPINFKINK 473

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 53/126 (42%), Gaps = 20/126 (15%)

Query: 27  IRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQPIT----SPCGNYTLCVNGEIYN-HI 81
           I  RGP++S   +      A++      + S  QP T    S    Y L  NGE+YN  I
Sbjct: 47  IAARGPNYSSLRVSK----AYQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYNKEI 102

Query: 82  QIREQFPDYPFKTLSDCEPIIPLYLKHD---IDTPKHLDGMFAWCLYDSKQDRIIAARDP 138
              +    Y    L +        L  D   ID  + L+G +A+ +YD K  +    RDP
Sbjct: 103 SDDDNDSQYIASLLQN--------LTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRDP 154

Query: 139 IGITTL 144
           IG  +L
Sbjct: 155 IGRRSL 160

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  FA  P   E   E  +++NN++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 427 FLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKA 461
           FLD   ++L     P    +N       K ILRK 
Sbjct: 452 FLDEYVIKLSTAEIPINFKVN-------KLILRKV 479

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQPITSPCGN----YTLCVNGEIYN-HI 81
           I  RGP++S        + A+       + S  QP T    N    Y L  NGE+YN  I
Sbjct: 47  IAARGPNYSSL----RAVKAYRISWFSSVLSLRQPFTKQSINVDDRYFLQFNGELYNKEI 102

Query: 82  QIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMFAWCLYDSKQDRIIAARDPIGI 141
              +    Y    L + +  + +     ID  K L+G +A+ +YD    ++   RDPIG 
Sbjct: 103 SQGDNDSLYIASMLQNLKEGMGV-----IDVIKSLEGEYAYTIYDVNSSKLYFGRDPIGR 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 9/105 (8%)

Query: 356 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKS 415
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E  +++NN++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 416 TMAWGLEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRK 460
               G+E R PFLD + ++      P    IN    ++ K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFSTMEIP----INY---KVNKMILRK 475

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 69  YTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMFAWCLYDSK 128
           Y L  NGE+YNH +I      Y    L +  P IP  +K        L+G FA+ +YD +
Sbjct: 90  YVLQFNGELYNH-EIVHNDTQYIVGLLKESAPSIPAIIKK-------LNGEFAYSIYDIQ 141

Query: 129 QDRIIAARDPIGITTL 144
                  RD +G  +L
Sbjct: 142 NGTFYFGRDTVGKRSL 157

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 363 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWGLE 422
           +GV ++ SG G+DE++GGY   A   SA E       ++NN+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 423 ARVPFLDRDFLQL 435
            R PFLD   +Q 
Sbjct: 445 VRYPFLDEKVVQF 457

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 58/126 (46%), Gaps = 23/126 (18%)

Query: 69  YTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPK---HLDGMFAWCLY 125
           + L  NGE+YN      Q  D  F        I  L  ++  D PK    ++G FA+ ++
Sbjct: 91  FVLQYNGELYNS---SIQHNDTLF--------IASLIERYQDDIPKAIREMEGEFAYTIF 139

Query: 126 DSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLT---DDCDSIIAFPPGHVYD 182
           D + +++   RD IG  +L    +S+T +   F S +   +   +DC+    +    +YD
Sbjct: 140 DKQCEKLYFGRDTIGKRSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IYD 193

Query: 183 SKTDQI 188
           SKT  +
Sbjct: 194 SKTGNL 199

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  F    +  E   E  +++NN+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 427 FLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRK 460
           FLD   ++   +  P    IN    +I K ILRK
Sbjct: 451 FLDEHVIKYSTHDIP----INY---KINKLILRK 477

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 57/134 (42%), Gaps = 27/134 (20%)

Query: 22  QLSKRIRHRGPDWSGNVIKNTTILAHERLAIVG-LDSGAQPITSPC----GNYTLCVNGE 76
            L K I  RGP+++         L   R+++   + S  +P           Y L  NGE
Sbjct: 43  NLMKLISARGPNFAS-----LRTLKDHRISLFSSVLSLREPFCKQSVLVEDRYVLQFNGE 97

Query: 77  IYNHIQIREQFPDYPFKTLSDCEPIIPLYL------KHDIDTPKHLDGMFAWCLYDSKQD 130
           +YN   I            +D + I+ L L      K  I   K+LDG FA+ +YD K  
Sbjct: 98  LYNDEIIH-----------NDTQFIVKLLLNTEQNSKGIISVIKNLDGEFAFSIYDLKNK 146

Query: 131 RIIAARDPIGITTL 144
           R+   RDPIG  +L
Sbjct: 147 RLYFGRDPIGKRSL 160

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 92/406 (22%), Positives = 154/406 (37%), Gaps = 74/406 (18%)

Query: 69  YTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTP-KHLDGMFAWCLYDS 127
           Y L  NGE+YN              + +D + I  L  K  +D   + L G FA+ +Y++
Sbjct: 91  YILQYNGELYNDDI-----------SHNDSQYIAGLLEKLPVDVVLRRLYGEFAYSIYNT 139

Query: 128 KQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLT--DDCDSIIAFPPGHVYDS-- 183
           K   I   RD +G  +L   ++++T + +F  S    L     CD+ I +    VYD+  
Sbjct: 140 KTKCIYFGRDSVGKRSLSYHQDNETGE-LFITSVSGKLEGFKACDAGIIY----VYDTVR 194

Query: 184 ----KTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFXXXXXXXXX 239
                  ++  Y+      +  +   + ++  +   L  ++ KRL    P          
Sbjct: 195 RTLYNDMRLREYYQVSGTHDTDVELLQSNVDLLYNKLYDSINKRLTTIEPLHEENKTHVS 254

Query: 240 XXX-----IASIAARETE--KANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLH 292
                    + IAA   E  K N+ A L+  N   E  +   TG+               
Sbjct: 255 VLFSGGLDCSVIAALICEQWKVNSDAVLELLNVAFENPR---TGMKPS------------ 299

Query: 293 SFAIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTP 352
                   APD   +++  K +  ++ +    L E   + DD + H            T 
Sbjct: 300 -------EAPDRILSKRSVKILRKLYPQTKIKLVEVDVSYDDYLKHKPVVIDLMYPKDTE 352

Query: 353 M-------FLLSRK-----------IKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEF 393
           M       F  + K           I  Q   +VL SG G+DE++GGY  F    S    
Sbjct: 353 MDLSIAIAFYFASKGHGSLQEGDKTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELL 411

Query: 394 HTESVKRVNNLHLADCLRANKSTMAWGLEARVPFLDRDFLQLCMNI 439
             E  K++NN++  +  R +K     G+E R PFLD + + L  ++
Sbjct: 412 IKELTKQINNIYDRNLDRDDKCMACNGIEIRYPFLDEEVINLSTSL 457

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 44/89 (49%), Gaps = 14/89 (15%)

Query: 102 IPLYLKHDIDTPKHLDGMFAWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASE 161
           +P YL+ DID PKHL+ MFA+     ++              ++ G +    +T F  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCC--------CCKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LTDDCDSIIAFPPGHVYDSK 184
             L C    LT  CD+  +F PG V+DS+
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++NN+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 421 LEARVPFLD 429
           +E R PFLD
Sbjct: 442 VEVRYPFLD 450

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 36/89 (40%), Gaps = 13/89 (14%)

Query: 60  QPITSPC----GNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKH 115
           +P+T  C      + L  NGEIYN   I      Y    LS  + +  +  K        
Sbjct: 78  EPLTKQCIDINDRFVLQYNGEIYNS-SIAHNDTQYIATELSIVQNVPTVIRK-------- 128

Query: 116 LDGMFAWCLYDSKQDRIIAARDPIGITTL 144
           L G FA+ +YD     I   RD +G  +L
Sbjct: 129 LSGEFAYTVYDRATGEIFFGRDGVGKRSL 157

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 6/95 (6%)

Query: 356 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKS 415
           + ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++NN++  +  R +K 
Sbjct: 382 VRKEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKV 439

Query: 416 TMAWGLEARVPFLDRDFLQLCMNIDP----KEKMI 446
             + G+E R PFL  + ++      P    ++KMI
Sbjct: 440 IASNGVEVRYPFLAEEVVEFSTASIPLNYKRDKMI 474

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 74/180 (41%), Gaps = 36/180 (20%)

Query: 1   MCGIFA----AFKHEDVHAFK------PR------ALQLSKRIRHRGPDW-SGNVIKNTT 43
           MCGI      +FK E+    +      PR         + K +R RGP++ S   IK+  
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 44  ILAHERLAIVGLDSGAQPITSP---CGN-YTLCVNGEIYNHIQIREQFPDYPFKT--LSD 97
                 + I  + S  QP T      GN Y L  NGE+YN  +I E   D  F +  L  
Sbjct: 61  -----SIWISSVLSLRQPFTKQSIVIGNKYVLQFNGELYND-EIIESGNDTQFLSGLLKK 114

Query: 98  CEPIIPLYLKHDIDTPKH-LDGMFAWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTV 156
           C        + DI    H LDG FA+ + D + + I   RD IG  +L    N    + +
Sbjct: 115 CIS------EDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSLSYSLNYNISELI 168

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  F++  +  E   E   ++NN++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 427 FLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKA 461
           FLD   +     +    K        + K ILRK 
Sbjct: 448 FLDDQVVAFSTQLPINYK--------VNKMILRKV 474

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 37/89 (41%), Gaps = 13/89 (14%)

Query: 60  QPITSPC----GNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKH 115
           +P T  C      + L  NGEIYN   I      Y  + L + + I  +         + 
Sbjct: 78  EPFTKQCIEVEDRFVLQYNGEIYNS-SISHNDTQYIAEMLLNAKDIPSVI--------RT 128

Query: 116 LDGMFAWCLYDSKQDRIIAARDPIGITTL 144
           L G FA+ +YD     +   RDPIG  +L
Sbjct: 129 LSGEFAYTIYDKLTGEVFFGRDPIGRRSL 157

>SAKL0E13200g Chr5 complement(1087744..1088137,1088221..1088285)
           [459 bp, 152 aa] {ON} highly similar to uniprot|Q07648
           Saccharomyces cerevisiae YDL219W DTD1 D-Tyr-tRNA(Tyr)
           deacylase functions in protein translation may affect
           nonsense suppression via alteration of the protein
           synthesis machinery ubiquitous among eukaryotes
          Length = 152

 Score = 33.5 bits (75), Expect = 0.58,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 38/102 (37%), Gaps = 14/102 (13%)

Query: 456 YILRKAFDTSDDPEAKPYLPEEILWRQKEQFSDGVGYSWIDGLKDTAERVISDAMF---- 511
           Y+L     T D+ E    L ++I     + F D  GY W   +KD    ++S + F    
Sbjct: 27  YMLLVGISTEDNTEDAEKLSKKI--ASLKVFDDDTGYGWKKSIKDVEGEILSVSQFTLMA 84

Query: 512 -----ENPKDHWGTDIPTTKEAYWYRLKFDALYPQKTAADTV 548
                  P  H     PT KE Y    KF  L  Q    D V
Sbjct: 85  RTKKGTKPDFHMAQKGPTAKELYE---KFLDLLKQDLGEDRV 123

>YGL014W Chr7 (466141..468807) [2667 bp, 888 aa] {ON}  PUF4Member of
           the PUF protein family, which is defined by the presence
           of Pumilio homology domains that confer RNA binding
           activity; preferentially binds mRNAs encoding nucleolar
           ribosomal RNA-processing factors
          Length = 888

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 55/118 (46%), Gaps = 15/118 (12%)

Query: 8   FKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIV--GLDSGAQPITSP 65
           + H+ VH  KPRA++LS  I   G +    ++K   +     L I+  G ++G Q + + 
Sbjct: 777 YTHKIVHLLKPRAIELS--IHKFGSNVIEKILKTAIVSEPMILEILNNGGETGIQSLLND 834

Query: 66  C-GNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTP--KHLDGMF 120
             GNY L         + I  +  DY +K LS  E + PL +    +TP  K + GM 
Sbjct: 835 SYGNYVL------QTALDISHKQNDYLYKRLS--EIVAPLLVGPIRNTPHGKRIIGML 884

>TPHA0M01980 Chr13 complement(410969..412075) [1107 bp, 368 aa] {ON}
           Anc_6.361 YNR041C
          Length = 368

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 40/96 (41%), Gaps = 16/96 (16%)

Query: 90  YPFKTLSDCEPIIPLYLKHDIDTPKHLDGMFAWCL-YDS---KQDRIIAARDPIGITTLY 145
           +P   + D   ++PLY            G F WC+ YD+    QD+    +  I  T L 
Sbjct: 229 FPAMGIMDWSTMLPLY-----------TGSFLWCMIYDTIYAHQDKAFDVKAGIKSTALA 277

Query: 146 MGRNSKTPQTVFFASELKCLT-DDCDSIIAFPPGHV 180
            G+N+K   TV   ++    T    ++ +   PG +
Sbjct: 278 WGKNTKKISTVLATAQFSLFTIAGINAGLILGPGFI 313

>Skud_7.273 Chr7 (469226..471898) [2673 bp, 890 aa] {ON} YGL014W
           (REAL)
          Length = 890

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 55/118 (46%), Gaps = 15/118 (12%)

Query: 8   FKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIV--GLDSGAQPITSP 65
           + H+ VH  KP+A++LS  I   G +    ++K   +     L I+  G ++G Q + + 
Sbjct: 779 YTHKIVHLLKPKAIELS--IHKFGSNVIEKILKTPIVSEPMILEILNNGGETGIQSLLND 836

Query: 66  C-GNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTP--KHLDGMF 120
             GNY L         + I  +  DY +K LSD   + PL +    +TP  K + GM 
Sbjct: 837 SYGNYVL------QTALDISHKQNDYLYKRLSDI--VAPLLVGPIRNTPHGKRIIGML 886

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,211,308
Number of extensions: 2711137
Number of successful extensions: 6531
Number of sequences better than 10.0: 52
Number of HSP's gapped: 6610
Number of HSP's successfully gapped: 70
Length of query: 577
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 462
Effective length of database: 40,294,809
Effective search space: 18616201758
Effective search space used: 18616201758
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)