Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B057105.441ON56354027480.0
NCAS0F034205.441ON52553814730.0
TDEL0D026005.441ON52349714600.0
ZYRO0F10186g5.441ON51954614480.0
Kpol_1062.255.441ON53348213031e-175
TBLA0A027905.441ON54749412991e-174
SAKL0G02684g5.441ON53948112511e-167
TPHA0E017205.441ON53748812111e-161
KAFR0E038105.441ON49047111241e-148
Skud_4.6405.441ON51148311131e-146
CAGL0A02904g5.441ON50150411111e-146
Ecym_45125.441ON52747011071e-145
Suva_2.5435.441ON51150711021e-145
Smik_4.6375.441ON51147710931e-143
KNAG0C048705.441ON45847110871e-143
YDR371W (CTS2)5.441ON51147910761e-141
KLLA0E02333g5.441ON48046010521e-138
ACL166W5.441ON49048010221e-133
KLTH0F15906g5.441ON5154819901e-128
Kwal_55.214025.441ON5164889621e-123
KAFR0D044901.504ON21578687.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05710
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...  1063   0.0  
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   572   0.0  
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   566   0.0  
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   562   0.0  
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   506   e-175
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   504   e-174
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   486   e-167
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   471   e-161
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   437   e-148
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   433   e-146
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   432   e-146
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   431   e-145
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   429   e-145
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   425   e-143
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   423   e-143
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   419   e-141
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   409   e-138
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   398   e-133
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   385   e-128
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   375   e-123
KAFR0D04490 Chr4 (886513..887160) [648 bp, 215 aa] {ON} Anc_1.50...    31   7.9  

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score = 1063 bits (2748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/540 (95%), Positives = 516/540 (95%)

Query: 24  QMCLTKLFFNSNKEKIVTDHYKXXXXXXXXXXXXXXXDDGNKKGQHHSHLFPQENDIVNY 83
           QMCLTKLFFNSNKEKIVTDHYK               DDGNKKGQHHSHLFPQENDIVNY
Sbjct: 24  QMCLTKLFFNSNKEKIVTDHYKNNNNNNNNNNNNNNNDDGNKKGQHHSHLFPQENDIVNY 83

Query: 84  PKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEW 143
           PKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEW
Sbjct: 84  PKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEW 143

Query: 144 SDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKFQN 203
           SDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKFQN
Sbjct: 144 SDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKFQN 203

Query: 204 FKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPG 263
           FKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPG
Sbjct: 204 FKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPG 263

Query: 264 KYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKLNILPIKE 323
           KYLEIVQRLRKRMDKLEHDIFQKSKISP         PKFELSVATPAFIEKLNILPIKE
Sbjct: 264 KYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNILPIKE 323

Query: 324 MNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAIN 383
           MNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAIN
Sbjct: 324 MNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAIN 383

Query: 384 YMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEPGMWLYNQL 443
           YMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEPGMWLYNQL
Sbjct: 384 YMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEPGMWLYNQL 443

Query: 444 PIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDH 503
           PIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDH
Sbjct: 444 PIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDH 503

Query: 504 KHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQIMSAM 563
           KHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQIMSAM
Sbjct: 504 KHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQIMSAM 563

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/538 (53%), Positives = 371/538 (68%), Gaps = 53/538 (9%)

Query: 24  QMCLTKLFFNSNK-EKIVTDHYKXXXXXXXXXXXXXXXDDGNKKGQHHSHLFPQENDIVN 82
           QMCL KL+F     + ++  H++                      Q   +L  Q N    
Sbjct: 27  QMCLHKLYFKQKATQDLIQSHFRNGTIPNR---------------QEIDYLMNQTNS--- 68

Query: 83  YPKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDE 142
                     ++SG+YYSSWSPYKPR+HFPHDIDLT+++H+YY+FFLV+  TG +  SDE
Sbjct: 69  -----NGEKGYLSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDE 123

Query: 143 WSDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKF- 201
           WSDL+MDLYKPLS+KL+ L+  D    ++   +L +     K++LPLGC+GELFYLK   
Sbjct: 124 WSDLQMDLYKPLSVKLHNLNLAD----NEKPVQLRD-----KRKLPLGCIGELFYLKHSG 174

Query: 202 -----QNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPE 256
                 + K+I+SIGGWSNR+ FP +VRD  K   FI+S+VE MF+YGFDGIDLDWEFP+
Sbjct: 175 IIPGGSSTKMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPK 234

Query: 257 DDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKL 316
           DDG EP KYLE++ +LR++MD LE +IF ++K            PKF+LSVATPAFI KL
Sbjct: 235 DDGLEPNKYLEMISKLRRKMDDLELEIFGETK----------DHPKFQLSVATPAFIYKL 284

Query: 317 NILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGL 376
           +ILPI +M++Y+DYWNMMTYDYYG WSE TGYHCNL+ G +     A YKHEHT+ N GL
Sbjct: 285 SILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLFNG-DGSEFRAGYKHEHTAHNNGL 343

Query: 377 NANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAG-EP 435
           NAN+AI++M+ + NV S K+VLG+AAYGR F  VK  +  +  IN+KF GVG    G EP
Sbjct: 344 NANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQGVDTLINQKFKGVGKGGLGDEP 403

Query: 436 GMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFW 495
           GMWLYNQLP+K + EM+DPNY +AFCYD K++TF+GYDNVD++K+KA+YVQ R L GGFW
Sbjct: 404 GMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFW 463

Query: 496 WESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLS 553
           WESCGDDH +  RSLL  F+N  EV  + K+ D  LI+ + + I YYLN +G DGFLS
Sbjct: 464 WESCGDDHINKRRSLLYNFSN--EVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLS 519

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/497 (54%), Positives = 364/497 (73%), Gaps = 35/497 (7%)

Query: 75  PQENDIVNYPKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGAT 134
           PQ+  +V  P   +    ++SG+YYS+WSPY PR HFPHDIDL++++H+YY+FFLV+GAT
Sbjct: 47  PQQAQLVTNPGTVEPGQ-YLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGAT 105

Query: 135 GDVTCSDEWSDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGE 194
           G +   DEWSD+ MDLYKP+++KLN L  N +V +D         +E+ ++ LP GC+GE
Sbjct: 106 GALKLGDEWSDVGMDLYKPMAIKLNKL--NPEVKND---------LERQRRILPNGCLGE 154

Query: 195 LFYLKK--------FQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFD 246
           LFY++          ++FK+IM +GGWSNRE FP MVR+  ++++FI+S +E MFKYGFD
Sbjct: 155 LFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFD 214

Query: 247 GIDLDWEFPEDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELS 306
           GIDLDWEFPEDDGFEP  YL++ +RL++RM++LE  IF  +             PKF+LS
Sbjct: 215 GIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPN----------MNHPKFQLS 264

Query: 307 VATPAFIEKLNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYK 366
           +ATPAF EKL+ILPI EM+KYID WNMMTYDY+G+WSE+TGYHCNLY G          K
Sbjct: 265 MATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFDETHQK 324

Query: 367 HEH-TSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFD 425
           H + T S +GL+A+ AI +ML    V+S K+ LG+AAYGRGFT V     D+ FI+K F 
Sbjct: 325 HIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFTNVVAQSTDKRFIDKPFH 384

Query: 426 GVGGASAGEPGMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYV 485
           GVGGAS GEPGMWLYNQLPI+ + E+FDP+YVS FCY   +KTFVGYD+V++++ KA+YV
Sbjct: 385 GVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFVGYDSVESVRFKAQYV 444

Query: 486 QDRHLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNY 545
           ++++LAGGFWWESCGDDH +  RSLLNAFTN  E+K + K++D  L+Y Q   ++YY+N 
Sbjct: 445 REKNLAGGFWWESCGDDHANQSRSLLNAFTN--EIKFVSKFDD--LMYRQTPVLRYYVNK 500

Query: 546 FGNDGFLSPFFIQIMSA 562
           FGND FLSPF + +++ 
Sbjct: 501 FGNDAFLSPFILNLLAG 517

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/546 (51%), Positives = 370/546 (67%), Gaps = 62/546 (11%)

Query: 24  QMCLTKLFFNSNKEKIVTDHYKXXXXXXXXXXXXXXXDDGNKKGQHHSHLFPQENDIVNY 83
           +MC  +  F S+ E  V DH                    ++ G      F   + ++  
Sbjct: 25  EMCFYRKIFKSSAEHDVLDHV-------------------HEVGDGSLQQFKDHHTVIG- 64

Query: 84  PKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEW 143
                 +  + SG+YYS WSPY PR HFPHDID +K++H+YY+FFL++G TG++  SDEW
Sbjct: 65  ------DEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEW 118

Query: 144 SDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK---- 199
           SD +MDLYKPL++KLN L               N+ +      LP GCVGELFYL+    
Sbjct: 119 SDFQMDLYKPLAVKLNQLQLK------------NDDVHASMGVLPKGCVGELFYLRHTGI 166

Query: 200 ----KFQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFP 255
               K ++FK++M++GGWSNR+ +P MVRD  ++  FI S VE MFKYGFDGIDLDWEFP
Sbjct: 167 LDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFP 226

Query: 256 EDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEK 315
           ++DGFEP  YLE+ +++R + D+LE  IF                PKF+LS+ATPAF +K
Sbjct: 227 QNDGFEPRMYLELARKMRLKFDELEEVIFAGEP----------NHPKFQLSMATPAFKDK 276

Query: 316 LNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKG 375
           LN+LPIKE+++YID WNMMTYDY+G+WS  TGYHCNLY+G     +++QYKH+ +S ++G
Sbjct: 277 LNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGPVK--VHSQYKHDSSSDDEG 334

Query: 376 LNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEP 435
           L+AN AI+ M+    V SRK+ LG+AAYGRGFT VK + ND+ FI+K F GVGGAS GEP
Sbjct: 335 LDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEP 394

Query: 436 GMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFW 495
           GMWLYNQLPIK SKE +DP YVS FC+D KTKTFVGYDNV+++KVKA YV++  L GGFW
Sbjct: 395 GMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFW 454

Query: 496 WESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPF 555
           WESCGD+H  P+RSLLNAFT +  +K + K E+S  +Y +P+ ++YYL  FG D FLSPF
Sbjct: 455 WESCGDNHIDPQRSLLNAFTGR--IKTIAKNENS--VYHKPEALRYYLEKFGQDEFLSPF 510

Query: 556 FIQIMS 561
            I+I+S
Sbjct: 511 IIRIIS 516

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  506 bits (1303), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 253/482 (52%), Positives = 327/482 (67%), Gaps = 38/482 (7%)

Query: 96  GVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYKPLS 155
           GVYYS+WSPY PR H PHD+D +++THVYY+FF+V+  TG +T SD WSD +MD YKPL+
Sbjct: 67  GVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLA 126

Query: 156 LKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKFQ--------NFKLI 207
           +KL  L Q D   +            K K  LP+GC+GELFYL+  Q         FKLI
Sbjct: 127 MKLKKL-QLDHFFN-----------PKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLI 174

Query: 208 MSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLE 267
           MS+GGWSNRE FP M+RD  KL+ F+ S +E MF YGFDGI+LDWEFP+DD  EP  YLE
Sbjct: 175 MSVGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLE 234

Query: 268 IVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKLNILPIKEMNKY 327
           +V++L+ + ++LE  IF  S             PKF LS+A PAF EKL+IL ++EM+ Y
Sbjct: 235 LVKKLKWKQNELEQKIFNNS-----GNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHY 289

Query: 328 IDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSN---------KGLNA 378
           +D WNMMTYDY+G+WSE+TGYH NLY        +         +            LN 
Sbjct: 290 VDVWNMMTYDYHGEWSEKTGYHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNG 349

Query: 379 NDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEPGMW 438
           + AINY++   +++ +K+ LG+AAYGRGFTKV  +  D  FINK + GVGGAS GEPGMW
Sbjct: 350 DYAINYVIKKYHINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMW 409

Query: 439 LYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWES 498
           LYNQLPIKNS E FDP+YVSAFCYD K+KTFVGYDN D+MKVKA+YV++ +L GGFWWES
Sbjct: 410 LYNQLPIKNSLEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWES 469

Query: 499 CGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQ 558
           CGDDHK+PE+SLLNAFT+++        E +  ++   + +KYYL   G+ GFLS F ++
Sbjct: 470 CGDDHKNPEKSLLNAFTDEIGSVT----EKNETMFTNIEVLKYYLKTKGDTGFLSTFIMK 525

Query: 559 IM 560
           ++
Sbjct: 526 LL 527

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  504 bits (1299), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 254/494 (51%), Positives = 333/494 (67%), Gaps = 52/494 (10%)

Query: 93  FVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYK 152
           + SGVYYS+WSPY PR HFPHDID ++I+HVYYSFFLVNG  G V   D+WSD++MDLYK
Sbjct: 77  YTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYK 136

Query: 153 PLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKFQ---------- 202
           PLS+KL  L     V  +       +T   +K  LP GC+GE FYL+  +          
Sbjct: 137 PLSIKLGKLKNKVDVYEEP------QTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENS 190

Query: 203 -NFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFE 261
            NFK+IM+IGGWSNR+ FP M +   K++ F+ S++E MF+YGFDGIDLDWEFP+++  E
Sbjct: 191 KNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQE 250

Query: 262 PGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKLNILPI 321
           P  YL+I+Q+LR+ M++LE +I++ S +             F+LSVA+PAF EKL++LPI
Sbjct: 251 PAVYLKIMQQLRQGMNELEEEIYKNSAVP------VEERKHFQLSVASPAFEEKLSVLPI 304

Query: 322 KEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDA 381
           KEMNK +DYWNMMTYDY G+WSE+TGYH NLY+G       ++ KH+       LNA+ A
Sbjct: 305 KEMNKVLDYWNMMTYDYNGEWSEKTGYHSNLYDG-------SKVKHDEEV----LNADSA 353

Query: 382 INYMLYNNNVSSRKLVLGLAAYGRGFTKVKVN--------------KNDELFINKKFDGV 427
           I YM+    V   KLVLGLA YGRG+T V VN                DE+FI+ ++ GV
Sbjct: 354 IKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGV 413

Query: 428 GGASAGEPGMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQD 487
           GG S GEPGMW+YNQLPIK S E FDP +VSA+CYD KT T V YDNV++M VK +YV+D
Sbjct: 414 GGESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKD 473

Query: 488 RHLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFG 547
           + LAGGF WESCGD H +P+RSL+ AFTN+L    + K E S  I++   T ++YL  FG
Sbjct: 474 KGLAGGFMWESCGDVHDNPKRSLITAFTNEL--GKIKKQESS--IFQDEKTFEFYLEEFG 529

Query: 548 NDGFLSPFFIQIMS 561
           N+G+LS    ++++
Sbjct: 530 NEGYLSEAIAKLLN 543

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  486 bits (1251), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 244/481 (50%), Positives = 323/481 (67%), Gaps = 43/481 (8%)

Query: 90  NNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMD 149
           + +++SGVYY++WSPY PR HFPHD++  +IT+V+YSFF+V+  +G V  SDEWSD +MD
Sbjct: 86  SQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMD 145

Query: 150 LYKPL--SLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK-------- 199
           LYK      K   L  +       +K          K+ LP+GC+GELFYLK        
Sbjct: 146 LYKKFYPQFKAALLSSSSSSTFQSHK----------KEMLPMGCIGELFYLKYSSILPSL 195

Query: 200 ----KFQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFP 255
                 +NFK+ MS+GGWSNR+ FP +VRD NK + FI + VE MF+YGFDG+D+DWEFP
Sbjct: 196 HGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFP 255

Query: 256 EDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEK 315
           ++DG EP  YL +++RLR+ +D LE DIFQ    S            F L+VA PAF EK
Sbjct: 256 QNDGLEPKMYLTMIRRLREALDDLERDIFQDEHHSE----------HFFLTVAVPAFKEK 305

Query: 316 LNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKG 375
           L +LP+++M+ Y+D+WN+M YDY+G+WSE TGYH NLY   +N      ++ E       
Sbjct: 306 LQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQ---- 361

Query: 376 LNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEP 435
           LNA+ A+ Y+L N  ++SRK+VLG+AAYGRGFT+VK   N   +I K ++GVGGAS GEP
Sbjct: 362 LNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGEP 421

Query: 436 GMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFW 495
           GMWLYNQLP+  + E FDP  VSA+ +DPK+KTFVGYDNVD+M+ KA+YV++ +LAGGFW
Sbjct: 422 GMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFW 481

Query: 496 WESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPF 555
           WESCGD+HK  ++SLLNAFTN L    L K + S  IY     I+YYL  +   GFLS  
Sbjct: 482 WESCGDNHKDEQKSLLNAFTNDL--GSLAKQQPS--IYTSAHVIRYYLKNYPQ-GFLSRV 536

Query: 556 F 556
           F
Sbjct: 537 F 537

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  471 bits (1211), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 236/488 (48%), Positives = 328/488 (67%), Gaps = 36/488 (7%)

Query: 87  GKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDL 146
           G  N+ +  GVYYS+WSPY PR  FPHDID ++++HVYYSF LV+G  G +  SD WSD 
Sbjct: 72  GTENSLYSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDF 131

Query: 147 KMDLYKPLSLKLNTLHQN-DKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK------ 199
           ++D+YKPL L L  +  + D V            I   K+ LP+GC+GE FYL+      
Sbjct: 132 QIDMYKPLYLSLGQVDNDFDSV-----------PISMKKELLPMGCIGEFFYLRNTRIPI 180

Query: 200 ---KFQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPE 256
              K  +FK+ MS+GGWSNRE FP MVRD  K+++FI S ++ MF YGFDGIDLDWEFPE
Sbjct: 181 HGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPE 240

Query: 257 DDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKL 316
           DDGFEP  YL+I++RL+ +M +LE  I+ K  IS          P FELS+A PAF EKL
Sbjct: 241 DDGFEPMMYLDIIKRLKMKMLELEATIY-KDAIS-----HNTSYPHFELSIAAPAFDEKL 294

Query: 317 NILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGN-NGTINAQYKHEHTSSNKG 375
            ILP+++M+K++D WNMMTYDY G+WS+ TGYH NL+   + +G++    K   ++SN+ 
Sbjct: 295 RILPVQQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPPDVSGSV---MKRSQSNSNET 351

Query: 376 LNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEP 435
           L  ++A+ YM  N  +SSRK++LG+AAYGRGF+ V  +K +     KKF+GV G+S  EP
Sbjct: 352 LCGDNAVKYMKDNLKISSRKIILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEP 411

Query: 436 GMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFW 495
           G+WLYN+LPIK SKE FD   VSA+CYDPK+K FV YDN  +M +K+KYV+D +L GGF 
Sbjct: 412 GVWLYNKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFL 471

Query: 496 WESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPF 555
           WE+CG+   +P+ SL+N+FT   ++ ++ K +    ++     ++YYL  +G  GFLS +
Sbjct: 472 WEACGEKLNNPKLSLINSFT--FDMNNIDKQKS---MFSNRKVLEYYLMKYGKQGFLSGY 526

Query: 556 FIQIMSAM 563
            + +++ M
Sbjct: 527 ILSVLNRM 534

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  437 bits (1124), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 221/471 (46%), Positives = 293/471 (62%), Gaps = 48/471 (10%)

Query: 90  NNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMD 149
           N +F  G+YYS+WS Y+PR HFPH+I+   I+HVYY+FFLV+G  G +   D+W+D +  
Sbjct: 55  NRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRP 114

Query: 150 LYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKFQNFKLIMS 209
           + K           N+K++                     G VGELF LK     K IM 
Sbjct: 115 ILK-----------NNKLVK--------------------GNVGELFDLKMKNRVKCIMC 143

Query: 210 IGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLEIV 269
           IGGWSNRE +     D +K+  F E +V+ MF+YGFDGIDLDWE+PEDDG EP  YLEI+
Sbjct: 144 IGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIM 203

Query: 270 QRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKLNILPIKEMNKYID 329
           +R++  M+KLE +IF+ +  +            FELSVATPAF +KL I P+KEM+  ID
Sbjct: 204 RRIKHHMNKLESEIFKDTSATTSY---------FELSVATPAFKDKLEIFPLKEMDTVID 254

Query: 330 YWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAINYMLYNN 389
           YWNMMTYDYYG+WSE TGYH NLY+G    T          S  +GLN + A+ YM+ N 
Sbjct: 255 YWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMI-NQ 313

Query: 390 NVSSRKLVLGLAAYGRGFTKVKVNK----NDELFINKKFDGVGGASAGEPGMWLYNQLPI 445
            +   K++LG+AAYGRGFT V V          +I + FDGVGGAS GEPGMW Y+QLPI
Sbjct: 314 GIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPI 373

Query: 446 KNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDHKH 505
             + E FDP YVS +C++P T TFVGYD +D+++VK +Y++ + + GGFWWESCGD HK+
Sbjct: 374 PGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKN 433

Query: 506 PERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFF 556
           PERSL+NA+  +L   ++ K E    IY+    + +Y   F   GFLS + 
Sbjct: 434 PERSLVNAYVKELGRDNIKKPES---IYKNLHCVSHYKQSFHGKGFLSKYL 481

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  433 bits (1113), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 224/483 (46%), Positives = 307/483 (63%), Gaps = 59/483 (12%)

Query: 93  FVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYK 152
           +VSGVYYS+WSPY PR+HFPHDI+L +++HVYY+FF +N  TG +  +D WSDL+M+LYK
Sbjct: 73  YVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYK 132

Query: 153 PLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKF---QNFKLIMS 209
           PL++K + L +N+          LN++++ +   LPLGCVGELFYLK     + FK+IMS
Sbjct: 133 PLAIKSSQLVENN----------LNDSVQNI---LPLGCVGELFYLKNACSEKKFKVIMS 179

Query: 210 IGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLEIV 269
           IGGWS+ E+F ++V DD  L  F++SSVE MFK GFDGID+DWEFPE++  EP  YL++V
Sbjct: 180 IGGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLV 239

Query: 270 QRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKLNILPIKEMNKYID 329
           + LR +++ LE  IF +S               F++S+A PAF +KL  LPI E+++YID
Sbjct: 240 KMLRLKLNNLESQIFGES-----------IEDHFQISIAAPAFKDKLFFLPISEIDQYID 288

Query: 330 YWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAINYMLYNN 389
           YWNMMTYDYYG WSE TGYH NL+                  S   L+ N A++YM+   
Sbjct: 289 YWNMMTYDYYGSWSETTGYHSNLF------------------SETELSGNFAMHYMIDEF 330

Query: 390 NVSSRKLVLGLAAYGRGF----TKVKVNKNDELFINKKFDGVG------GASAGEPGMWL 439
           +V S KLVLG+AAYGR F    +K +    + + IN+ F GVG        + G+ G+W 
Sbjct: 331 SVDSSKLVLGMAAYGRSFHIKDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWP 390

Query: 440 YNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESC 499
           Y  LP K + E +DP YVSA+C+D K   F+ YDN  + K KA+YV    L GGFWWESC
Sbjct: 391 YKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESC 450

Query: 500 GDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQI 559
           G+ H +  RSL+NAF   +      K      +++    IK+YLN +G+DGFLSP+   +
Sbjct: 451 GEAHTNKSRSLINAFNEGIRFNVSSKPS----MFQDMRVIKFYLNKYGDDGFLSPYLKHL 506

Query: 560 MSA 562
            S+
Sbjct: 507 ESS 509

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  432 bits (1111), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 229/504 (45%), Positives = 312/504 (61%), Gaps = 49/504 (9%)

Query: 65  KKGQHHSHLFPQENDIVNYPKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVY 124
           ++ Q   +  P E+D++       +N ++++G+YYS+WSPY+PR HFPHDID  K++H+Y
Sbjct: 36  RRSQSDDYRMP-ESDVL-------SNTSYIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIY 87

Query: 125 YSFFLVNGATGDVTCSDEWSDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMK 184
           Y+F L++  TG++T SDEWSD +++L K     +      D++   K  T +        
Sbjct: 88  YAFLLIDPETGNLTSSDEWSDTQLNLAKQCREYMFKRFTGDEL---KAVTNI-------- 136

Query: 185 KQLPLGCVGELFYLK------KFQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVE 238
            + P GC+GEL YL+      K +N KLIMS+GGWSNRE FP MVRD+ K   FI S +E
Sbjct: 137 -RAPPGCIGELNYLRYIYSKIKKRNVKLIMSVGGWSNRESFPIMVRDELKFKNFINSCIE 195

Query: 239 QMFKYGFDGIDLDWEFPEDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXX 298
            M  YGFDGIDLDWEFPEDD +EP  YL + + L+ ++ KLE +I               
Sbjct: 196 TMVYYGFDGIDLDWEFPEDDSYEPDAYLRMARELKLQLQKLEANILGDHS---------- 245

Query: 299 XXPKFELSVATPAFIEKLNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNN 358
               F+LS+ATPAF +KL+ILPI +++KYID WN+MTYDYYG+WSE TG H NLY     
Sbjct: 246 -NKTFQLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYDYYGEWSERTGLHANLYN--EK 302

Query: 359 GTINAQYKHEHTSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKV-NKNDE 417
           G +   ++H+    + GL+ + AINYM+    +  RK++LG+AAYGRGFT V + + N  
Sbjct: 303 GKLLHLHRHD---EDAGLSGDAAINYMVNRCKIDPRKVILGMAAYGRGFTNVDMKSTNPH 359

Query: 418 LFINKKFDGVGGASAGEPGMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDT 477
                KF GVGGAS GEPGMWLYNQLPI  S E +D  +V A+CYD +T T VGYDN  +
Sbjct: 360 NPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYCYDDRTHTLVGYDNPTS 419

Query: 478 MKVKAKYVQDRHLAGGFWWESCGDDHKHPERSLLNAFTNQLE-VKHLMKYEDSHLIYEQP 536
           +  KA Y+    L G FWWESCGD HK+P+RSLLN +   +  VK+     +   IY   
Sbjct: 420 VIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVIRNVKN-----NKETIYSTT 474

Query: 537 DTIKYYLNYFGNDGFLSPFFIQIM 560
               YYL  +  +GFL+ F   I+
Sbjct: 475 KLHDYYLENYDTNGFLTGFIKDII 498

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  431 bits (1107), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 229/470 (48%), Positives = 304/470 (64%), Gaps = 50/470 (10%)

Query: 93  FVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYK 152
           +  GVYY+SWSPY+PR HFPHDID  ++T+V Y+FF+V+  TG V  +D WSDL+M  + 
Sbjct: 63  YAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHA 122

Query: 153 PLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK--KFQNFKLIMSI 210
           P                                Q   G +GEL YLK  +  NF+L M++
Sbjct: 123 P-----------------------------GIPQGVTGMIGELNYLKLQRNTNFRLFMAV 153

Query: 211 GGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLEIVQ 270
           GGWSNRE FP +VR + KL  F+ S+++ MF+YGFDGIDLDWEFP+DDG+EPG YLE+  
Sbjct: 154 GGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCS 213

Query: 271 RLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKLNILPIKEMNKYIDY 330
           RLR +MDKLE +I+  +             PKFELSVATPAF + L ILPI EMNK++  
Sbjct: 214 RLRSKMDKLEDEIWGANNTD---------YPKFELSVATPAFSQTLKILPIIEMNKFVSI 264

Query: 331 WNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEH--TSSNKGLNANDAINYMLYN 388
           WNMMTYD++G WS+ TGYH NLY+G  N     + + E      N+GLNA+DAI  M+ N
Sbjct: 265 WNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVEN 324

Query: 389 NNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEPGMWLYNQLPIKNS 448
             V ++K+ LG+ AYGRGFT V+   +D+L +NKK+ GVGG S GEPG+WLYNQLP+ N+
Sbjct: 325 FKVHAKKVRLGMPAYGRGFTNVQTKDDDDL-LNKKYSGVGGGSEGEPGIWLYNQLPLANT 383

Query: 449 KEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDHKHPER 508
            E FD  +VSA+C+D   KTFVGYDN+ +M+VK+ YV+ +HL+GGF+WESCGD H  P+R
Sbjct: 384 AEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKR 443

Query: 509 SLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQ 558
           +L+ AF+ +L    +        I++ P  I YYL +    GFL   F Q
Sbjct: 444 NLVRAFSQELSEMRI------PTIFKDPRAIAYYLKH-RQKGFLYSLFSQ 486

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  429 bits (1102), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 230/507 (45%), Positives = 313/507 (61%), Gaps = 61/507 (12%)

Query: 68  QHHSHLFPQENDIVNYPKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSF 127
           Q+  H  P   ++V   K    ++ +VSGVYYS+WSPYKPR+HFPHDI+L +++HVYY+F
Sbjct: 51  QNGRHQVP---NMVQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAF 107

Query: 128 FLVNGATGDVTCSDEWSDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQL 187
           F ++  TG +  +D WSDL+MDLYKPL++K + L   D  L D N          M+  L
Sbjct: 108 FRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQL--VDDNLDDNN----------MQSIL 155

Query: 188 PLGCVGELFYLKKF---QNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYG 244
           PLGC+GELFYLK     + FK IMSIGGWS+ E+F ++V+++  L  F++SSVE MFK G
Sbjct: 156 PLGCIGELFYLKNACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLG 215

Query: 245 FDGIDLDWEFPEDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFE 304
           FDGID+DWEFPE++  EP  YL++V+ LR +++ LE  IF  S               FE
Sbjct: 216 FDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGS-----------TKDHFE 264

Query: 305 LSVATPAFIEKLNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQ 364
           LS+A PAF +KL  LPI E+++YID+WNMMTYDYYG WSE TGYH NL+           
Sbjct: 265 LSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLF----------- 313

Query: 365 YKHEHTSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGF----TKVKVNKNDELFI 420
                  S   L+ N AI+YM+    V+ RKLVLG+AAYGR F     K +    + + I
Sbjct: 314 -------SETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFTKNTVLI 366

Query: 421 NKKFDGVGGA------SAGEPGMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDN 474
           N++F GVG        + G+ G+W Y  LP K + E +DP YVSA+C+D K   F+GYDN
Sbjct: 367 NQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGYDN 426

Query: 475 VDTMKVKAKYVQDRHLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYE 534
            +++K KA YV    L GGFWWESCG+D+    RSL+NAF   L      K      +++
Sbjct: 427 TESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPS----MFQ 482

Query: 535 QPDTIKYYLNYFGNDGFLSPFFIQIMS 561
               +KYYL+ +G+ GFL+P+   + S
Sbjct: 483 DKRVMKYYLSKYGDGGFLAPYLKHLES 509

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  425 bits (1093), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 221/477 (46%), Positives = 301/477 (63%), Gaps = 59/477 (12%)

Query: 93  FVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYK 152
           FVSGVYYS+WSPYKPR+HFPHDI+LT+++HVYY+FF +N  TG +  +D WSDL+M+LYK
Sbjct: 73  FVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYK 132

Query: 153 PLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK---KFQNFKLIMS 209
           PL++K          L D N +        ++K LPLGC+GELFYLK     + FK+IMS
Sbjct: 133 PLAIK-------SSELIDGNSSN------DIQKILPLGCIGELFYLKHSCSGKKFKVIMS 179

Query: 210 IGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLEIV 269
           IGGWS+ E+F  +++++N L  F++SSVE MFK GFDGIDLDWEFPE++  EP  YL++V
Sbjct: 180 IGGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLV 239

Query: 270 QRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKLNILPIKEMNKYID 329
           + LR +++ LE  IF +                F+LS+A PAF +KL  LPI E+++YID
Sbjct: 240 RMLRSKLNSLESQIFGEG-----------VEDHFQLSIAAPAFKDKLYYLPIPEIDQYID 288

Query: 330 YWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAINYMLYNN 389
           YWNMMTYDYYG WSE TGYH NL+                  S   L+ N AI+YM+   
Sbjct: 289 YWNMMTYDYYGSWSETTGYHSNLF------------------SETELSGNFAIHYMIDKF 330

Query: 390 NVSSRKLVLGLAAYGRGF----TKVKVNKNDELFINKKFDGVG------GASAGEPGMWL 439
            ++SRKLVLG+AAYGR F    +  +    + + IN+ F GVG        + G+ G+W 
Sbjct: 331 GINSRKLVLGMAAYGRSFHIKGSGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWP 390

Query: 440 YNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESC 499
           Y  LP K + E +DP YVSA+C+D K   F+ YDN  ++K KA+YV    L GGFWWESC
Sbjct: 391 YKNLPKKGTIERYDPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESC 450

Query: 500 GDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFF 556
           G+ + +  RSL++AF   L      K      ++E    + +YLN +GN+GFL+P+ 
Sbjct: 451 GETYANESRSLIHAFNEGLRSNVSTKPS----MFENERVVNFYLNKYGNNGFLTPYL 503

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  423 bits (1087), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 222/471 (47%), Positives = 297/471 (63%), Gaps = 63/471 (13%)

Query: 89  TNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKM 148
            N  +VSGVYYS WSPY+PR HFP +ID +KITH+YYSFFLV+  +  +   D WSD++M
Sbjct: 47  VNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEM 106

Query: 149 DLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKFQ-NFKLI 207
            + K   LK                                GC+G L  L+  +  FK I
Sbjct: 107 PMGKNTVLK--------------------------------GCIGALNSLRDEKPGFKNI 134

Query: 208 MSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLE 267
           M++GGWSN++ FP  +R  + + +  +S VE MF+YGFDGIDLDWE+P+DDG EP  YLE
Sbjct: 135 MAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLE 194

Query: 268 IVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKLNILPIKEMNKY 327
           +++++R+ M++LE  I+   K             +F LSVATPAF +KL   PIKEM++Y
Sbjct: 195 LMRKIRQHMNELEIAIWGDKK------------RRFHLSVATPAFYDKLETFPIKEMDQY 242

Query: 328 IDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAINYMLY 387
           IDYWNMMTYDYYG+WS  TG+H NLY+G N  +       EH+     L A+ AI YM  
Sbjct: 243 IDYWNMMTYDYYGEWSSGTGFHSNLYDGTNKFS-------EHS-----LCADGAIRYMTN 290

Query: 388 NNNVSSRKLVLGLAAYGRGFTKVKVN--KNDELFINKKFDGVGGASAGEPGMWLYNQLPI 445
              ++SRK+VLG+A YGRGFT VK    K     IN+KF GVGG S GEPGMWLYNQLPI
Sbjct: 291 KIGINSRKVVLGMALYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPI 350

Query: 446 KNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDHKH 505
           + ++E+FD  Y SA+C+DPKTKT VGYDNVD+ + KA+YV+  +LAGGFWWESCG+   +
Sbjct: 351 RGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDN 410

Query: 506 PERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFF 556
            ++SL++ F   +E   L + E +  +Y+ P   ++YL  F   GFL+  F
Sbjct: 411 VQQSLVHVFNEDIE--RLDRNETN--LYQDPKLREHYLQIFAKSGFLAATF 457

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  419 bits (1076), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 222/479 (46%), Positives = 301/479 (62%), Gaps = 61/479 (12%)

Query: 92  TFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLY 151
            F+SGVYYS+WSPYKPR+HFPHDI+L +++H+YY+FF +N  TG +  +D WSDL+M+LY
Sbjct: 72  AFISGVYYSNWSPYKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLY 131

Query: 152 KPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKF---QNFKLIM 208
           K L++K      N +++    K   N +++ +   LPLGC+GELFYLK     + FK+IM
Sbjct: 132 KSLAIK------NSELI----KESSNNSVQNI---LPLGCIGELFYLKNTCSDKKFKVIM 178

Query: 209 SIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLEI 268
           SIGGWS+ E+F  +++DD  L  F++SSVE MF+ GFDGIDLDWEFP ++  EP  YL++
Sbjct: 179 SIGGWSDSENFKIIIKDDKLLQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKL 238

Query: 269 VQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKLNILPIKEMNKYI 328
           V+ LR +++ LE  IF K                F+LS+A PAF +KL  LPI E+++Y+
Sbjct: 239 VRMLRLKLNSLESQIFGKR-----------TEDHFQLSIAAPAFKDKLFYLPITEIDQYV 287

Query: 329 DYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAINYMLYN 388
           DYWNMMTYDYYG WSE TGYH NL+                  S   LN N A++YM+  
Sbjct: 288 DYWNMMTYDYYGSWSETTGYHSNLF------------------SETELNGNFAMHYMIDR 329

Query: 389 NNVSSRKLVLGLAAYGRGFTKVKVNK-----NDELFINKKFDGVGGASA------GEPGM 437
             V+SRKLVLG+AAYGR F  +K NK      + + INK F GVG  +       G+ G+
Sbjct: 330 FGVNSRKLVLGMAAYGRSF-HIKDNKFEPFNQNTVLINKIFKGVGKPTKEIDKADGKEGI 388

Query: 438 WLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWE 497
           W Y  LP   + E +DP YVSA+C+D K   F+ YDN  ++K KA+YV   +L GGFWWE
Sbjct: 389 WPYKNLPKIGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVTHNNLGGGFWWE 448

Query: 498 SCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFF 556
           SCG+ + +  RSL+NAF   L      K      I++     KYYLN +G+ GFLSP+ 
Sbjct: 449 SCGEAYANESRSLINAFNEGLHFNVSSKPS----IFQDVRVKKYYLNKYGDGGFLSPYL 503

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  409 bits (1052), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/460 (46%), Positives = 290/460 (63%), Gaps = 53/460 (11%)

Query: 62  DGNKKGQHHSHLFPQENDI-VNYPKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKI 120
           D  KKG       P E D     P  G   + F    YYS+WSPY  R H P DI  +++
Sbjct: 36  DKIKKGGSAGRRPPTEIDPDTRVPSEGP--DGFSVATYYSNWSPYNARNHKPADIPTSQL 93

Query: 121 THVYYSFFLVNGATGDVTCSDEWSDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETI 180
           THVYY+FF+V+  +G V  SD WSD ++    PLS+ +                      
Sbjct: 94  THVYYAFFVVDAKSGAVKSSDSWSDFEL----PLSVGVK--------------------- 128

Query: 181 EKMKKQLPLGCVGEL--FYLKKFQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVE 238
                    GC+ EL    L+    FK I+ +GGWSNRE +  + + + K+ +FIE++V+
Sbjct: 129 ---------GCIKELQKIKLESKHEFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAVD 179

Query: 239 QMFKYGFDGIDLDWEFPEDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXX 298
            MF+YGFDGIDLDWEFPE+D  EP  YLE+++ +R+ MD+LE  IF     SP       
Sbjct: 180 CMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFG----SPAEEKDH- 234

Query: 299 XXPKFELSVATPAFIEKLNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNN 358
             P F+LSVATPAF EKLNILPI EM+KY+D WNMM YD++G+WS+ TGYH NLY  G++
Sbjct: 235 --PHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGHS 292

Query: 359 GTINAQYKHEHTSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDEL 418
                +    +  SN  L+++ A+  M   +N+SSR++ LG+AAYGRGFT V+ N  D+ 
Sbjct: 293 ----HRRSLSNRISNSSLSSDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVETN--DDN 346

Query: 419 FINKKFDGVGGASAGEPGMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTM 478
           ++ KK+ GVGG S GEPG+WLYNQLPI  SKE FD N VSA+C+DPK++TFVGYDNV +M
Sbjct: 347 YLGKKYHGVGGGSEGEPGIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSM 406

Query: 479 KVKAKYVQDRHLAGGFWWESCGDDHKHPERSLLNAFTNQL 518
            +K KY++ ++L GGFWWESCGD  K P +SL+NAF+ ++
Sbjct: 407 DIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEI 445

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  398 bits (1022), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 226/480 (47%), Positives = 298/480 (62%), Gaps = 55/480 (11%)

Query: 84  PKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEW 143
           P     +  +  GVYYSSWSPYKPR H+P +ID  ++THVYY+FF+V+  TG +   D+W
Sbjct: 54  PDAPYPDGEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKW 113

Query: 144 SDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKF-- 201
           SD KM    P++L       N                         G +GEL YLK    
Sbjct: 114 SDTKM----PMNLTGMPRGLN-------------------------GAIGELNYLKTRPG 144

Query: 202 QNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFE 261
            +FKL+M++GGWSNRE F  +VRD+ K N FI+S+++ MF+YGFDGIDLDWEFP+DDG+E
Sbjct: 145 TDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYE 204

Query: 262 PGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKLNILPI 321
           P  YLE+  RLR +MD+LE +I+     +          P+F LS+A PAF + L I P+
Sbjct: 205 PQMYLEMCSRLRHKMDELEDNIWGPGGTT---------EPRFHLSMAAPAFPQTLGIFPV 255

Query: 322 KEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTIN----AQYKHEHTSSNKGLN 377
           +EMNKY+  WNMMTYDY+G WSE TGYH NLY   N+   +     +Y+     +   LN
Sbjct: 256 EEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELN 315

Query: 378 ANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEPGM 437
           A+DAI  M     VS RK+ LG+AAYGRGFT V+   + E  I +K+ GVGG S GEPGM
Sbjct: 316 AHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVR--GDGEQLIGQKYSGVGGGSEGEPGM 373

Query: 438 WLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWE 497
           WLYNQLP+ +  E FD  +VSA+ YDP TKT V YDNVD+MK+K +YV+D+ LAG F WE
Sbjct: 374 WLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWE 433

Query: 498 SCGDDHKHPERSLLNAFTNQLE-VKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFF 556
           SCGD+ K  +R+L+ AFT  ++  +    Y+DS L       I+YYL     +GFL P +
Sbjct: 434 SCGDNFKDKDRNLVEAFTENMKGARKATAYKDSKL-------IQYYLRT-RPEGFLVPMY 485

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  385 bits (990), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 212/481 (44%), Positives = 285/481 (59%), Gaps = 55/481 (11%)

Query: 93  FVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYK 152
           FV+G+YYS+WSPY  R HFPHDID  K+THVYY+F +VN  TG+   SDEWSD++MDLYK
Sbjct: 71  FVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYK 130

Query: 153 PLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK------------K 200
            +      L    +                 K +LPLGC+GELF+LK             
Sbjct: 131 QMISSFKKLDLRAQFPTGS------------KDKLPLGCIGELFFLKYSNFLTRNGGSAG 178

Query: 201 FQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGF 260
             NFK IMS+GGWSNRE F S+V    KL  F++S V +MF+YGFDGID+DWEFP++D  
Sbjct: 179 VNNFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAK 238

Query: 261 EPGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFIEKLNILP 320
           EP  YL++++ LR+R+D LE  IF                  F L+ A  A  E L  LP
Sbjct: 239 EPKVYLQMLKALRERLDTLESQIFGSKD----------HKHHFALTSAISADEECLKYLP 288

Query: 321 IKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNAND 380
           ++E ++Y+DYWN+M YD+ G WS +T Y  NLY            K    S+N   +A+ 
Sbjct: 289 LQEADRYVDYWNLMAYDFSGAWSAQTAYQSNLY---------TPAKTNKRSTNGRGSADK 339

Query: 381 AINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVN-KNDELFINKKFDGVGGASAGEPGMWL 439
           A+ ++   + ++S+K+VLG+ AYGRGF  V+V+ K+ E  I K F  V G+S GE G+ L
Sbjct: 340 AVRFLTDKSKLASKKIVLGMPAYGRGFKGVEVSHKSIENVIGKPFQDVSGSSEGEEGISL 399

Query: 440 YNQLPIKNSKEMFDPNYVSAFC----YDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFW 495
           Y QLP+K   E FD N VSA+C    ++ K    + YDNVD+M  KA YV+  HL GGFW
Sbjct: 400 YKQLPLKGGMEFFDHNAVSAYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFW 459

Query: 496 WESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPF 555
           WESCG+D+K   +SL+ AFT   E+K L K E +  IY  P+ +++YL      GFL+  
Sbjct: 460 WESCGEDYKG--KSLVGAFTK--EIKCLNKTEPT--IYSLPEVVQHYLK-LHPGGFLAST 512

Query: 556 F 556
           F
Sbjct: 513 F 513

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  375 bits (962), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/488 (42%), Positives = 284/488 (58%), Gaps = 52/488 (10%)

Query: 86  LGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSD 145
           L  +     SG+YYS+WSPYK R HFPHDID  ++T V+YSF +VNG TG+   SDEWSD
Sbjct: 64  LISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSD 123

Query: 146 LKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK------ 199
           ++MDLYK +    +   + D        +R           LPLGC+GELFYLK      
Sbjct: 124 VQMDLYKQM---FSAFEKVDLKRQFPQSSR---------NDLPLGCIGELFYLKYTDFLS 171

Query: 200 ------KFQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWE 253
                   +NFK IMS+GGWSNRE F S+V+   K+  FI S V+QMFKYGFDGID+DWE
Sbjct: 172 KMGGPEDVKNFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWE 231

Query: 254 FPEDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPXXXXXXXXXPKFELSVATPAFI 313
           FP++D  EP  YL++++ LRK++D LE DIF   K              F L+ A  A  
Sbjct: 232 FPKNDSTEPKAYLDMMRSLRKKLDDLESDIFGTEK----------HTQHFLLTSAISADP 281

Query: 314 EKLNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSN 373
             L  LP+ E+++Y+D WN+M YD+ G WS  T Y  NLY   + G        + + ++
Sbjct: 282 SCLEYLPLGEIDRYVDQWNLMAYDFSGAWSRHTAYQSNLYSRSSLG--------KRSENS 333

Query: 374 KGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDEL-FINKKFDGVGGASA 432
           +G +A+ A+  +L  + + ++K+VLG+ AYGRGF  V V  + E   I + F  V G S 
Sbjct: 334 EGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVSGLSE 393

Query: 433 GEPGMWLYNQLPIKNSKEMFDPNYVSAF----CYDPKTKTFVGYDNVDTMKVKAKYVQDR 488
           GE G+ LYNQLP+K  +E FD + VSA+      + +    V YDNV +MK+KA+YV   
Sbjct: 394 GESGISLYNQLPLKGGQEWFDQDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKN 453

Query: 489 HLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGN 548
           +L GGFWWESCG+++    RSL  AFT   E+K+L K   +  IY  P   +YY   +  
Sbjct: 454 NLGGGFWWESCGENYLDNSRSLTRAFTQ--EIKYLNKTVPT--IYALPQVGEYYHKKY-P 508

Query: 549 DGFLSPFF 556
           DGFL+   
Sbjct: 509 DGFLASII 516

>KAFR0D04490 Chr4 (886513..887160) [648 bp, 215 aa] {ON} Anc_1.504
           YJR057W
          Length = 215

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 32/78 (41%), Gaps = 7/78 (8%)

Query: 190 GCVGELFYLKKFQ----NFKLIMSIGGWSNREHFPSMVRDDNK---LNQFIESSVEQMFK 242
           G + E    K FQ       L+ S   W  +E+    +  D K   +++++ S +     
Sbjct: 46  GLINEYLTNKSFQMPDQTIHLLFSSNRWERQEYIEKTLVTDKKHIVMDRYVYSGIAYSLA 105

Query: 243 YGFDGIDLDWEFPEDDGF 260
              DG+D DW F  D G 
Sbjct: 106 KEVDGMDFDWCFGCDKGL 123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,572,873
Number of extensions: 3261366
Number of successful extensions: 9539
Number of sequences better than 10.0: 39
Number of HSP's gapped: 9688
Number of HSP's successfully gapped: 43
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)