Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B056905.437ON42342322740.0
NCAS0F034005.437ON41539711521e-156
KAFR0E038205.437ON3963899181e-120
YDR370C5.437ON4423938851e-115
Skud_4.6395.437ON4423898791e-114
Smik_4.6365.437ON4463948701e-113
Suva_2.5425.437ON4423898571e-111
ZYRO0F10098g5.437ON3733877342e-93
TDEL0B021805.437ON4183867373e-93
SAKL0G02596g5.437ON4003796606e-82
Kpol_1016.45.437ON4133876163e-75
CAGL0A02860g5.437ON4023615851e-70
KLTH0F15994g5.437ON3903835701e-68
KNAG0C048905.437ON4053845642e-67
Kwal_55.214155.437ON3893775604e-67
TPHA0J026005.437ON4413945522e-65
TBLA0A028005.437ON4533804992e-57
AER404C5.437ON3863804383e-49
KLLA0E02245g5.437ON4033753702e-39
Kpol_380.83.570ON379236910.010
ZYRO0A10538g5.252ON608159920.010
KAFR0J001603.570ON380192840.083
CAGL0C01925g3.570ON40091840.090
AFR263C3.570ON376269830.11
AFR262CsingletonON775230790.37
TDEL0D063803.570ON378188780.45
TPHA0G036503.570ON377235760.80
NDAI0I032603.570ON37757750.85
KLLA0E12893g3.570ON38459741.3
Kwal_47.192763.570ON386193741.4
TDEL0E011204.258ON669199732.0
SAKL0F00726g3.570ON383153712.9
NDAI0B055205.414ON1009111723.2
Skud_7.213.570ON38960694.8
Suva_7.153.570ON38960695.8
YGL246C (RAI1)3.570ON38759686.0
Smik_7.153.570ON38759686.1
NCAS0E002403.570ON38059686.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05690
         (423 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   880   0.0  
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   448   e-156
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   358   e-120
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   345   e-115
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   343   e-114
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   339   e-113
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   334   e-111
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   287   2e-93
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   288   3e-93
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   258   6e-82
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   241   3e-75
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   229   1e-70
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   224   1e-68
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   221   2e-67
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   220   4e-67
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   217   2e-65
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   196   2e-57
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   173   3e-49
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   147   2e-39
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    40   0.010
ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} simila...    40   0.010
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    37   0.083
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    37   0.090
AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON} S...    37   0.11 
AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON} S...    35   0.37 
TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON} Anc_3...    35   0.45 
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    34   0.80 
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     33   0.85 
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    33   1.3  
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    33   1.4  
TDEL0E01120 Chr5 (229597..231606) [2010 bp, 669 aa] {ON} Anc_4.2...    33   2.0  
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    32   2.9  
NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_...    32   3.2  
Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON} Y...    31   4.8  
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    31   5.8  
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    31   6.0  
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    31   6.1  
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    31   6.8  

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/423 (100%), Positives = 423/423 (100%)

Query: 1   MTTSTKPYDFTNLSRELNAVKEETNASKEVITAPPITTIPFKQFKHCSISTYPKTPSSFF 60
           MTTSTKPYDFTNLSRELNAVKEETNASKEVITAPPITTIPFKQFKHCSISTYPKTPSSFF
Sbjct: 1   MTTSTKPYDFTNLSRELNAVKEETNASKEVITAPPITTIPFKQFKHCSISTYPKTPSSFF 60

Query: 61  ETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLANPSCSLNEARDLKLPYLGSDLYDGYE 120
           ETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLANPSCSLNEARDLKLPYLGSDLYDGYE
Sbjct: 61  ETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLANPSCSLNEARDLKLPYLGSDLYDGYE 120

Query: 121 SFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNKFTIVSARHHIVEMTMCIFNKRKMD 180
           SFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNKFTIVSARHHIVEMTMCIFNKRKMD
Sbjct: 121 SFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNKFTIVSARHHIVEMTMCIFNKRKMD 180

Query: 181 DFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKDGVVRKISYSGFALEDLLTTNKNDHNA 240
           DFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKDGVVRKISYSGFALEDLLTTNKNDHNA
Sbjct: 181 DFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKDGVVRKISYSGFALEDLLTTNKNDHNA 240

Query: 241 DNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNH 300
           DNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNH
Sbjct: 241 DNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNH 300

Query: 301 RRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNY 360
           RRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNY
Sbjct: 301 RRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNY 360

Query: 361 NAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQSFQIRINASRAIQIKKLKSVPNNVTMY 420
           NAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQSFQIRINASRAIQIKKLKSVPNNVTMY
Sbjct: 361 NAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQSFQIRINASRAIQIKKLKSVPNNVTMY 420

Query: 421 CKK 423
           CKK
Sbjct: 421 CKK 423

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  448 bits (1152), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 214/397 (53%), Positives = 287/397 (72%), Gaps = 15/397 (3%)

Query: 35  PITTIPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLA 94
           PIT +PF +F H SIS +P     F+E+S  VALYHN +LY +   ++IP L+  IA+L 
Sbjct: 22  PITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQL- 80

Query: 95  NPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLG 154
            P  S +EAR LK  YLGSDLYDG+E+F+PM   +LDS+EPC  +I+ WE +    Y+ G
Sbjct: 81  -PKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPG 139

Query: 155 NKFTIVSARHHIVEMTMCIF--------NKRKMDDFILNVTYKGGSNGMLLFSRDVNKKD 206
            KF IVS RHHIVEMTM +F        N +K+ D++LNV Y G   G LLF++D +   
Sbjct: 140 RKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKDWSNTG 199

Query: 207 DG---GIYSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLN 263
           +    GIYSK+ ++++I YSGFALEDL+T   ++   +   +T  GG+KAVFA++ENKL+
Sbjct: 200 NSMNEGIYSKNIILKRICYSGFALEDLMTETTSELEKEGEKLT--GGEKAVFAVVENKLD 257

Query: 264 DDISLLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGI 323
           DDI +LLRCE+D++N   K FTE+KCF+ LKM+N +HRRKLLKAWVQTGV+P+SDILIGI
Sbjct: 258 DDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGI 317

Query: 324 RDPMFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDES 383
           RD  FGEL D+EW+SR  L  +INNRNLPE+K+D N+NA++A QWSQHCI+SICKLVDE+
Sbjct: 318 RDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDEN 377

Query: 384 IDKTRLNTSQSFQIRINASRAIQIKKLKSVPNNVTMY 420
           +D+  ++  Q FQIRI++ R I+IK L  VP ++  Y
Sbjct: 378 LDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDILEY 414

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  358 bits (918), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 182/389 (46%), Positives = 264/389 (67%), Gaps = 28/389 (7%)

Query: 35  PITTIPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDT--NLIPQLEPAIAK 92
           PI + PFK+F+H SI+ +P  P++FF+ S++VA YH+ ++Y  ++T  +++P L   I+K
Sbjct: 27  PIVS-PFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPLLNKDISK 85

Query: 93  LANPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQ 152
           +A    ++ +AR  K+ Y+GSDLY G+E+F  M  +ELDS  PCF YI+ WE  +   Y 
Sbjct: 86  IAQGVSAI-DARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYT 144

Query: 153 LGNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNK--KDDGGI 210
              K+TIVSARHHIV + M IF+  K  + I+N TY G  NG+L FS+D +     + GI
Sbjct: 145 ENKKYTIVSARHHIVNLIMSIFDTSK--ETIVNSTYLG--NGLLTFSQDTSDPMTMNEGI 200

Query: 211 YSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLL 270
           ++K+  ++KI YSGFALEDLLT ++ +                +F+I EN+L+D+I+LLL
Sbjct: 201 FTKNKNLKKICYSGFALEDLLTKSQKE---------------PLFSITENQLDDNITLLL 245

Query: 271 RCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGE 330
           RCEMD+YN + + +TE+KC+A LKM +  HR+KLLK W+QTGV+P+SD++ GIR P  GE
Sbjct: 246 RCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGE 305

Query: 331 LNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLN 390
           L DIEW+SR  LYR+ NNRNLPE K  LN+NA IAV+WS HCIK+IC+L+    D  + +
Sbjct: 306 LLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELIS---DNLQGD 362

Query: 391 TSQSFQIRINASRAIQIKKLKSVPNNVTM 419
             Q+FQI+++  R I I+ L  +P N  +
Sbjct: 363 APQAFQIKVDTFRNISIRNLSKIPQNAQI 391

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  345 bits (885), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 181/393 (46%), Positives = 259/393 (65%), Gaps = 19/393 (4%)

Query: 34  PPITTIPFKQFKHCSISTY-PKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAK 92
           P +  IP+  F H  +  +  K P   F  SK+VAL+ N + Y+    +LIP L+ +IA+
Sbjct: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAE 120

Query: 93  LANPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQN-KHDY 151
           L     SL EA+  K+PYLG DL+   + F+PM   ELDS+ PCF YIE+W L N   D+
Sbjct: 121 LY--ESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDF 178

Query: 152 QLGNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDD---G 208
           ++G KFT+V+ RHHIV++TM +FN+R     ++ VTY G   G+L F R+V K       
Sbjct: 179 KIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLI-VTYMGA--GLLSFCRNVKKDSQMSKE 235

Query: 209 GIYSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKA-VFAIIENKLNDDIS 267
           GIYS D  ++KI YSGF  E+ +T        +NS V  + G K  +F+++E+KL+++I 
Sbjct: 236 GIYSNDPNMKKICYSGFEFENWVT--------ENSKVADLTGSKCPIFSLVESKLSEEIG 287

Query: 268 LLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPM 327
           LL+RCEMD++NPV++  TE+KCFA L M+N NHRRKLLK WVQTG++PNSDI+IG+RD  
Sbjct: 288 LLIRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSH 347

Query: 328 FGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKT 387
            G+L DI+W+SR  L ++ N+  LP  K +LNYNA+IAV+W  +CI++ICKLV+ +I   
Sbjct: 348 SGQLLDIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDY 407

Query: 388 RLNTSQSFQIRINASRAIQIKKLKSVPNNVTMY 420
                +SF+I I+ + AI I KLK+ P NV ++
Sbjct: 408 SSTKPESFEIGIDTNNAIVITKLKTTPRNVELF 440

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  343 bits (879), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 178/389 (45%), Positives = 255/389 (65%), Gaps = 21/389 (5%)

Query: 39  IPFKQFKHCSISTYP-KTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLANPS 97
           +P+  F H SI     K P   F+ SK+VAL+ N Q Y++   +LIP L   I +L    
Sbjct: 66  VPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITELYE-- 123

Query: 98  CSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNK-HDYQLGNK 156
            SL EAR  K+PYLG DL+   + F+PM   ELDSI PC  Y+E+W+L N   ++++G K
Sbjct: 124 SSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKK 183

Query: 157 FTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDD-----GGIY 211
           FTIVSARHHIV++TM  F++R     ++ VTY G   G++ FSR  N K+D      GIY
Sbjct: 184 FTIVSARHHIVDLTMHRFDRRNKRKSLI-VTYMGA--GLISFSR--NPKNDFQMSKEGIY 238

Query: 212 SKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLR 271
           S D  ++KI YSGF  E  +T        D     L G    +F+++E+KL++DI LL+R
Sbjct: 239 SSDPNMKKICYSGFEFEHWVT-------EDIKATDLNGPKHPIFSVVESKLSEDIGLLMR 291

Query: 272 CEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGEL 331
           CE+D++NPV++  TE+KCF  L M+N NHR+KLLK W+QTG++PNSDI+IG+RD   G+L
Sbjct: 292 CEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQL 351

Query: 332 NDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNT 391
            DI+W+SR +LY++ N+  LP +K +LN+NA++AV+W  HCIKSIC+LV+ +I       
Sbjct: 352 LDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTR 411

Query: 392 SQSFQIRINASRAIQIKKLKSVPNNVTMY 420
            +SF++ I+A+  I I KL +VP NV ++
Sbjct: 412 PESFEVSIDANGTIAITKLNTVPKNVELF 440

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  339 bits (870), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 178/394 (45%), Positives = 256/394 (64%), Gaps = 21/394 (5%)

Query: 34  PPITTIPFKQFKHCSISTYP-KTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAK 92
           P  T + +  F H  +  +P K P   F  SK+VAL+ N Q Y++   +++P L+  IA+
Sbjct: 61  PKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAE 120

Query: 93  LANPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNK-HDY 151
           L   S  L +AR+ KLPYLG DL+     F+PM   ELDSI PC  YIE+W L N   D+
Sbjct: 121 LCERS--LLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDF 178

Query: 152 QLGNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDG--- 208
           ++G KFT+V+ RHHIV+MTM +F++R     ++  TY G   G++ FSR  N+K+D    
Sbjct: 179 KIGRKFTVVTTRHHIVDMTMHLFDRRNKKRSLV-ATYMGA--GLISFSR--NQKNDSRMS 233

Query: 209 --GIYSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDI 266
             GIYS D  ++KI YSGF  E+ +T  +    AD     L G    VF+++E+KL+++I
Sbjct: 234 KEGIYSSDPNMKKICYSGFEFENWVT--EGIKAAD-----LNGSKLPVFSVVESKLSEEI 286

Query: 267 SLLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDP 326
            LL+RCEMD++NPV+   TE+KCFA L M+N NHRRKLLK W+QTG+ PNSDI+IG+RD 
Sbjct: 287 GLLIRCEMDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDS 346

Query: 327 MFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDK 386
             G+L DI+W+SR +L  + N+  LP  K +LNYNA++AV+W  HCIKSIC+L+  +I  
Sbjct: 347 HSGQLLDIQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISD 406

Query: 387 TRLNTSQSFQIRINASRAIQIKKLKSVPNNVTMY 420
                 +SF+I I+++  I I KLK++P +V ++
Sbjct: 407 YSCKNPESFEISIDSNNTIAITKLKNIPKHVELF 440

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  334 bits (857), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 173/389 (44%), Positives = 247/389 (63%), Gaps = 17/389 (4%)

Query: 37  TTIPFKQFKHCSISTYP-KTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLAN 95
           T +P+  F H SI  +P K P   F  SK+VAL+ + QLY +   ++IP L+  I+ L  
Sbjct: 64  TRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISHLY- 122

Query: 96  PSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNK-HDYQLG 154
               L EAR LK  YLG DL+   +  +PM   ELD+I PC  YIE W L N    +++G
Sbjct: 123 -ESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIG 181

Query: 155 NKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDV---NKKDDGGIY 211
            KFT+V+ RHHIV++TM  F++R     I+  TY G  NG +  SR+    +K    GIY
Sbjct: 182 KKFTVVTTRHHIVDLTMHPFDRRNKQKSII-ATYMG--NGFISLSRNPKYDHKASKEGIY 238

Query: 212 SKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLR 271
           S D  ++KI +SGF  E+ LT N  +  +  S          VF+I+E KL++DI LL+R
Sbjct: 239 SGDPNIKKICHSGFEFENCLTENTKNSGSSASKC-------PVFSIVEGKLSEDIGLLMR 291

Query: 272 CEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGEL 331
           CEMD++NPV+K  TE+KCF  L M N +HR+KLLK W+QTG++PNSDI++G+RD   G+L
Sbjct: 292 CEMDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQL 351

Query: 332 NDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNT 391
            DI+W+SR  L+R+ N+  LP  K ++NYNA++AV+W +HCIKSIC LV+ +I +   N 
Sbjct: 352 LDIQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNK 411

Query: 392 SQSFQIRINASRAIQIKKLKSVPNNVTMY 420
            + F+I I+A+  I I KL ++P NV ++
Sbjct: 412 PEPFEINIDANGTIIITKLSTIPRNVEIF 440

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  287 bits (734), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 153/387 (39%), Positives = 234/387 (60%), Gaps = 32/387 (8%)

Query: 36  ITTIPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLAN 95
           + ++PF QF+H S   +P  P + F   K+ + Y+  QL+ S   ++          L +
Sbjct: 13  LPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSI---------GLKS 63

Query: 96  PSCSLNEARDL--KLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQL 153
           P   L+  R    K  +LGSDLY G+E F+P+ P+ LDS   C+++I  WE  N   Y  
Sbjct: 64  PGNKLSHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQ 123

Query: 154 GNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSK 213
            + F ++S RH++VE+TM +F + K   + +  T+ G  +G ++ S+  N K      S+
Sbjct: 124 RSPFVVISPRHYLVELTMQLFQQSK---YSILCTHLG--DGKIVLSQVENDKKSHQHTSR 178

Query: 214 DGVV-RKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRC 272
           +  + +KI +SG+ALEDLLT                  D   FAIIE +L+ +ISL+LRC
Sbjct: 179 NTTMTKKILHSGYALEDLLTRGPRVE------------DDPFFAIIEAELDANISLVLRC 226

Query: 273 EMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELN 332
           E+DSYN + + FTE+KC+A L M+N  HR KLLK W+Q  + P  D+LIG+R+   G L 
Sbjct: 227 ELDSYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQ 286

Query: 333 DIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTS 392
           D+++F+   LYR+IN+RNLP++    NYNA++AVQW QHCI+SICKLV E++D++   + 
Sbjct: 287 DLQYFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRS---SP 343

Query: 393 QSFQIRINASRAIQIKKLKSVPNNVTM 419
           Q F++ I+ S  IQ++KLK VP +V +
Sbjct: 344 QCFKLTIDESHKIQLEKLKHVPAHVEL 370

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  288 bits (737), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 154/386 (39%), Positives = 228/386 (59%), Gaps = 27/386 (6%)

Query: 39  IPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTN--LIPQLEPAIAKLANP 96
           IPF +F+H  +  +P   + FFE  ++VA Y N  L+  D +   L P L+   A +A  
Sbjct: 50  IPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMKDSSKKPLYPCLQMFAALIAE- 108

Query: 97  SCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNK 156
               N     KLPY+G DLY G+E + P+   ELDS   CF+YI+ WE +         K
Sbjct: 109 ----NRGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGK 164

Query: 157 FTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKDGV 216
            TI+S RHH+V++ M +F+  ++     N+       G L+FS D +K++  G+ SK+ +
Sbjct: 165 VTIISPRHHVVDLVMALFHDDEVSIICTNI-----GKGKLIFSGDRSKEERNGLNSKNSM 219

Query: 217 VRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDS 276
            RKI YSGFALED LTT+ ++                 ++I+E K+N+ +SLLLRCEMD+
Sbjct: 220 TRKICYSGFALEDKLTTSHDERMG------------PFYSIVEGKINERLSLLLRCEMDA 267

Query: 277 YNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEW 336
           YNP+   +TE+KCF +L + +  HRRKLLK WVQ G+IP+SD++IG RD   G+L D+ W
Sbjct: 268 YNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTW 327

Query: 337 FSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDE---SIDKTRLNTSQ 393
           +SR +LY++ NN ++      LN+NA IAV+W  HCI+SIC LV +   S         +
Sbjct: 328 YSRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYE 387

Query: 394 SFQIRINASRAIQIKKLKSVPNNVTM 419
           SF++ ++ S  I +KKL  VP +V +
Sbjct: 388 SFKVIVDKSHNIIVKKLTKVPRHVQI 413

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  258 bits (660), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 138/379 (36%), Positives = 222/379 (58%), Gaps = 28/379 (7%)

Query: 42  KQFKHCSISTYPKTPSSFFETSKDVALY-----HNKQLYSSDDTNLIPQLEPAIAKLANP 96
           K F H ++S +P  P  FF+ S+++  +       K L+  D   L P  +     + NP
Sbjct: 28  KGFVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFD-DKLGLRPLKDDICEYIHNP 86

Query: 97  SCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNK 156
           +     A  +K  YLG DL +G+E +IP+  DEL++++    +I +WE +N   Y   NK
Sbjct: 87  A---KNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENK 143

Query: 157 FTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNK-KDDGGIYSKDG 215
           FTIVS RHH++++ MC F+  + +  + ++      +G+L+ S D +K K D GI SKD 
Sbjct: 144 FTIVSNRHHLIDLIMCPFSLEEANLIVTHL------DGLLIISSDKSKPKVDSGIRSKDT 197

Query: 216 VVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMD 275
            VRK+ Y+GF LE+L+T  K D           G     ++I+ENKL + +SLLL+ EMD
Sbjct: 198 RVRKLCYTGFELENLVTKGKVDS---------PGMHTCFYSIVENKLTEGVSLLLQAEMD 248

Query: 276 SYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIE 335
           SYNP    + E+KC    ++ N NHRRKLL+ W+QTG++P +D+L+G RDP + +L+ ++
Sbjct: 249 SYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALK 308

Query: 336 WFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQSF 395
            ++R  +Y++ + RNL E +   N+N+ +AVQWS H I  I +LVD+++    L   QSF
Sbjct: 309 PYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPL---QSF 365

Query: 396 QIRINASRAIQIKKLKSVP 414
           ++ +     + + KL + P
Sbjct: 366 KLTLTRDLQLSLTKLANTP 384

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  241 bits (616), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 152/387 (39%), Positives = 225/387 (58%), Gaps = 25/387 (6%)

Query: 36  ITTIPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLAN 95
           I  IPF +F H +  ++P+     F  SK VA +   QL+ + +   +P L+  IA ++ 
Sbjct: 38  INIIPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISG 97

Query: 96  PSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHD-YQLG 154
            S  LN ++  KLPYLGSDLY   + + P+  D LDS +PCF +I  WE +++ + Y   
Sbjct: 98  KSV-LN-SKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAH 155

Query: 155 NKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRD----VNKKDDGGI 210
             +TI+S RHHI E+ M +F   K     L  TY    NG++L S+D     +  +  G+
Sbjct: 156 ADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYL--KNGIILLSKDDASSSSNSNTTGL 213

Query: 211 YSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLL 270
            S + + RKI YSGFA EDL+  +     A+N+        + +F+++E+KL + I+LLL
Sbjct: 214 NSSNPMTRKICYSGFAFEDLVLEDI----AENA--------RPIFSVVESKLTESINLLL 261

Query: 271 RCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGE 330
           R E+D YN V   FTE+KCFA LK       +++LK WVQTG+IP SDI+IGIRD   G 
Sbjct: 262 RNELDGYNNVTNMFTELKCFAPLKC--MFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGL 319

Query: 331 LNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLN 390
           L D+ W++R +L R  NN +LP A    N+NA IAV+W +  ++SI  LV  SI  +  N
Sbjct: 320 LEDLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADS--N 377

Query: 391 TSQSFQIRINASRAIQIKKLKSVPNNV 417
              SF+++I+  + I I+KL  +P  V
Sbjct: 378 HPCSFKLKIDNHKTISIQKLSRIPQTV 404

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  229 bits (585), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 123/361 (34%), Positives = 213/361 (59%), Gaps = 19/361 (5%)

Query: 50  STYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLANPSCSLNEARDLKLP 109
           +++ K    F++++K + ++H+ +LY  +  +L PQL+  IA +A  + +  E   L  P
Sbjct: 53  TSHHKNMPQFYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPA--EKTQLVRP 110

Query: 110 YLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNKFTIVSARHHIVEM 169
           +LG  LY+ ++ + PM   ELD+ E C  Y++ +E  +   Y     F IV+ARHH++++
Sbjct: 111 FLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDL 170

Query: 170 TMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDV--NKKDDGGIYSKDGVVRKISYSGFAL 227
            +  F+ R+  +  L   Y  G+  +L  S+D   N  D  G+ + + +++KI +SGFAL
Sbjct: 171 AILPFS-RQFTNVNLLCAYTPGN--LLEISQDPADNTNDKVGVNTDNPILKKICFSGFAL 227

Query: 228 EDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDSYNPVNKCFTEM 287
           ED+LT + ND   +             F I+EN++ +   LL+RCE+D+YNP+   +TE+
Sbjct: 228 EDILTESANDEERN-----------PTFLIVENEIAN-TRLLMRCEIDAYNPITSHYTEL 275

Query: 288 KCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFSRMNLYRQIN 347
           KC+A+    N NHRRKLLK+W+QTGVIP +DI+IG+RD   G L D+  ++R  LY ++ 
Sbjct: 276 KCYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLI 335

Query: 348 NRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQSFQIRINASRAIQI 407
           +++LP    +LNY+  I+V W +  I ++   +   +DK   +  Q F I+++ +  I+I
Sbjct: 336 SKSLPRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395

Query: 408 K 408
           +
Sbjct: 396 E 396

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  224 bits (570), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 121/383 (31%), Positives = 211/383 (55%), Gaps = 43/383 (11%)

Query: 42  KQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLANPSCSLN 101
           + F+  SIS +P  P  FF+  K++               +   ++    +L     + +
Sbjct: 22  RGFERASISHFPAEPLHFFDEVKEIG-------------TMTHWIDSDKFELGRKQSAPH 68

Query: 102 EARDLKL-----------PYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHD 150
             +DL L            Y+G DL + Y+ F P+ P++L+ +   F+++  WE  +   
Sbjct: 69  LKKDLGLFTITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKP 128

Query: 151 YQLGNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGI 210
           Y  G+ FTIV +RH+++++ M  F+    +D   NV Y  G   + +F     +K D GI
Sbjct: 129 YSSGSDFTIVCSRHNLIDLIMAPFSD---EDVHFNVKYINGY--LHIFPDKQFQKKDDGI 183

Query: 211 YSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVF-AIIENKLNDDISLL 269
           YS +  +R+I Y+GF LEDL+T             T  G  K+ F ++++ K++ +I LL
Sbjct: 184 YSSESNIRRICYTGFELEDLVTE------------TQPGAPKSAFYSLVQGKISKNIKLL 231

Query: 270 LRCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFG 329
            + EMD +NP  + +TE+KC   LK+ +  HRRKLL+ WVQT ++P++D+LIG+RDP + 
Sbjct: 232 FKAEMDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYH 291

Query: 330 ELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRL 389
           +L+  E ++R  LY++ NNRNL   K   NYNA I+VQW +H +K +C+ +   ++KT  
Sbjct: 292 QLSSFECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTP- 350

Query: 390 NTSQSFQIRINASRAIQIKKLKS 412
             + SF++ +     ++++K+++
Sbjct: 351 TEAVSFKLTLTKQLELRLRKIET 373

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  221 bits (564), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 133/384 (34%), Positives = 203/384 (52%), Gaps = 24/384 (6%)

Query: 39  IPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDD--TNL--IPQLEPAIAKLA 94
           + FK+F H     Y   P+  F+ SK+VA Y   +LY +D   TNL  +P L+  IA LA
Sbjct: 28  VRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAALA 87

Query: 95  NPSCSLNEARDLKLPYLGSDLYDGYESFI-PMDPDELDSIEPCFKYIESWELQNKHDYQL 153
             S +  ++   K  YLG  LY G+E ++  M PD LDS +PC  YI  W   +K + + 
Sbjct: 88  Q-SKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKF 146

Query: 154 GNKF--TIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGML-LFSRDVNKKDDGGI 210
           G  +   IV  RHH+VE+TM +F      D+ L  T   G   +L  F     +  + GI
Sbjct: 147 GESYRHIIVGPRHHLVELTMALFAND--SDYKLVCTVLRGKFIVLSQFDDGSQRNRNEGI 204

Query: 211 YSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLL 270
              D   R + YSGF +  + + N+             G   + F      +        
Sbjct: 205 TLSDRRTRMLCYSGFVICKIWSLNR-------------GIIPSQFFYYGTPIRRGHLATF 251

Query: 271 RCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGE 330
            CEMD+YN +   +TE+KC+  L M +  H+ KLL+ WVQT V P++D++IG R+   G 
Sbjct: 252 TCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGT 311

Query: 331 LNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLN 390
           L DI   SR +LYR+ NN++ P A  + NYNA++AV+WSQ+ +K+I +L++ ++++  + 
Sbjct: 312 LQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVL 371

Query: 391 TSQSFQIRINASRAIQIKKLKSVP 414
             Q+F + +     I I+KLK VP
Sbjct: 372 EPQAFVVTVYRGHDIGIRKLKGVP 395

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  220 bits (560), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 124/377 (32%), Positives = 215/377 (57%), Gaps = 27/377 (7%)

Query: 42  KQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLANPSCSLN 101
           K F+H  I+ +PK    FF+  ++VA      L  +D+  L  +L   + +L    C   
Sbjct: 22  KNFQHAQINQFPKNVLPFFDEVQEVATI--THLLDTDEFLLDDKL--GMPELVQDLCEFT 77

Query: 102 EARDL--KLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNKFTI 159
           E+  L  K  Y+G DL D ++ ++P+ P +L+ +     ++E W+  +   +     FTI
Sbjct: 78  ESGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFTI 137

Query: 160 VSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVN-KKDDGGIYSKDGVVR 218
           V +RH+++++ M  F+    +D  L + +   SNG L  S D   +K D GI+S D  ++
Sbjct: 138 VCSRHNLIDLIMMPFSD---EDVHLKIQF---SNGYLNLSPDAQYQKTDQGIHSGDTKIK 191

Query: 219 KISYSGFALEDLLT-TNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDSY 277
           KI Y+GF LE+L+T T+K D  +            + ++++E KL D I LLL+ EMD +
Sbjct: 192 KICYTGFELENLITATSKPDVRS------------SFYSLVEGKLGDGIKLLLKAEMDCF 239

Query: 278 NPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWF 337
           N   + +TE+KC + LK+ +  HRRKLL+ WVQT ++P++++L+GIRDP + +L   E +
Sbjct: 240 NSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECY 299

Query: 338 SRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQSFQI 397
           +R  LYR+ NN+ L   + + NYNA I+VQW +H I+ +C+++   I+K       +F++
Sbjct: 300 TRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGS-KEEVNFRL 358

Query: 398 RINASRAIQIKKLKSVP 414
            +  +  I+++K+   P
Sbjct: 359 TLRKNLTIKLRKMPETP 375

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  217 bits (552), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 130/394 (32%), Positives = 219/394 (55%), Gaps = 27/394 (6%)

Query: 36  ITTIPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQL--YSSDDTNLI-----PQLEP 88
           I  IPFK F + S +   K+  + F+ +K VALY++K++   ++++  LI     P L  
Sbjct: 60  IARIPFKHFSY-SNAHIGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTK 118

Query: 89  AIAKLANPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNK 148
            I+ L+    SL +++  KLPY+G +LYD  E F PMD   LDS  PCF+Y+ + ++ ++
Sbjct: 119 DISNLS--EISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKI-SE 175

Query: 149 HDYQLGNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDG 208
            D      +T ++ RHH+ E+ M ++  R+ +    +  +    + +++ S D+ K+++ 
Sbjct: 176 EDKLYNTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNP 235

Query: 209 GIYS---KDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDD 265
              +   ++   +K+  SGF  E+L+  N  + +            K  F I EN+L   
Sbjct: 236 SPQNHKLQNSFSKKVINSGFTFEELVIENFQECH------------KPYFYISENRLTPK 283

Query: 266 ISLLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRD 325
            + ++R EMDSYN   + FTE+KCF +L +    HR+KLLK W QTG+ PN DI+IGIRD
Sbjct: 284 STFIIRSEMDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRD 343

Query: 326 PMFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESID 385
              G L D+ W+SR N+Y+++ + +LP+ K   ++   I +QW  HCI +I     +   
Sbjct: 344 TSSGILEDLLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTS 403

Query: 386 KTRLNTSQSFQIRINASRAIQIKKLKSVPNNVTM 419
            T  N   ++++ I+  ++I IKKL  VP NV +
Sbjct: 404 DTASN-PMTYKVIIDKHKSIIIKKLSIVPKNVEI 436

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  196 bits (499), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 126/380 (33%), Positives = 200/380 (52%), Gaps = 21/380 (5%)

Query: 57  SSFFETSKDVALYHNKQLYSSDD-----TNLIPQLEPAIAKLANPSCSLNEARDLKLPYL 111
           S  + TSK+VA YH   L  + D     T  +P L+  I ++A  S  L +++  K  Y+
Sbjct: 57  SDLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKS--LLDSKKYKAKYI 114

Query: 112 GSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQN---KHDYQLGNKFTIVSARHHIVE 168
           G+DL+  YE +  M+ + L     CFKYI+ ++ ++   K  Y +  +F I+++RHHI +
Sbjct: 115 GADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHIND 174

Query: 169 MTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKD--GVVRKISYSGFA 226
           + +  F K    +  + +TY G  +  +L S+D   +      +K     +RKI  SGFA
Sbjct: 175 LVLAPFKKISDPEVSVLLTYLG--DNRILLSQDYAHEPPDWRENKQFYNSMRKIVNSGFA 232

Query: 227 LEDLLTTNKNDHNADNSDVTLVGGDKAV----FAIIENKLNDDISLLLRCEMDSYNPVNK 282
            EDL+  +        S       D ++    F+++EN ++  +++LLR EMD YNP+  
Sbjct: 233 FEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTN 292

Query: 283 CFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFSRMNL 342
            +TE+KCF RL M +  HR+KLLK WVQ G +PNSD+L+G RD   G LNDI WFSR +L
Sbjct: 293 SYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDL 352

Query: 343 YRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQ---SFQIRI 399
             + ++   P  +   N     A  W  H + +I  L  + + KT    S     F++ +
Sbjct: 353 VTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIV 412

Query: 400 NASRAIQIKKLKSVPNNVTM 419
             +R I +  LK VP +V +
Sbjct: 413 EKNRTITLLPLKKVPASVPI 432

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  173 bits (438), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 119/380 (31%), Positives = 188/380 (49%), Gaps = 36/380 (9%)

Query: 36  ITTIPFKQFKHCSISTYPKTPS-SFFETSKDVALYHNKQL-YSSDDTNLIPQLEPAIAKL 93
           I  +  K+F H  I+   K  S   F  S++V     + L Y  DD   +P L   I + 
Sbjct: 22  IVNVNMKKFPHGPITRRGKERSIRIFSESREVGTAFRQGLVYDLDDKKNLPLLNDEICEY 81

Query: 94  ANPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQL 153
            +     + ++   + Y+GSDL    E+F P+  +EL  +    K+I  WE  N+ +Y  
Sbjct: 82  IS-----HRSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYAS 136

Query: 154 GNKFTIVSARHHIVEMTMCIF-NKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYS 212
            +KFTIVS RHHI+++ M  F N+R    F           G+ + +   +++  G I S
Sbjct: 137 RSKFTIVSPRHHILDILMIPFGNERCRLVFT-------AHRGLFVITLAPSQRPTG-INS 188

Query: 213 KDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRC 272
                RKI Y+GF LE LLT                    + ++ IE KL  DI++LL+C
Sbjct: 189 PSSATRKICYTGFELERLLTATSGTERG------------SFYSFIEAKLEPDITILLQC 236

Query: 273 EMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELN 332
           EMD+YNP  + +TE+K      + N  H  KLLK W QT ++P++DIL+G RDP    L 
Sbjct: 237 EMDAYNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLK 296

Query: 333 DIEWFS----RMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTR 388
            +  +S       LY +   R+ P      N+N E+A  W+ + I+ IC+ +   +D T 
Sbjct: 297 TVVPYSVDQIAEKLYIRDRTRSHPSY---FNFNPEVAKDWTHYAIREICERLSSLVDATS 353

Query: 389 LNTSQSFQIRINASRAIQIK 408
            ++ QSF + I+ +  ++I+
Sbjct: 354 -SSPQSFLVEIDKNLQMKIR 372

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  147 bits (370), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 110/375 (29%), Positives = 189/375 (50%), Gaps = 36/375 (9%)

Query: 42  KQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLI------PQLEPAIAKLAN 95
           K+F H S++             K+V   HN     +D T L       P+L P +     
Sbjct: 45  KKFPHVSVNYVVDKTPKLLTDCKEV---HNCSYIINDATLLWNEASRKPRLRPEVCTYIK 101

Query: 96  PSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLG- 154
            S   N+A  +K  ++G DL  GY+ ++P+D + L+S+      +   E   +++  L  
Sbjct: 102 DSKWENKA--VKDSFIGIDLTKGYDDYVPLDRNVLNSL------VILKEAYQRYEKTLNP 153

Query: 155 NKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIY-SK 213
            K T VS RHHI+++ MC F    +    L +T +   N  +L S D +K    GI+ ++
Sbjct: 154 EKTTFVSLRHHIIDIIMCPFLDEPLS---LLMTVQPDKN--ILISVDKSKDKPNGIHETR 208

Query: 214 DGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCE 273
           +   +KI Y+GFALEDLL  +  + +        +   +  ++I+   LND+I LL++ E
Sbjct: 209 NSFNKKICYTGFALEDLLIESPTEGH--------ILEHELYYSIVHGSLNDEIDLLIQAE 260

Query: 274 MDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELND 333
           MDS N +   +TE+K     K+ N  HRRKLL+ W+QT ++P SD+LIG R+    EL  
Sbjct: 261 MDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQ 320

Query: 334 IEWFSRMNLYRQINNRNLPEAKLDL-NYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTS 392
           ++ +   ++Y +INN ++         +N  +A  W QH  +    L    +  ++ +TS
Sbjct: 321 LKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQV---LKQNLLLLSQESTS 377

Query: 393 QSFQIRINASRAIQI 407
            +F+++I+ +  + I
Sbjct: 378 TTFKVQIDTNLTLSI 392

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 100/236 (42%), Gaps = 32/236 (13%)

Query: 117 DGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNKFTIVSARHHIVEMTMCIFNK 176
           D Y++F   DP  L  +    K I+++E       Q   K  I++ R  I ++    F+ 
Sbjct: 68  DHYKNF--QDPGTLKGL---LKTIQAYE----EIKQKKVKVDIITFRGVIRKLISSAFDS 118

Query: 177 RKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKDGVVRKISYSGFALEDLLTTNKN 236
            K +   L +    G     +F ++V +K++     KDG +    YSG+  E+L+T +K 
Sbjct: 119 PKFNQVNLRIVLFDGQ----IFMKEVPRKEEE---PKDGKIAPPVYSGYKFENLVTVSKP 171

Query: 237 DHNADNSDV-----TLVGGDKAVFAIIENKLNDDISLLLRCEMDS-YNPVNKCFTEMKCF 290
                 + +      +V       +++   +  +  L+L  E+D+ ++   +    +K +
Sbjct: 172 IPYTSRTTIEKRPKKIVSNGDEYISVVRTGVG-NCKLMLGAEVDAIFDFKEEDKDNLKHY 230

Query: 291 ARLKMNN--------HNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFS 338
             LK  N            +K+ K W+Q  ++    I+ G RD  F  L  +E FS
Sbjct: 231 VELKTTNAVLTPSDARKFEQKIFKTWIQCFLVGIPRIIYGFRDNNFI-LKSVEEFS 285

>ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 608

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 65/159 (40%), Gaps = 5/159 (3%)

Query: 162 ARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKDGVVRKIS 221
           A+H I   ++  FN+     FI    +     G+L+  ++  KK +   Y   G V  I 
Sbjct: 383 AKHGIATDSVLFFNRSDWSLFIGTAIFTFEGIGLLIPIQESMKKPEH-FYPSLGFVMSIV 441

Query: 222 YSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDSYNPVN 281
              F    LL        A    V L+   +   A I  +L   +++LL   +  + P  
Sbjct: 442 TFIFVSSGLLCYLA--FGAKVETVVLLNFPQDSIATISVQLIYSLAILLSTPLQLF-PAI 498

Query: 282 KCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDIL 320
           + F E   F       HNHR K LK + +TGV+  + +L
Sbjct: 499 RIF-ETWTFPSNASGKHNHRVKWLKNYFRTGVVIFTALL 536

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 79/192 (41%), Gaps = 30/192 (15%)

Query: 197 LFSRDVNKKDDGGIYSKDGVVRKISYSGFALEDLLTTNK------NDHNADNSDVTLVGG 250
           +F +++N+K+D         +   SY+G+  E L   N+       D     +D  +  G
Sbjct: 139 VFIKEINEKED-----ISNAIDVNSYTGYKFEALTLLNEPIAFTERDSLDSRADACVSNG 193

Query: 251 DKAVFAIIENKLNDDISLLLRCEMDSYNPVN-------KCFTEMKCFARLK--MNNHNHR 301
           D+ V ++++  +     +L+  E+D             K + E+KC   L    +  N  
Sbjct: 194 DEYV-SVVKTGIGKH-RVLMGGEVDGIYDFKEDGADNLKHYLELKCTRSLSSYQDIENFE 251

Query: 302 RKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYN 361
           +KL K W+Q  +I    I  G RD  +  L  IE +   ++ +   NR +    +D    
Sbjct: 252 KKLFKTWLQCFLIGIPRITYGFRDRSYN-LTSIEEYLTEDVPKLFTNRGVKAQCMD---- 306

Query: 362 AEIAVQWSQHCI 373
              A+QW    I
Sbjct: 307 ---AIQWYGEII 315

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
           similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246c RAI1
          Length = 400

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 12/91 (13%)

Query: 282 KCFTEMKCFARLKMNNHNHR--RKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFS- 338
           K +TE+KC +++   N   R  +K+ +AW+Q  ++    ++ G RD  +  L  +E FS 
Sbjct: 242 KHYTELKCSSQISTTNDVRRFEKKMFRAWLQCFLVGVPRVIYGFRDDQY-MLKTVEEFST 300

Query: 339 -RMNLYRQINNRNLPEAKLDLNYNAEIAVQW 368
             + +  + NN  L ++ LD       A++W
Sbjct: 301 EEIPVIIKANNPTLGQSCLD-------AIKW 324

>AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 376

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 56/269 (20%), Positives = 107/269 (39%), Gaps = 40/269 (14%)

Query: 159 IVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKDGVVR 218
           I++ R  +  +  C F     D  +  +++ G      LF R   KK +     ++    
Sbjct: 102 IIAFRGQVKRLIHCAFGGHATDVDMYVMSFDGQ-----LFIRAARKKLEFPTSPRESWAY 156

Query: 219 KISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVF-------AIIENKLNDDISLLLR 271
              YSG+  E +   ++    A+     L    K V         ++   + +   L+L 
Sbjct: 157 LAYYSGYKFERMALLDRP--VAETPREVLESRGKQVVRNGPQYKTVVRTGVGEH-KLVLG 213

Query: 272 CEMDSY----NPVN---KCFTEMKCFARLKM--NNHNHRRKLLKAWVQTGVIPNSDILIG 322
            E+D       P     K + E+K   +++   +  N  +KL   W+Q  ++  + ++IG
Sbjct: 214 AEVDGIFDFREPTGDNLKHYVELKVAKKVQTLKDATNFEQKLFSVWLQCFLVGINRVIIG 273

Query: 323 IRDPMFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDE 382
            RD  F  L  +E FS   +   + +  L  A +D       A++W     K +C+L   
Sbjct: 274 FRDEKF-VLKSVEEFSTSEIPLLLKSTGLRNACVD-------AIKWYGALTKWLCELPRG 325

Query: 383 SIDKTRLNTSQSFQIRINASR-AIQIKKL 410
             D  +L        R++ SR A+ +++L
Sbjct: 326 PEDDFKL-------YRLSCSRGALHLRQL 347

>AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 775

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 47/230 (20%), Positives = 88/230 (38%), Gaps = 24/230 (10%)

Query: 159 IVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKDGVVR 218
           I++ R  +  +  C F     D  +  +++ G      LF R   KK +     ++    
Sbjct: 510 IIAFRGQVKRLIHCAFGGHATDVDMYVMSFDGQ-----LFIRAARKKLEFPTSPRESWAY 564

Query: 219 KISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAV------FAIIENKLNDDISLLLRC 272
              YSG+  E +   ++    A+     L    K V      +  +      +  L+L  
Sbjct: 565 LAYYSGYKFERMALLDRP--VAETPREVLESRGKQVVRNGPQYRTVMRTGVGEHKLVLGA 622

Query: 273 EMDSYNPVNKCFTE-MKCFARLKM--NNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFG 329
           E+D      +   + +K +  LK+   N N   KL  +W+Q  ++  + ++IG RD  F 
Sbjct: 623 EIDGIIDFREPTGDNLKHYVELKVCQKNRNFSEKLFSSWLQCFLVGINRVIIGFRDEKF- 681

Query: 330 ELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKL 379
            L  +E FS   +   +         +D       A++W     K +C+L
Sbjct: 682 VLKSVEEFSTSEIPHLLKGTEYSNVCVD-------AIEWYGALTKWLCEL 724

>TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 73/188 (38%), Gaps = 21/188 (11%)

Query: 152 QLGNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIY 211
           Q   K  I++ R  I  +    F+  K +   L V    G     +F RDV  KD+    
Sbjct: 94  QKRTKADIITFRGVIRRLISAAFDSPKFNKVDLRVVAFDGQ----IFIRDVASKDEELRM 149

Query: 212 SKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVT-----LVGGDKAVFAIIENKLNDDI 266
           + +   R   Y+G+  E + T ++     D   V      LV        ++   + +  
Sbjct: 150 TTES--RNAWYTGYKFETVATLSQPLPYVDRETVEKRPKKLVNTGDEYITVVRTGVGNS- 206

Query: 267 SLLLRCEMDSYNPVN-------KCFTEMKCFARL--KMNNHNHRRKLLKAWVQTGVIPNS 317
            L+L  E+D             K + E+KC A +  + +     +K+ K W+Q  ++   
Sbjct: 207 KLILGAEVDCIFDFKEEGKDNLKHYAELKCSAMVSTQADARKFEKKIFKTWLQCFLVGIP 266

Query: 318 DILIGIRD 325
            I+ G RD
Sbjct: 267 RIIYGFRD 274

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 97/235 (41%), Gaps = 32/235 (13%)

Query: 173 IFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKDGVVRKISYSGFALEDLLT 232
           I  K  M  F  N  Y      ++LF   +  KD   + +K   V  + Y+G+  E L T
Sbjct: 107 IIRKLIMSSFETNSKYNVVDLRIVLFDGQLFIKDVSTVNAKPEKVTPLEYTGYKFEALCT 166

Query: 233 -------TNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDSYNPVN---- 281
                   ++   N     + +  GD+ V ++++  +  +  +LL  E+D+         
Sbjct: 167 LPEPLPYVSRTKLNKRPKKI-VSHGDEFV-SVVKTGVG-NCKILLGAEVDAIFDFKEKGK 223

Query: 282 ---KCFTEMKCFARLKMNNHNHRR----KLLKAWVQTGVIPNSDILIGIRDPMFGELNDI 334
              + + E+KC A +  NN N  +    KL K W+Q  +I  + I  G RD  +  L  I
Sbjct: 224 DNLQHYIELKCTAAI--NNINDTKKFENKLFKTWIQCFLIGITRITYGFRDEQY-LLKTI 280

Query: 335 EWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLV---DESIDK 386
           E F+  ++     N N   A      N   A++W     + + K++   D S+ K
Sbjct: 281 EEFATSDIPLIFKNHNPTLAS-----NCVNAIKWYGVFTEWLMKMIPTEDTSVTK 330

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 284 FTEMKCFARL--KMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFS 338
           + E+KC  ++    + H   RKL K W+Q  ++    I+ G RD  +  L  +E FS
Sbjct: 227 YAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRDENYT-LKSVEEFS 282

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 282 KCFTEMKCFARLKM--NNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFS 338
           K + E+KC   +    + H   RKL K W+Q  ++  + I+ G RD  F  L  +E F+
Sbjct: 233 KHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRDDNFM-LKTVEEFT 290

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 79/193 (40%), Gaps = 33/193 (17%)

Query: 214 DGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVG------GDKAVFAIIENKLNDDIS 267
           D +  +  YSG+  E L T +K       S +          GD+ V  +     N    
Sbjct: 152 DAMQYRSYYSGYKFESLATLSKPLPQTPRSSLEKRSKKICNNGDQFVTVVRSGVGN--CK 209

Query: 268 LLLRCEMDS-YNPVNKCFTEMKCFARLKMNN--------HNHRRKLLKAWVQTGVIPNSD 318
           L+L  E+D  ++        +K +A LK            +  RKL K W+Q  ++  + 
Sbjct: 210 LVLGAEVDCVFDFAEDTSNNLKHYAELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINR 269

Query: 319 ILIGIRDPMFGELNDIEWFS--RMNLYRQINNRNLPEAKLDLNYNAEIAVQW----SQHC 372
           I+ G RD  F  L  +E +    + L  + NN  L  A +D       AV+W    ++  
Sbjct: 270 IIYGFRDEHFI-LRSVEEYGSHEIPLLLKNNNPQLTNACMD-------AVRWYGAFTEWL 321

Query: 373 IKSICKLVDESID 385
           + SI +  DES+D
Sbjct: 322 LSSIPR--DESVD 332

>TDEL0E01120 Chr5 (229597..231606) [2010 bp, 669 aa] {ON} Anc_4.258
           YLR396C
          Length = 669

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 90/199 (45%), Gaps = 22/199 (11%)

Query: 188 YKGGSNGMLLFSRDVNKKDDGGIYSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTL 247
           Y G    +++F RD++            ++ +++YSG  L+DL     +       DV+L
Sbjct: 258 YSGLEKDLIVFDRDMD--------PMTPLLTQLTYSGL-LDDLHGLTPDGKVKGLDDVSL 308

Query: 248 VGGDKAVFAIIE----NKLNDDISLLLRCEMDSYNPVNKC--FTEMKCFARLKMNNHNHR 301
                +++  ++      L   ++ + R   D Y+  +K     E+K F    + +   R
Sbjct: 309 KCDKDSIWDDLKFLNFGALGPRLNYIARELQDKYDARHKAESVGEIKQFVD-SLGSLQER 367

Query: 302 RKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYN 361
           +KLLK  V T +  +SDIL  +      +LN I    +  L   ++N++  ++ LDL Y 
Sbjct: 368 QKLLK--VHTTL--SSDILKEVEKDESVQLNRILELEQDLLLGNLDNKSSCDSILDLLYE 423

Query: 362 AEIAVQWSQH--CIKSICK 378
            ++ ++      C+ SICK
Sbjct: 424 GQVGLKRIMRLLCLSSICK 442

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 61/153 (39%), Gaps = 16/153 (10%)

Query: 212 SKDGVVRKISYSGFALEDLLTTNKNDHNADNSDV-----TLVGGDKAVFAIIENKLNDDI 266
           + D +  +  YSG+  E L+T  K       + +      +V   +   +++   +    
Sbjct: 150 TTDSIEHRSYYSGYKFESLVTLPKPLGEVSRTTLEKRPKKIVNNGEQYISVVRTGVGKS- 208

Query: 267 SLLLRCEMDSYNPVN-------KCFTEMKCFARLK--MNNHNHRRKLLKAWVQTGVIPNS 317
            L+L  E+D             K +TE+KC   +          RK+ K W+Q  ++  +
Sbjct: 209 KLILGAEVDCVFDFKEDSGDNLKHYTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVN 268

Query: 318 DILIGIRDPMFGELNDIEWFSRMNLYRQINNRN 350
            ++ G RD  F  L  +E FS   +   + N N
Sbjct: 269 RVIYGFRDDNF-ILKSVEEFSTQEIPIILKNNN 300

>NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON}
           Anc_5.414 YDR356W
          Length = 1009

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 11/111 (9%)

Query: 278 NPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWF 337
           N +N+  +++K    L++ N N  R+ L+  +    I  SD L GI++ M  EL  I+  
Sbjct: 408 NKINELESKIKNL-HLQLENLNTERQELQDALLGHDIAGSDELRGIKEDMQNELEKIKQL 466

Query: 338 SRMNLYRQINNRNLPEAKLDLNYN----------AEIAVQWSQHCIKSICK 378
              N   QIN  +L +    L  N           EI VQ  Q  I ++ K
Sbjct: 467 EETNHTLQINFDDLQKDNSKLTRNLKNSEENKKTLEIQVQSMQQTIDNLEK 517

>Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 282 KCFTEMKCFARLKMN---NHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFS 338
           K + E+KC  ++ MN    H   RKL + W+Q  ++    I+ G +D  +  L  +E FS
Sbjct: 237 KHYAELKCTQQV-MNISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDQY-VLKTVEEFS 294

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 282 KCFTEMKCFARLKMN---NHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFS 338
           K + E+KC  ++ MN    H   RKL + W+Q  ++    I+ G +D  +  L  +E FS
Sbjct: 237 KHYAELKCTQQV-MNVSDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHY-VLKTVEEFS 294

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 282 KCFTEMKCFARLK--MNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFS 338
           K + E+KC  ++    + H   RKL + W+Q  ++    I+ G +D  +  L  +E FS
Sbjct: 237 KHYAELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHY-VLKTVEEFS 294

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 282 KCFTEMKCFARL--KMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFS 338
           K + E+KC  ++    + H   RKL + W+Q  ++    I+ G +D  +  L  +E FS
Sbjct: 237 KHYAELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHY-VLKTVEEFS 294

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 282 KCFTEMKCFARL--KMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFS 338
           K + E+KC  ++    + H   RK+ + W+Q  ++    I+ G RD  +  L  IE +S
Sbjct: 233 KHYAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDENY-VLKTIEEYS 290

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,086,269
Number of extensions: 2475408
Number of successful extensions: 7023
Number of sequences better than 10.0: 50
Number of HSP's gapped: 7184
Number of HSP's successfully gapped: 50
Length of query: 423
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 311
Effective length of database: 40,638,807
Effective search space: 12638668977
Effective search space used: 12638668977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)