Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B057205.442ON36536515990.0
NCAS0F034305.442ON33236513470.0
Smik_4.6385.442ON34631513120.0
Suva_2.5445.442ON34631513110.0
YDR372C (VPS74)5.442ON34531513060.0
Skud_4.6415.442ON34631513050.0
SAKL0G02706g5.442ON33231512821e-178
KAFR0D050605.442ON32636512801e-177
KNAG0B042005.442ON34436512681e-175
TDEL0D025905.442ON33031512571e-174
CAGL0A02926g5.442ON32831512541e-173
KLTH0F15884g5.442ON32931512431e-172
Kwal_55.213995.442ON32931512311e-170
Kpol_1016.25.442ON32831512271e-169
ZYRO0F10208g5.442ON33231512261e-169
KLLA0E02355g5.442ON32431512201e-168
TBLA0A064805.442ON33431511941e-164
Ecym_45135.442ON33331511781e-162
ACL165C5.442ON33131511601e-159
TPHA0J026105.442ON32931511141e-152
Kpol_1062.245.442ON2762769331e-125
TBLA0A027805.442ON3872848341e-109
NCAS0H020905.442ON3452855932e-73
KAFR0C051107.39ON89174780.39
ABL078C4.372ON281113731.1
Skud_5.481.485ON517131741.2
KAFR0B043805.81ON761111731.8
KNAG0I004201.459ON108579695.3
Skud_10.2541.459ON110366679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05720
         (365 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   620   0.0  
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   523   0.0  
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   509   0.0  
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   509   0.0  
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   507   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   507   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   498   e-178
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   497   e-177
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   493   e-175
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   488   e-174
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   487   e-173
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   483   e-172
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   478   e-170
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   477   e-169
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   476   e-169
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   474   e-168
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   464   e-164
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   458   e-162
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   451   e-159
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   433   e-152
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   363   e-125
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   325   e-109
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   233   2e-73
KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7...    35   0.39 
ABL078C Chr2 complement(254921..255766) [846 bp, 281 aa] {ON} Sy...    33   1.1  
Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)    33   1.2  
KAFR0B04380 Chr2 complement(907246..909531) [2286 bp, 761 aa] {O...    33   1.8  
KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON...    31   5.3  
Skud_10.254 Chr10 (453258..456569) [3312 bp, 1103 aa] {ON} YJR03...    30   9.7  

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/365 (86%), Positives = 314/365 (86%)

Query: 1   MSTLQRRRRPQDGSNKGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIAYDPEEAK 60
           MSTLQRRRRPQDGSNKGM                                KIAYDPEEAK
Sbjct: 1   MSTLQRRRRPQDGSNKGMVDVDSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAYDPEEAK 60

Query: 61  LLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI 120
           LL                   AVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI
Sbjct: 61  LLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI 120

Query: 121 LIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWI 180
           LIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWI
Sbjct: 121 LIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWI 180

Query: 181 DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 240
           DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI
Sbjct: 181 DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 240

Query: 241 KRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNA 300
           KRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNA
Sbjct: 241 KRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNA 300

Query: 301 IARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSR 360
           IARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSR
Sbjct: 301 IARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSR 360

Query: 361 MDTLL 365
           MDTLL
Sbjct: 361 MDTLL 365

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/365 (73%), Positives = 288/365 (78%), Gaps = 33/365 (9%)

Query: 1   MSTLQRRRRPQDGSNKGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIAYDPEEAK 60
           MSTLQRRR  +D S+                                   K+AYDPEEA+
Sbjct: 1   MSTLQRRRVNKDDSDN-----------------ETGSVTPNVERDSDNDNKVAYDPEEAR 43

Query: 61  LLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI 120
           +                       P LTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI
Sbjct: 44  M----------------RNVGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI 87

Query: 121 LIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWI 180
           LIELALRGKI+ILDDSARKRF+LSERL++V DG+KTGEVLLDETLQLMKNDEPL+IA+WI
Sbjct: 88  LIELALRGKIQILDDSARKRFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPLSIASWI 147

Query: 181 DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 240
           DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI
Sbjct: 148 DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 207

Query: 241 KRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNA 300
           KRRVLS+LVSRNME +YN YFP+ T FKIIRTIALICGAYGANVLEN+L SLD+E SDNA
Sbjct: 208 KRRVLSILVSRNMELSYNNYFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNA 267

Query: 301 IARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSR 360
           IARADELIAQFSKFPFDLE  T   +SVNLNR VQQEL + PGYDLQLEVIAGVIEVFSR
Sbjct: 268 IARADELIAQFSKFPFDLETPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSR 327

Query: 361 MDTLL 365
           MDTLL
Sbjct: 328 MDTLL 332

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  509 bits (1312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/315 (78%), Positives = 277/315 (87%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           KIAYDPEE+KL                       PTLTLMEEVLLMGLRD+EGYLSFWND
Sbjct: 49  KIAYDPEESKLRDNIN-----------------IPTLTLMEEVLLMGLRDREGYLSFWND 91

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           +ISYALRGCI+IELALRGKIRILDDSARKRFDLSERLIEV DGSKTGEVLLDETLQLMKN
Sbjct: 92  SISYALRGCIIIELALRGKIRILDDSARKRFDLSERLIEVIDGSKTGEVLLDETLQLMKN 151

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPLTI+NWIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 152 DEPLTISNWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 211

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           + D+SCKEAIKRRVLSVLVSRNME +YNEYFP+ T FKIIRT+ALICG+YGANVLENVL+
Sbjct: 212 IADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLT 271

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           +L+YEK D AI+RA+E++AQFS+FPFDLEK T   +SVNLN+ V++E++ NPG++LQLEV
Sbjct: 272 TLEYEKRDKAISRAEEIMAQFSQFPFDLEKETELGISVNLNKEVKEEMESNPGHNLQLEV 331

Query: 351 IAGVIEVFSRMDTLL 365
           IAGV EVFSRMD LL
Sbjct: 332 IAGVFEVFSRMDMLL 346

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/315 (78%), Positives = 277/315 (87%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           KIAYDPEE+KL                       PTLTLMEEVLLMGLRD+EGYLSFWND
Sbjct: 49  KIAYDPEESKLRDNIK-----------------IPTLTLMEEVLLMGLRDREGYLSFWND 91

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           +ISYALRGCILIELALRGKIRILDDSARKRFDLSERL+EV DGSKTGEVLLDETLQLMKN
Sbjct: 92  SISYALRGCILIELALRGKIRILDDSARKRFDLSERLVEVIDGSKTGEVLLDETLQLMKN 151

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPLTI+NWIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 152 DEPLTISNWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 211

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           + D+SCKEAIKRRVLSVLVSRNME +YNEYFP+ T FKIIRT+ALICG+YGANVLENVL+
Sbjct: 212 IADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLT 271

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           +L+YEK D AI+RA+E+++ FS++PFDLEK T+  VSVNLN+ V++E++ NPG+DLQLEV
Sbjct: 272 TLEYEKRDKAISRAEEIMSHFSQYPFDLEKDTDLGVSVNLNKEVKEEIENNPGHDLQLEV 331

Query: 351 IAGVIEVFSRMDTLL 365
           IAGV EVFSRMD LL
Sbjct: 332 IAGVFEVFSRMDMLL 346

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  507 bits (1306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/315 (78%), Positives = 276/315 (87%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           KIAYDPEE+KL                       PTLTLMEEVLLMGLRD+EGYLSFWND
Sbjct: 48  KIAYDPEESKLRDNIN-----------------IPTLTLMEEVLLMGLRDREGYLSFWND 90

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           +ISYALRGCI+IELALRGKIRILDDSARKRFDLSERLIEV D SKTGEVLLDETLQLMKN
Sbjct: 91  SISYALRGCIIIELALRGKIRILDDSARKRFDLSERLIEVIDSSKTGEVLLDETLQLMKN 150

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPL+I+NWIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 151 DEPLSISNWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 210

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           + D+SCKEAIKRRVLSVLVSRNME +YNEYFP+ T FKIIRT+ALICG+YGANVLENVL+
Sbjct: 211 IADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLT 270

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           +L+YEK D AI+RA+E++AQFS++PFDLEK T   VSVNLN+ V++E++ NPG+DLQLEV
Sbjct: 271 TLEYEKRDKAISRAEEIMAQFSQYPFDLEKETELGVSVNLNKEVKEEIENNPGHDLQLEV 330

Query: 351 IAGVIEVFSRMDTLL 365
           IAGV EVFSRMD LL
Sbjct: 331 IAGVFEVFSRMDMLL 345

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  507 bits (1305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/315 (78%), Positives = 275/315 (87%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           KIAYDPEE+KL                       PTLTLMEEVLLMGLRD+EGYLSFWND
Sbjct: 49  KIAYDPEESKLRDNIK-----------------IPTLTLMEEVLLMGLRDREGYLSFWND 91

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           +ISYALRGCILIELALRGKIRILDDSARKRFDLSERL+EV DGSKTGEVLLDETLQLMKN
Sbjct: 92  SISYALRGCILIELALRGKIRILDDSARKRFDLSERLVEVVDGSKTGEVLLDETLQLMKN 151

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPLTI+NWIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 152 DEPLTISNWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 211

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           + D+SCKEAIKRRVLSVLVSRNME +YNEYFP+ T FKIIRT+ALICG+YGANVLENVL+
Sbjct: 212 IADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLT 271

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           +L+YEK D AI RA+E++AQFS++PFDLEK T   VSVNLN+ V++E++ N G+DLQLEV
Sbjct: 272 TLEYEKRDKAINRAEEIMAQFSQYPFDLEKETELGVSVNLNKEVKEEIENNTGHDLQLEV 331

Query: 351 IAGVIEVFSRMDTLL 365
           IAGV EVFSRMD LL
Sbjct: 332 IAGVFEVFSRMDMLL 346

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  498 bits (1282), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/315 (77%), Positives = 269/315 (85%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           K+AYDPEEAKL                       P LTLMEEVLLMGL+DKEGYLSFWND
Sbjct: 35  KVAYDPEEAKL-----------------KENTTVPKLTLMEEVLLMGLKDKEGYLSFWND 77

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           NISYALRGCILIELALR KIR+LDD ARKRFD+S+RLIEV DGSKTGEVLLDE L L+KN
Sbjct: 78  NISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDGSKTGEVLLDEALNLIKN 137

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPL IANWIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 138 DEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 197

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           +TD+SCKEAIKRRVLSVLVSRNME NYNEYF +N  FKIIRT++LICGAYGANVLENVL+
Sbjct: 198 ITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTLSLICGAYGANVLENVLA 257

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           SLDY+K D A +RADE++AQFS+FPF L+K T + +SVNLN+ VQ E+ +NPG DLQLEV
Sbjct: 258 SLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKEVQAEIAQNPGKDLQLEV 317

Query: 351 IAGVIEVFSRMDTLL 365
           +AGV EVFSRMDTLL
Sbjct: 318 VAGVFEVFSRMDTLL 332

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  497 bits (1280), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 252/365 (69%), Positives = 279/365 (76%), Gaps = 39/365 (10%)

Query: 1   MSTLQRRRRPQDGSNKGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIAYDPEEAK 60
           MSTLQRRR+ +  SN                                   K+AYDPEEAK
Sbjct: 1   MSTLQRRRKNRSDSNAD----------------------DSENVSESQDRKVAYDPEEAK 38

Query: 61  LLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI 120
           L                       P LTLMEEVLLMGLRD+EGYLSFWNDNISYALRGCI
Sbjct: 39  L-----------------RDNVSIPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCI 81

Query: 121 LIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWI 180
           LIELALR KIRILDDSARKRFD+SERL+EV DGSKTGEVLLDE LQLMKNDEPLTIANWI
Sbjct: 82  LIELALRNKIRILDDSARKRFDVSERLVEVIDGSKTGEVLLDEALQLMKNDEPLTIANWI 141

Query: 181 DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 240
           DLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTD+SCKEAI
Sbjct: 142 DLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAI 201

Query: 241 KRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNA 300
           KRR+LS LVSRNME NYN YF + T FK IR +AL+C +YGANVLENVLSSLDYEK D A
Sbjct: 202 KRRILSALVSRNMELNYNSYFAETTSFKYIRIVALVCCSYGANVLENVLSSLDYEKRDRA 261

Query: 301 IARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSR 360
           I+RA+E++AQF+++PFDL K T   +SVNLN+ V+ E++ENP + LQLEVIAGVIEVFSR
Sbjct: 262 ISRAEEILAQFAQYPFDLSKNTELGISVNLNKEVENEVNENPQFTLQLEVIAGVIEVFSR 321

Query: 361 MDTLL 365
           MD LL
Sbjct: 322 MDMLL 326

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  493 bits (1268), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 247/365 (67%), Positives = 280/365 (76%), Gaps = 21/365 (5%)

Query: 1   MSTLQRRRRPQDGSNKGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIAYDPEEAK 60
           MSTLQRRR  +  SN+G                                 K+AYDPEEAK
Sbjct: 1   MSTLQRRRVNRSDSNEG----ETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAK 56

Query: 61  LLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI 120
           L                       P LTLMEEVLLMGLRD+EGYLSFWNDNISYALRGCI
Sbjct: 57  L-----------------RDNYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCI 99

Query: 121 LIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWI 180
           +IELALR KIRILDDSARKRFD+SERL+EV DGSKTGEVLLDETLQLMKNDEPLTIANWI
Sbjct: 100 MIELALRKKIRILDDSARKRFDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWI 159

Query: 181 DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 240
           DLLSGETWN+MKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI
Sbjct: 160 DLLSGETWNLMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 219

Query: 241 KRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNA 300
           KRR+LS +VSRNME ++N YFP++T FK IRT+AL+C  YGA+VLENVLSSLDYE+ D A
Sbjct: 220 KRRILSTVVSRNMELSFNSYFPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRA 279

Query: 301 IARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSR 360
           ++RA+EL+ +F ++PFDLEK  ++ +S NLN+  Q+E+DE+P   L LEV+AGVIEVFSR
Sbjct: 280 VSRAEELLEKFGQYPFDLEKQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSR 339

Query: 361 MDTLL 365
           MD LL
Sbjct: 340 MDMLL 344

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  488 bits (1257), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/315 (75%), Positives = 269/315 (85%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           ++AYDPEEAK+                       P LTLMEEVLL+GLRDKEGYLSFWND
Sbjct: 33  RVAYDPEEAKI-----------------TENVKNPKLTLMEEVLLLGLRDKEGYLSFWND 75

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           NISYALRGCI+IELALRGKIRI+DDSARKRFD+SERLIEV D SKTGEVLLDETLQLMK 
Sbjct: 76  NISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASKTGEVLLDETLQLMKY 135

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPLTIANWIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 136 DEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 195

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           VTD+SCKEA+KRRVLSVLVSRNME +YNEYFP  T FK+IRTIALICG+Y ANVLENVL+
Sbjct: 196 VTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIALICGSYRANVLENVLT 255

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           SLDYEK D A++RADE++ Q++++PFDL+K T + +S+NLN+ V++EL +N    LQLEV
Sbjct: 256 SLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVKEELSQNKDCPLQLEV 315

Query: 351 IAGVIEVFSRMDTLL 365
           +AGV EVFSRMD LL
Sbjct: 316 VAGVFEVFSRMDMLL 330

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  487 bits (1254), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 238/315 (75%), Positives = 270/315 (85%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           KIAYDPEE+KL                    +  PTLTLMEEVLLMGLRD+EGYLSFWND
Sbjct: 31  KIAYDPEESKL-----------------QNDSKQPTLTLMEEVLLMGLRDREGYLSFWND 73

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           +ISYALRGCILIELALR KIRILD  AR RFD+SERLIEV D SKTGEVLLDETLQLM N
Sbjct: 74  SISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSKTGEVLLDETLQLMVN 133

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPL+IANWIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 134 DEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 193

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           V+DSSCKEAIKRR+LSVLVSRNME +YN YFP++T FK+IRT++LI GAYGANVLENV+S
Sbjct: 194 VSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLIAGAYGANVLENVIS 253

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           SL+Y+K D AI RA+E++AQFS++PFDL+K +   +SVNLN+ +Q+EL+ NPG DL+LEV
Sbjct: 254 SLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQEELESNPGSDLKLEV 313

Query: 351 IAGVIEVFSRMDTLL 365
           IAGV EVFSRMD LL
Sbjct: 314 IAGVFEVFSRMDMLL 328

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  483 bits (1243), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 235/315 (74%), Positives = 264/315 (83%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           ++AYDPEEAKL                      TP L LMEEVLLMGL+DKEGYLSFWND
Sbjct: 32  RVAYDPEEAKL-----------------RDDTTTPKLNLMEEVLLMGLKDKEGYLSFWND 74

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           NISYALRGCILIELALRGKI++L+D ARKRFD+SERL+EV + +KTGEVLLDE L LMKN
Sbjct: 75  NISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKTGEVLLDEALNLMKN 134

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPLTIANWIDLLSGETWN MKI+YQLKQVRERLAKGLVDKGVLRTEMKNFFLFDM THP
Sbjct: 135 DEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMPTHP 194

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           +TD+SCKEAIKRR+LSVLVSRNM+ NYNEYFP +  FK+IRT++LICGAYGANVLENVLS
Sbjct: 195 ITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLICGAYGANVLENVLS 254

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           SLDYEK D A +RADE++AQFS+FPF L+K T T +SVNLN+ VQ+E+  N    LQLE 
Sbjct: 255 SLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQEEVVSNQDASLQLEC 314

Query: 351 IAGVIEVFSRMDTLL 365
           +AGV EVFSRMDTLL
Sbjct: 315 VAGVFEVFSRMDTLL 329

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  478 bits (1231), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 231/315 (73%), Positives = 265/315 (84%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           ++AYDPEEA L                    A  P L LMEEVLLMGL+DKEGYLSFWND
Sbjct: 32  RVAYDPEEAML-----------------KDNATIPKLNLMEEVLLMGLKDKEGYLSFWND 74

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           NISYALRGCILIELALRGKI++++DSARKRFD+SERL+EV + +KTGEVLLDE L LMKN
Sbjct: 75  NISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKTGEVLLDEALNLMKN 134

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPLTIANWIDLLSGETWN MKI+YQLKQVRERLAKGLVDKGVLRTEMKNFFLFDM THP
Sbjct: 135 DEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMPTHP 194

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           +TD+SCKEAIKRR+LSVLVSRNM+ NYNEYFP +  FK++RT++LICGAYGANVLENVL 
Sbjct: 195 ITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLICGAYGANVLENVLC 254

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           SLDYEK D A +RADE++AQFS+FPF L+K T T +SVN+N+ +Q+E+D N    L+LEV
Sbjct: 255 SLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQEEIDANSDALLRLEV 314

Query: 351 IAGVIEVFSRMDTLL 365
           +AGV EVFSRMDTLL
Sbjct: 315 VAGVFEVFSRMDTLL 329

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  477 bits (1227), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/315 (72%), Positives = 264/315 (83%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           KIAYDPEEAKL                       PTLTLMEEV+L+GL DK+GYLSFWND
Sbjct: 31  KIAYDPEEAKL-----------------KDDVTVPTLTLMEEVVLLGLGDKDGYLSFWND 73

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           NISY LRGCI+IELALR KIRILDD ARKRFDLSERL+EV DGSKTGEVLLDE LQLMKN
Sbjct: 74  NISYTLRGCIIIELALRNKIRILDDPARKRFDLSERLVEVVDGSKTGEVLLDEALQLMKN 133

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPL+IANWIDLLSGETWN  KINYQLKQVRER++KGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 134 DEPLSIANWIDLLSGETWNFFKINYQLKQVRERISKGLVDKGVLRTEMKNFFLFDMATHP 193

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           VTD+SCKEAIKRR+LS LVSR ME NYNEYFP+ T +K+IRTIALIC +Y ANVLENVLS
Sbjct: 194 VTDTSCKEAIKRRILSALVSRTMELNYNEYFPETTQYKVIRTIALICSSYAANVLENVLS 253

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           SL+YEK DNAIAR++ ++++F+++PF L+K ++  VS+NL++LV+ E+ +NPG  LQLE 
Sbjct: 254 SLEYEKRDNAIARSESILSEFAQYPFKLDKASDIKVSINLSKLVEDEIAQNPGSALQLEA 313

Query: 351 IAGVIEVFSRMDTLL 365
           +AGV +VFS+MD +L
Sbjct: 314 VAGVFDVFSKMDMIL 328

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  476 bits (1226), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 234/315 (74%), Positives = 261/315 (82%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           K+AYDPEE KL                       P LTLMEEVLL+GLRDKEGYLSFWND
Sbjct: 35  KVAYDPEEVKL-----------------TDNVEVPKLTLMEEVLLLGLRDKEGYLSFWND 77

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           NISYALRGCI+IELALRGKIR++DDSARKRFD+SERLIEV D SKTGEVLLDE LQLMK 
Sbjct: 78  NISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDSSKTGEVLLDEALQLMKC 137

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPL+I NWIDLLSGETWN +KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 138 DEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 197

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           VTD+SCKEAIKRR+LSVLV RN+E NYN+YF +   FK+IRTIALICGAY ANVLENVL+
Sbjct: 198 VTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTIALICGAYRANVLENVLT 257

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           SL YEK DNAI RADE++ QFS++PFDL+  T + +S+NLN+ V QEL ++P   LQLEV
Sbjct: 258 SLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKEVGQELQQHPESTLQLEV 317

Query: 351 IAGVIEVFSRMDTLL 365
           +AGV EVFSRMD LL
Sbjct: 318 LAGVFEVFSRMDMLL 332

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  474 bits (1220), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/315 (73%), Positives = 261/315 (82%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           KI YD +EAKL                       P LTLMEEVLLMGL+DK+GYLSFWND
Sbjct: 27  KIVYDEQEAKL-----------------RDNTSVPKLTLMEEVLLMGLKDKQGYLSFWND 69

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           NISYALRGCILIELALRGKIR +DD ARKR+D+SERLIEV DGSKTGEVLLDE+L LMKN
Sbjct: 70  NISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGEVLLDESLSLMKN 129

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           D P +I  WIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 130 DPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 189

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           +TD++CKE+IKRR+LS+LVSRN E  YN YFPQ+  FK IRT++LICGAYGANVLENVL+
Sbjct: 190 ITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGAYGANVLENVLA 249

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           +LDYE  D   ARADE++AQFS+FPF L+K T+T VSVNLN+ + QEL+ +PG DLQLEV
Sbjct: 250 TLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELNNHPGSDLQLEV 309

Query: 351 IAGVIEVFSRMDTLL 365
           +AGV EVFSRMDTLL
Sbjct: 310 VAGVFEVFSRMDTLL 324

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  464 bits (1194), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 223/315 (70%), Positives = 260/315 (82%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           ++AYDPEE K+                       P LTLMEEV+L+GLRDKEGYLSFWND
Sbjct: 37  RVAYDPEEDKI-----------------RNNMSVPQLTLMEEVVLLGLRDKEGYLSFWND 79

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           NISYALRGCI+IELALRGKIRILDD ARKRF+LSERL+EV D SKTGEVLLDE LQ+M+N
Sbjct: 80  NISYALRGCIIIELALRGKIRILDDPARKRFELSERLVEVVDSSKTGEVLLDEALQIMRN 139

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEPL I+NW+DLLSGETWN+ KINYQLKQVRER++KGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 140 DEPLAISNWVDLLSGETWNVFKINYQLKQVRERISKGLVDKGVLRTEMKNFFLFDMATHP 199

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           VTDSSCKEAIKRR+LS+LV+R  EF YN+YFP+ T FK IRTI+LIC AYGANVLENVL+
Sbjct: 200 VTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTSFKYIRTISLICSAYGANVLENVLN 259

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           SL+Y+K DN + RA+EL+ QFS++PFDLEK T    S+NLN LV++E++ +P   L LEV
Sbjct: 260 SLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGTSINLNALVKEEIEADPKNALFLEV 319

Query: 351 IAGVIEVFSRMDTLL 365
           +AGV EVFS+MD LL
Sbjct: 320 VAGVFEVFSKMDLLL 334

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  458 bits (1178), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 259/315 (82%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           K+AYDPE+ KL                       PTLTLMEEVLLMGL+DKEGYLSFWND
Sbjct: 36  KVAYDPEDQKL-----------------RENTKEPTLTLMEEVLLMGLKDKEGYLSFWND 78

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           +ISY+LRGCILIELALRGKIR+++D+ARKRFDLSERL+EV + SKTGE LLDETL LMK+
Sbjct: 79  SISYSLRGCILIELALRGKIRVVEDAARKRFDLSERLVEVIETSKTGEALLDETLSLMKS 138

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           +EPL+I NWIDLLSGETWN++KI+YQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 139 NEPLSIVNWIDLLSGETWNLLKISYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 198

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           V DSSCKE+IKRR+LSVLV RN+  +Y EYFP++  FK +RTIALICGAYGANVLENVLS
Sbjct: 199 VADSSCKESIKRRMLSVLVPRNVSLDYTEYFPESVAFKYLRTIALICGAYGANVLENVLS 258

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           SLDYEK +   +RA+E++ QFS++PF L+K   T +SVNL   V++E+ +NPG  LQLEV
Sbjct: 259 SLDYEKRERGFSRAEEILTQFSQYPFALDKDVETGISVNLYNQVKEEIGKNPGTGLQLEV 318

Query: 351 IAGVIEVFSRMDTLL 365
           +AGV EVFSRMD  L
Sbjct: 319 VAGVFEVFSRMDNFL 333

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  451 bits (1160), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 220/315 (69%), Positives = 252/315 (80%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           K+AYDPEE KL                       PTLTLMEEVLLMGL+DKEGYLSF N+
Sbjct: 34  KVAYDPEEQKL-----------------RENTREPTLTLMEEVLLMGLKDKEGYLSFLNE 76

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           NISYALRGCILIELALRG+I+++DD+ R+RFD SERLIEV DGSKTGE LLDE L LMK 
Sbjct: 77  NISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSKTGEALLDEALTLMKG 136

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
            EPLTI NW+DLLSGETWN +KINYQL+QVRERLAKGLVDKGVLRTEMKNFFLFDM THP
Sbjct: 137 SEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLRTEMKNFFLFDMPTHP 196

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           V D+SCKE+IKRR+LSVLV RN+E  Y E FP+   FK +RTIALIC A+GANVLE VLS
Sbjct: 197 VADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIALICSAHGANVLEKVLS 256

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           +LDYEK D   +RA+EL+ QFS++PF L+K   T +SVNLNRLVQ+ELD NPG  L LEV
Sbjct: 257 TLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQEELDRNPGTALNLEV 316

Query: 351 IAGVIEVFSRMDTLL 365
           +AGV++V+SRMD LL
Sbjct: 317 VAGVLKVYSRMDDLL 331

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  433 bits (1114), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 248/315 (78%), Gaps = 17/315 (5%)

Query: 51  KIAYDPEEAKLLXXXXXXXXXXXXXXXXXXXAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110
           K+A+DPEEAK+                       P LTLMEEV+L+GL D EGYLSFWND
Sbjct: 32  KVAFDPEEAKI-----------------KDDVSVPKLTLMEEVVLLGLGDSEGYLSFWND 74

Query: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170
           NISY LRGCILIELALRGKIRI+DDSARK FDLSERLIEV D SKTGEVLLDETLQLMKN
Sbjct: 75  NISYVLRGCILIELALRGKIRIIDDSARKSFDLSERLIEVIDASKTGEVLLDETLQLMKN 134

Query: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230
           DEP +I +WIDLLSGETWN  K+NYQLKQVRERL+KGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 135 DEPQSIVSWIDLLSGETWNFFKVNYQLKQVRERLSKGLVDKGVLRTEMKNFFLFDMATHP 194

Query: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290
           V DSSCKE++KRR++S LV R +   YNEYFP++T FK+IRT++LI  AY ANVLENVL+
Sbjct: 195 VADSSCKESLKRRIMSTLVDRTLSLQYNEYFPESTTFKVIRTVSLIITAYSANVLENVLN 254

Query: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350
           +L+YEK D A++RA+ L+  F  +PF L    +  +S+NLN+LV+ E+  NP   LQLEV
Sbjct: 255 TLEYEKRDKALSRAENLLNNFGNYPFKLVNEPDNRISINLNQLVEDEIKANPKTALQLEV 314

Query: 351 IAGVIEVFSRMDTLL 365
           +AGV +VF++MD ++
Sbjct: 315 LAGVFDVFAKMDVII 329

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  363 bits (933), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/276 (61%), Positives = 220/276 (79%)

Query: 90  MEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIRILDDSARKRFDLSERLIE 149
           MEEV+L+G+RDKEGYLSFWN+N+S+ LRGCILIELA RG I+++DD +RKRFDLS+RLIE
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 150 VKDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLV 209
           V +  KTGE LLDETLQ+MK++E  +I+ WIDLLSGETWNI KIN QLKQVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 210 DKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKI 269
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+R+LSVL+ +      +EYFP+    + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 270 IRTIALICGAYGANVLENVLSSLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVN 329
           +RTIALI  AY  +VLENV S LDY+K D+   R  E++ Q S +PF+ +  ++TN++ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 330 LNRLVQQELDENPGYDLQLEVIAGVIEVFSRMDTLL 365
           LN+LV+ EL ++   +L+LE IAGV EVF +MD+++
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  325 bits (834), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 153/284 (53%), Positives = 210/284 (73%), Gaps = 1/284 (0%)

Query: 83  VTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIRILDDSARKRFD 142
           + P L LMEE++L+GL+DK+GYLSFWNDNISY LRGCILIELALR KI+++DD  R  +D
Sbjct: 104 ILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKKIKVIDDPVRNMYD 163

Query: 143 LSERLIEV-KDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNIMKINYQLKQVR 201
           +S R+IEV    +KTG  LLDE L +M  + P +I NWIDLLSGETWN+ K N QLK VR
Sbjct: 164 VSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSGETWNVFKNNLQLKNVR 223

Query: 202 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSVLVSRNMEFNYNEYF 261
           ER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K+R+ S+LV ++    YN YF
Sbjct: 224 ERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYF 283

Query: 262 PQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNAIARADELIAQFSKFPFDLEKT 321
           P+N  FKIIR++ LIC AYGA+VL++ L +++Y+ SDNA  +A++L    S FP +L++ 
Sbjct: 284 PENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQR 343

Query: 322 TNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSRMDTLL 365
             + V V++ + +Q EL ++ G  L LEV+AGV++V  RMD+LL
Sbjct: 344 EGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  233 bits (593), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 124/285 (43%), Positives = 184/285 (64%), Gaps = 9/285 (3%)

Query: 84  TPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIRILDDSARKRFDL 143
           TP LTLM+E+ L+ L+DKEGY+S W+  +SY LR C++IELALRGKI+ + +  +K+ DL
Sbjct: 62  TPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-DL 120

Query: 144 S--ERLIEVKDGSKTGEVLLDETLQLMKNDEP-LTIANWIDLLSGETWNIMKINYQLKQV 200
           +  E  IEV DGS TG+ LLD+TL LMK ++   ++++WI LLSGE+ N +K +YQL  V
Sbjct: 121 APHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHV 180

Query: 201 RERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSVLVSRNMEFNYNEY 260
           R+R+ + LV+ G+L  + K      + THP+ D  CK AI+ R+  +L +  ++    +Y
Sbjct: 181 RKRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKY 240

Query: 261 FPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNAIARADELIAQFSKFPFDLEK 320
           FP    ++++RTI L C AYGA++L+      + E       RA  L++ FSKFPF+L  
Sbjct: 241 FPDTVSYRVLRTIVLACAAYGADILDKGFFQTENETVIGK-GRARVLLSLFSKFPFEL-- 297

Query: 321 TTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSRMDTLL 365
             N  V  +LN  V +EL E+P    QLEV+AG I+V + +DT+L
Sbjct: 298 --NQAVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7.39
           YOR353C
          Length = 891

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 128 GKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSG-E 186
           GK  + D  A K  DL++   +  D SK    +LDE LQL+ N++PL +  ++  +   +
Sbjct: 723 GKQVLTDSLASKIRDLTDTCCQAMDLSK----ILDERLQLLLNNDPLIVEKYLSTVEKLK 778

Query: 187 TWNIMKINYQLKQV 200
           TW   KIN  LK +
Sbjct: 779 TWE--KINAFLKSI 790

>ABL078C Chr2 complement(254921..255766) [846 bp, 281 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR200W
           (RPN10)
          Length = 281

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 6/113 (5%)

Query: 225 DMATHPVTDSSCKEAIKRRVL--SVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGA 282
           D    P    S KEAI R VL  +VLV  N E++ N  FP+  F   I  +  I  A  +
Sbjct: 11  DQTQVPSAGGSVKEAI-RMVLEATVLVVDNSEYSRNGDFPKTRFEAQIDAVEFIFQAKRS 69

Query: 283 NVLENVLSSLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQ 335
           +  EN +  +    S   +       A+F K    L  TT    S++L+  +Q
Sbjct: 70  SNPENTVGLISAAGSSPRVLST--FTAEFGKILAGLHDTT-VGGSIHLSTAIQ 119

>Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)
          Length = 517

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 49/131 (37%), Gaps = 18/131 (13%)

Query: 83  VTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIRILDDSARKR-- 140
           +TP L+  +          +  L F  DN+    RGC  + +     +RI+ D+  K+  
Sbjct: 128 LTPGLSSYDTDAAGAAESLDSLLDFAVDNVPLKARGCTPVAVRATAGLRIIGDAKSKKIL 187

Query: 141 ------------FDLSERLIEVKDGSKTGEVLLDETLQLMKN----DEPLTIANWIDLLS 184
                       F ++E  + + DG + G      T  L+KN       L  A   DL  
Sbjct: 188 TAVTNHLEKDYPFPIAEGSVSIMDGDEEGVFAWITTNYLLKNIGTEGAKLPTAAVFDLGG 247

Query: 185 GETWNIMKINY 195
           G T  + +  +
Sbjct: 248 GSTQIVFEPTF 258

>KAFR0B04380 Chr2 complement(907246..909531) [2286 bp, 761 aa] {ON}
           Anc_5.81 YGR245C
          Length = 761

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 55/111 (49%), Gaps = 2/111 (1%)

Query: 244 VLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNAIAR 303
           +L  LV R+ E  + E+  Q + ++ +R I ++ G   A+  ++ + S +   SDN+  +
Sbjct: 16  LLQNLVKRDPESYHEEFLQQYSHYESLRDIFMLNGMSAASGAQSSVESSETNTSDNSSTQ 75

Query: 304 ADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGV 354
             ELI   S+      K T  N +  L +L+ +     P Y+L+ ++I  +
Sbjct: 76  LIELIGFVSQVCSCFPKET-ANFTSELKQLLLEYHKTLP-YELKEKIITSL 124

>KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON}
           Anc_1.459 YJR035W
          Length = 1085

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 39/79 (49%), Gaps = 14/79 (17%)

Query: 283 NVLENVLSSLDYEKSD---------NAIARADELIAQFSKFPFDLEKTTN--TNVSVNL- 330
           ++LE  +S  D E SD           I++   L+ QF+K PFDL   T     + +NL 
Sbjct: 695 DILERFVSVNDPEFSDIRYLRMDGTTNISKRQNLVDQFNKGPFDLFLLTTRVGGLGINLT 754

Query: 331 --NRLVQQELDENPGYDLQ 347
             NR++  + D NP  DLQ
Sbjct: 755 GANRIIIFDPDWNPSTDLQ 773

>Skud_10.254 Chr10 (453258..456569) [3312 bp, 1103 aa] {ON} YJR035W
           (REAL)
          Length = 1103

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 7/66 (10%)

Query: 289 LSSLDYEKSDNA--IARADELIAQFSKFPFD--LEKTTNTNVSVNL---NRLVQQELDEN 341
           LS+L Y + D    I R   L+ QF+  PFD  L  T    + VNL   NR++  + D N
Sbjct: 713 LSNLRYLRMDGTTNIKRRQSLVDQFNNEPFDVFLLTTRVGGLGVNLTGANRIIIFDPDWN 772

Query: 342 PGYDLQ 347
           P  D+Q
Sbjct: 773 PSTDMQ 778

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,546,381
Number of extensions: 1310146
Number of successful extensions: 4385
Number of sequences better than 10.0: 42
Number of HSP's gapped: 4479
Number of HSP's successfully gapped: 42
Length of query: 365
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 254
Effective length of database: 40,753,473
Effective search space: 10351382142
Effective search space used: 10351382142
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)