Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B057005.438ON1041045494e-74
NCAS0F034105.438ON1061034107e-53
CAGL0A02882g5.438ON1041033837e-49
KNAG0C048805.438ON1041043811e-48
TDEL0D026305.438ON1021043699e-47
Kwal_55.214145.438ON1191033622e-45
Kpol_1016.35.438ON971033472e-43
ZYRO0F10120g5.438ON1051023463e-43
Kpol_1016.3asingletonON971033421e-42
SAKL0G02618g5.438ON1041043239e-40
KLLA0E02267g5.438ON1031043056e-37
KLTH0F15972g5.438ON1031033031e-36
Ecym_45095.438ON1031052934e-35
ACL169W5.438ON1031052734e-32
TPHA0C00950singletonON991042701e-31
KAFR0D02490singletonON107952032e-21
TBLA0C05870singletonON1001001806e-18
KAFR0D02400singletonON114941624e-15
KAFR0D02500singletonON112941423e-12
TDEL0B070702.614ON17773651.0
NDAI0E014408.637ON89230613.8
TDEL0E055304.46ON90647605.9
Ecym_53682.202ON118230597.2
KLTH0A01848gna 1ON45324597.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05700
         (104 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   216   4e-74
NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     162   7e-53
CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   152   7e-49
KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   151   1e-48
TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   146   9e-47
Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   144   2e-45
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   138   2e-43
ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   137   3e-43
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   136   1e-42
SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   129   9e-40
KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   122   6e-37
KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   121   1e-36
Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   117   4e-35
ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   109   4e-32
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                108   1e-31
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      83   2e-21
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    74   6e-18
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                67   4e-15
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      59   3e-12
TDEL0B07070 Chr2 complement(1246994..1247527) [534 bp, 177 aa] {...    30   1.0  
NDAI0E01440 Chr5 complement(285903..288581) [2679 bp, 892 aa] {O...    28   3.8  
TDEL0E05530 Chr5 (1020490..1023210) [2721 bp, 906 aa] {ON} Anc_4...    28   5.9  
Ecym_5368 Chr5 (750046..753594) [3549 bp, 1182 aa] {ON} similar ...    27   7.2  
KLTH0A01848g Chr1 complement(158347..159708) [1362 bp, 453 aa] {...    27   7.8  

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  216 bits (549), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104
           QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK
Sbjct: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  162 bits (410), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 75/103 (72%), Positives = 82/103 (79%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           MVEWCVI+ DK GSDRSAF  QH A IPALVEQGK+VC GAIYNEP  EG  PT AGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPK 103
           Q++ADTKEE + +V  DIFAKEGIWD DN IIYRF  A+R PK
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPK 103

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  152 bits (383), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 70/103 (67%), Positives = 80/103 (77%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           MVEWCVI+ DK GSDRS    QH AGIP LVE GK+VC GAIYNEP + GG  T AGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPK 103
           Q+VADTKEE +ELV  D+FAK GIWD++N IIY+F  A+R PK
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  151 bits (381), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 82/104 (78%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           MVEWC ++ DK GSDRS F  +H A IP LV+QGK+VC GAIYNEPT  GG+ T AGSHL
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104
           Q+VADTKEE +E++  D+FAKEGIWD+ N I+Y+F  A+R PKK
Sbjct: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
           Anc_5.438
          Length = 102

 Score =  146 bits (369), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           MVEW VI+ DK   DRSAF   H AGIP LVEQGK+VC GAIYNEPT  GG  T AGSHL
Sbjct: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104
           Q+VADTKEE +E+VK DIFAKEG+WD+DN IIY+F  A+R  KK
Sbjct: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  144 bits (362), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 79/103 (76%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           MVEWCVI+ DKKGSDRS F   H  GIP LVE+GK+VC GAIY + + EG     AGSHL
Sbjct: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPK 103
           Q+VADTKEE +E+VK D+FAKEGIWD++N IIY F  A+R PK
Sbjct: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  138 bits (347), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 79/103 (76%), Gaps = 6/103 (5%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           MVEWCVIINDKKGSDRS    QH AGIP LVEQGK+ C GAIYN+      + + AGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYND------DGSFAGSHL 54

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPK 103
           Q+VADTKE+ +E+VK D+FA  GIWD+D+ IIY+F  A+R PK
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQPK 97

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserved
           hypothetical protein
          Length = 105

 Score =  137 bits (346), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 78/102 (76%), Gaps = 2/102 (1%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           MVEW VI  DK  +DRSA+ S+H AGIP  VE GK+VC GAIYNEP   G   T AGSHL
Sbjct: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLP 102
           QVVADTKEE +E+VK DIFAKEG+WD+DN I+Y+F  A+R P
Sbjct: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQP 100

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score =  136 bits (342), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (77%), Gaps = 6/103 (5%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           M EWC+IINDKKGS+RS   SQHFAGI  LVEQG + CGGAIYN+      + +VAGSHL
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYND------DGSVAGSHL 54

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPK 103
           Q+VADTKE+ +E+VK D+FA  GIWD+D+ +IY+F  A+R PK
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQPK 97

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  129 bits (323), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 76/104 (73%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           MVEWCV++ DK  +DRS F   H AGIP LVEQGK+VC GAI+NE  +EG     AGS L
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104
            +VAD+KEE + +VK D+FAKEGIWD++N +I+ F  A+R  KK
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  122 bits (305), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 75/104 (72%), Gaps = 1/104 (0%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           MVEW VI+ DK GSDRSA   QH AGIP LVE GK+V  GAIY +   +G     AGSHL
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKD-VVDGKPANFAGSHL 59

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104
            +VAD+K+EV+EL+K D+FAK  IWDVDNA+IY F  A+R  K+
Sbjct: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  121 bits (303), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 73/103 (70%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           MVEWCVI+ DKKGSDRSA    H  G+    E+G +VC GAIY+E   +G     AGSHL
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPK 103
           Q+ A+TKE+ +++VK DIFAKEGIWD++N IIY F  A+R  K
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  117 bits (293), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 76/105 (72%), Gaps = 3/105 (2%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPT-VAGSH 59
           MVEWCV + DK GSDRS + S H   IP LV++GK+V  GAIY +  +  G P   AGSH
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVD--GKPGGFAGSH 58

Query: 60  LQVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104
           L +VADT+EEV+EL+K DI+AKEG+WD+DN +I+ F  A+R  K+
Sbjct: 59  LILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  109 bits (273), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPT-VAGSH 59
           MVEWC II DK G DRS    +H A IP LVEQGK+V  GAIY E  +  G P+  AGS 
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVD--GRPSQFAGSQ 58

Query: 60  LQVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104
           L +VAD++EE + +++ D FAK G+WDV+N ++Y F  A+R  K+
Sbjct: 59  LTLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score =  108 bits (270), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 76/104 (73%), Gaps = 8/104 (7%)

Query: 1   MVEWCVIINDKKGSD--RSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGS 58
           M E+ V+I D  G++  R     +HF  IP LV+ G VVCGGA++NE     G+P   GS
Sbjct: 1   MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNEE----GSPV--GS 54

Query: 59  HLQVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLP 102
           H+Q+VAD++E+V+E++KKD+FA+E +WD+++AIIY+FD A+R P
Sbjct: 55  HIQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRKP 98

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}
          
          Length = 107

 Score = 82.8 bits (203), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 6/95 (6%)

Query: 1  MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
          M EW V + DK  +DR+ +N +H A +P L E+  +V  GA+       G N    GS  
Sbjct: 1  MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGALI------GDNGKEVGSSF 54

Query: 61 QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRF 95
          QVVA++KE+ + ++K DIFAKEG++++D+ + YRF
Sbjct: 55 QVVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 73.9 bits (180), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 56/100 (56%), Gaps = 6/100 (6%)

Query: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
           M EW V I D   SDR+    +H   +P L+  G + CGGA+ ++      N  + GSH 
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDD------NGNMIGSHF 54

Query: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALR 100
           ++  +TKEE M+L+ +D F K G+WD+++  I +F    R
Sbjct: 55  ELKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHR 94

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 67.0 bits (162), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 6/94 (6%)

Query: 1  MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
          M EW V + D K  DR+ +  +H   +P+LV+ G +V  GA+    T EG      G   
Sbjct: 1  MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGALT---TPEGKE---IGGMF 54

Query: 61 QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYR 94
           V A TKEE +E+VK+D+FA++GI+++D+    R
Sbjct: 55 IVTAKTKEEAIEIVKRDVFARKGIFNMDSVTCER 88

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}
          
          Length = 112

 Score = 59.3 bits (142), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 6/94 (6%)

Query: 1  MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60
          M EW V I D +G+DR+ +  +H   +  L ++  +V  GA+    T EG      G  L
Sbjct: 1  MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGAL---TTPEGKE---TGGIL 54

Query: 61 QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYR 94
           + A TKEE +E+VK+D+FA++GI+ +D     R
Sbjct: 55 IIAAKTKEEAIEVVKRDVFARKGIFKMDTITCER 88

>TDEL0B07070 Chr2 complement(1246994..1247527) [534 bp, 177 aa] {ON}
           Anc_2.614 YKL069W
          Length = 177

 Score = 29.6 bits (65), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 30  LVEQGKVVCGGAIYNEPTEEGGNPTVAGSHLQVVADTKEE-VMELVKKDIFAKEGIWDVD 88
           ++  GK VCG A   + T+   + T A  H+    DTK E V+ ++         + D+D
Sbjct: 90  MIPFGKGVCGTAASTQETQLVPDVTKAADHIACDGDTKSEIVIPIIDPQTKKTLAVIDID 149

Query: 89  NAIIYRFDAALRL 101
           +     FD   RL
Sbjct: 150 SVDTNGFDEVDRL 162

>NDAI0E01440 Chr5 complement(285903..288581) [2679 bp, 892 aa] {ON}
           Anc_8.637 YOR217W
          Length = 892

 Score = 28.1 bits (61), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 2/30 (6%)

Query: 58  SHLQVVADTKEEV--MELVKKDIFAKEGIW 85
           SHLQ VAD  E +   +LV+K I + E +W
Sbjct: 638 SHLQAVADAAESISAADLVEKKIRSSEQLW 667

>TDEL0E05530 Chr5 (1020490..1023210) [2721 bp, 906 aa] {ON} Anc_4.46
           YLR309C
          Length = 906

 Score = 27.7 bits (60), Expect = 5.9,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 58  SHLQVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104
           +H Q ++  KEEV +L+KK+  A E + D++ A I R    + + K+
Sbjct: 214 THEQFISSHKEEVSDLIKKNDDAAESVADME-AEIERLQKEIEIKKE 259

>Ecym_5368 Chr5 (750046..753594) [3549 bp, 1182 aa] {ON} similar to
           Ashbya gossypii AER411W
          Length = 1182

 Score = 27.3 bits (59), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 18/30 (60%)

Query: 49  EGGNPTVAGSHLQVVADTKEEVMELVKKDI 78
           +  NPT +G H  V+ D +   ++LV KD+
Sbjct: 577 KNANPTYSGEHETVITDRRRTRVKLVVKDL 606

>KLTH0A01848g Chr1 complement(158347..159708) [1362 bp, 453 aa] {ON}
           conserved hypothetical protein
          Length = 453

 Score = 27.3 bits (59), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 4/24 (16%)

Query: 46  PTEEGGNPTVAGSHLQVVADTKEE 69
           P + GGNPT  GSHL    DT+ E
Sbjct: 99  PGKNGGNPTATGSHL----DTQPE 118

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,230,204
Number of extensions: 413294
Number of successful extensions: 982
Number of sequences better than 10.0: 29
Number of HSP's gapped: 971
Number of HSP's successfully gapped: 29
Length of query: 104
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 30
Effective length of database: 44,996,115
Effective search space: 1349883450
Effective search space used: 1349883450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)