Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B056805.435ON85685639410.0
NCAS0F033905.435ON8618076992e-78
TDEL0E019005.435ON7626895904e-64
ZYRO0F10054g5.435ON6607074733e-49
YDR369C (XRS2)5.435ON8542013791e-36
Smik_4.6355.435ON8631963729e-36
Suva_2.5415.435ON8692013673e-35
KAFR0E038305.435ON8451993612e-34
Skud_4.6385.435ON8432033594e-34
CAGL0A02838g5.435ON8281973433e-32
SAKL0G02552g5.435ON8341863131e-28
TBLA0A028205.435ON9252033023e-27
Kpol_1016.55.435ON8122072961e-26
KNAG0C049005.435ON7691102782e-24
TPHA0J025905.435ON7751912782e-24
KLTH0F16038g5.435ON7923332729e-24
Kwal_55.214225.435ON7821922335e-19
KLLA0E02201g5.435ON8354052318e-19
Ecym_47615.435ON7982111862e-13
AER402C5.435ON8691421656e-11
KAFR0D029402.430ON74158771.8
TBLA0B037208.699ON62754734.7
AAL109W8.704ON914100726.2
NCAS0E019307.185ON104795727.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05680
         (856 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...  1522   0.0  
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   273   2e-78
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   231   4e-64
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   186   3e-49
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   150   1e-36
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   147   9e-36
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   145   3e-35
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   143   2e-34
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   142   4e-34
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   136   3e-32
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   125   1e-28
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   120   3e-27
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   118   1e-26
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...   111   2e-24
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...   111   2e-24
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   109   9e-24
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...    94   5e-19
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...    94   8e-19
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...    76   2e-13
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...    68   6e-11
KAFR0D02940 Chr4 complement(578907..581132) [2226 bp, 741 aa] {O...    34   1.8  
TBLA0B03720 Chr2 complement(857518..859401) [1884 bp, 627 aa] {O...    33   4.7  
AAL109W Chr1 (150547..153291) [2745 bp, 914 aa] {ON} Syntenic ho...    32   6.2  
NCAS0E01930 Chr5 complement(372023..375166) [3144 bp, 1047 aa] {...    32   7.3  

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score = 1522 bits (3941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 769/856 (89%), Positives = 769/856 (89%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60
           MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60

Query: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMYE 120
           LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMYE
Sbjct: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMYE 120

Query: 121 QFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVSNML 180
           QFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVSNML
Sbjct: 121 QFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVSNML 180

Query: 181 RPDNITFDTDVQKINSMESLKLVPXXXXXXXXXXXXQDYFFIITLNKSSVSEHADKSFIL 240
           RPDNITFDTDVQKINSMESLKLVP            QDYFFIITLNKSSVSEHADKSFIL
Sbjct: 181 RPDNITFDTDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIITLNKSSVSEHADKSFIL 240

Query: 241 RKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKRMIMNFECRNVKDIF 300
           RKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKRMIMNFECRNVKDIF
Sbjct: 241 RKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKRMIMNFECRNVKDIF 300

Query: 301 DSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEPPIEAAITEESTSSKNLKHT 360
           DSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEPPIEAAITEESTSSKNLKHT
Sbjct: 301 DSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEPPIEAAITEESTSSKNLKHT 360

Query: 361 PPEPVTTHIXXXXXXXXXXXXPLESLDFFVXXXXXXXXXXXXXXXLQQEIIEPKVPDVAP 420
           PPEPVTTHI            PLESLDFFV               LQQEIIEPKVPDVAP
Sbjct: 361 PPEPVTTHIVKKRRLARKRVKPLESLDFFVGGSTTGTPFETSSTTLQQEIIEPKVPDVAP 420

Query: 421 ILNEQIQQSQVNKSINEPAKDIYSIGGSDRKETAALTYATIDKHMQEPTQQIDDIPSQHI 480
           ILNEQIQQSQVNKSINEPAKDIYSIGGSDRKETAALTYATIDKHMQEPTQQIDDIPSQHI
Sbjct: 421 ILNEQIQQSQVNKSINEPAKDIYSIGGSDRKETAALTYATIDKHMQEPTQQIDDIPSQHI 480

Query: 481 DISPHGNSNEQEKRSNSSEKSPMITQQVNDEKDEKISNAKALKIGKREDSKRYSETTPKS 540
           DISPHGNSNEQEKRSNSSEKSPMITQQVNDEKDEKISNAKALKIGKREDSKRYSETTPKS
Sbjct: 481 DISPHGNSNEQEKRSNSSEKSPMITQQVNDEKDEKISNAKALKIGKREDSKRYSETTPKS 540

Query: 541 MVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNK 600
           MVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNK
Sbjct: 541 MVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNK 600

Query: 601 STNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAFL 660
           STNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAFL
Sbjct: 601 STNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAFL 660

Query: 661 ITRNYVPLKQYSKYDDSHGGKNGFNDEEMLEKEYVEYDNEEAGNGLSSTQHENENGVHLS 720
           ITRNYVPLKQYSKYDDSHGGKNGFNDEEMLEKEYVEYDNEEAGNGLSSTQHENENGVHLS
Sbjct: 661 ITRNYVPLKQYSKYDDSHGGKNGFNDEEMLEKEYVEYDNEEAGNGLSSTQHENENGVHLS 720

Query: 721 ATNQAHFQRSRSSQSSYNVDADEDSNEDDNIKSFSFSRTSLPKEPAPNKLFVPXXXXXXX 780
           ATNQAHFQRSRSSQSSYNVDADEDSNEDDNIKSFSFSRTSLPKEPAPNKLFVP       
Sbjct: 721 ATNQAHFQRSRSSQSSYNVDADEDSNEDDNIKSFSFSRTSLPKEPAPNKLFVPDEDEDED 780

Query: 781 XXXVAAHNLGIDIVNPDVRDVPEVPXXXXXXXXXXXXXXXXXXXXXFIDMXXXXXXXXXX 840
              VAAHNLGIDIVNPDVRDVPEVP                     FIDM          
Sbjct: 781 EDEVAAHNLGIDIVNPDVRDVPEVPKRNPEKRKKVSKKSSPKGRGRFIDMENVDNDSVGD 840

Query: 841 XXXXXXXPKFKFRRKR 856
                  PKFKFRRKR
Sbjct: 841 EDDDDDEPKFKFRRKR 856

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  273 bits (699), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 242/807 (29%), Positives = 385/807 (47%), Gaps = 87/807 (10%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60
           MW+LRYQY LEDG  +K+S C+++S+ Y+IGRS+KN LSIKNDKSISRQH+++KWE    
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60

Query: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMYE 120
           +H++NQGKLT + E+YL + +SL F  V++  L + LGT PV+V + +   N  IPN   
Sbjct: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNS--LSIKLGTKPVMVHLEFYSSNWLIPNGLT 118

Query: 121 QFRGLLTKYGIEVTSDI-LQEDSHITAVVMTPNDY-YVPLLALALGIPVFKSQYLTEVSN 178
           QF   L  +G+ V + I + + + I  +V   N    +PL      IPV K Q+ +    
Sbjct: 119 QFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTACE 178

Query: 179 MLRPDNITFDTDVQKINSMESLKLVPXXXXXXXXXXXXQDYFFIITLNKSSVSEHADKSF 238
           +L  ++  FD    ++    +                 ++Y  +I  +  +   + D   
Sbjct: 179 ILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNET---NKDAVK 235

Query: 239 ILRKSLQLIGGEEEIIKDPTELQNS---VTKILSTSGKNIVIVT--DEDNGKRMIMNFEC 293
            L+ +L L G    I+ D ++L  S   +  +  T+ ++I +V      +    + + E 
Sbjct: 236 TLKTALNLGGA---IVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDLEY 292

Query: 294 RNVKDIFDSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEP--------PIEA 345
             ++DI  +    D K++K   T    +  +   + ++  L+ EI  P        P   
Sbjct: 293 FKLEDIITAI--RDDKIMKLITT----IPEREQVMNQDVSLIPEITYPSDRKTNIQPSHH 346

Query: 346 AITEESTSSKNL--KHTPPEPVTTH-IXXXXXXXXXXXXPLESLDFFVXXXXXXXXXXXX 402
            +       KN+     P E    + I            PL+SL FF             
Sbjct: 347 TVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASP------- 399

Query: 403 XXXLQQEIIEPKVPDVAPILNEQIQQS---QVNKSINEPAKDIYSIGGSDRKETAALTYA 459
                 +I  P V + A    ++  +S   + N  + +P+ +   +  S+      +  A
Sbjct: 400 ------KIGSPAVQETAQATKDESAESDKFRTNNGLTQPSGNSQPLIHSEPIVLKEVLEA 453

Query: 460 TIDKHMQE-PTQQIDDIPSQHIDISPHGNSNE-QEKRSNSSEKSP--MITQQVNDEKDEK 515
             +K++QE PT  +  I S+      H   N+  E  S ++  +P  +    V      +
Sbjct: 454 DHNKNIQEGPTTAVPVIQSKSTQPLEHTEQNKNSEIGSVAATPTPEVLTGNGVERPNTPQ 513

Query: 516 ISNAKALKIGKREDS--KRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAI 573
           + + +AL    +E    K  S   PKS V+ IQ+ KNREVTRL+S++  +D +ELTE AI
Sbjct: 514 VPSTQALVSNHKEKKNLKSNSLEEPKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAI 573

Query: 574 NEFSNLAIVESNASLIR----RTENNDNTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVK 629
           N+  +L IVE N SLIR    R E    T + ++   R  S          R+NFK+FVK
Sbjct: 574 NQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDKTAREWS---------RRKNFKKFVK 624

Query: 630 VYPKYIQNKNDSNNERGDNGASDFIRNNAFLITRNYVPLKQYSKYDDSHGGKNGF--NDE 687
           +YPKY++   +S+        +D IRNNAFLITRNYVP+K+++      G  N    +DE
Sbjct: 625 IYPKYMKKDTESD-------TTDLIRNNAFLITRNYVPMKKFT------GQYNNVPNDDE 671

Query: 688 EMLEKEYVEYDNEEAGNGLSSTQHENENGVHLSATNQAHFQRSRSSQSSYNVDADEDSNE 747
           +M E    E +N E G+G  +      + +  S  +Q   Q    SQS+   D   D ++
Sbjct: 672 DMYEHHDYERENIENGDGDLAIPPVVNDFIPSSQLSQRRLQ--IDSQSARIKDTQPDFSD 729

Query: 748 DDNIKSFSFSRT--SLPKEPAPNKLFV 772
           D+  +SFSF R+  +  K  A N LFV
Sbjct: 730 DEG-QSFSFRRSMANAKKTTANNGLFV 755

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  231 bits (590), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 210/689 (30%), Positives = 327/689 (47%), Gaps = 68/689 (9%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60
           MWIL+Y Y LEDG I++VS CL +   +SIGRSSKNPL+IKNDKSISR HI++ W+   +
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60

Query: 61  L-HLVNQGKLTSVKERYLAIDESLIF-NVVDTKE-LDVHLGTNPVIVQIRWQPMNLYIPN 117
           L  L+NQG+LT+   +YL + ES+ F   +  +E + + LGT P+ V++ WQ +   +P+
Sbjct: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120

Query: 118 MYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVS 177
              QF   L   GI V +D +   S    V       Y  L  L  G  +  SQ+L EV+
Sbjct: 121 QLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVEVT 180

Query: 178 NMLRPDNITFDTDVQKINSMESLKLVPXXXXXXXXXXXXQDYFFIITLNKSSVSEHADKS 237
           N+L     TF+     +   ES  L P              ++ I     S V   A   
Sbjct: 181 NILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLI----ASDVITMA--- 233

Query: 238 FILRKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKRMIMNFECRNVK 297
             ++++L+   GE  ++++  +L + + +  ST   +++++  E+  K      +   + 
Sbjct: 234 -YVQEALERGNGELIVVENTEQLLDRLKQENSTD--DLIVLKAEETTKIPGDKIKLHTLV 290

Query: 298 DIFDSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEPPIEAAITEESTSSKNL 357
           D+ ++   N  K L   +          P +      ++   +P +       S S  N 
Sbjct: 291 DLVNAVSHNTVKTLLGGV----------PPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNK 340

Query: 358 KHTPPEPVT-THIXXXXXXXXXXXXPLESLDFFVXXXXXXXXXXXXXXXLQQEI----IE 412
           +HTP   VT                PL+SL FF                 +QEI    + 
Sbjct: 341 EHTPEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGGDYSTEEP-------EQEISTQPVN 393

Query: 413 PKVPDVAPI-LNEQIQQSQVNKSINEPAKDIYSIGGSDRKETAALTY-ATIDKH----MQ 466
           P   D A   +  QI   + + S    A D +      +     LT  +  D H    + 
Sbjct: 394 PAASDTAKTSITTQINVPENDASQESSAFDKFQPNIVLKNSAKPLTIDSPGDAHNTHEIN 453

Query: 467 EPTQQIDDIPSQHIDISPHGNSNEQEKRSNSS--EKSPMITQQVNDEKDEKISNAKALKI 524
              Q + DI +Q I+++ H  S +Q +++N +  E +P  T +    +D K +      +
Sbjct: 454 TANQHVKDI-AQQIEMN-HPESEQQSEQANLNMVETTPRPTARKKTLQDFKST------V 505

Query: 525 GKREDSKRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVES 584
              ++S   +E     +V+ I+D K+REV RL+S++  VD +ELTEDAIN+  +LAIV+ 
Sbjct: 506 NNPDNSASSTE----GLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQP 561

Query: 585 NASLIRRTENNDNTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNE 644
           N SLIRR +  D+   S N   +H   D       GR+NFK FVKV  KY + +   N  
Sbjct: 562 NDSLIRR-QKIDSAETSRND--QHPPWD-------GRKNFKNFVKVQAKYKEQRMGENYR 611

Query: 645 RGDNGASDFIRNNAFLITRNYVPLKQYSK 673
               G+SDFIRN+ +L+TR YVP K Y+K
Sbjct: 612 E---GSSDFIRNSGYLLTRQYVPSKIYTK 637

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  186 bits (473), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 192/707 (27%), Positives = 297/707 (42%), Gaps = 141/707 (19%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSG- 59
           MWILRYQY LEDG +K VS CL     Y+IGRSSKN L+IKNDKSISRQH++I W+    
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60

Query: 60  QLHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMY 119
           QL L+NQGK+T+V E+YL + ES+ F       L V LGT P+ +Q++W      +P   
Sbjct: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVL-VELGTKPLKMQLQWMDSIWMVPQGS 119

Query: 120 EQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVSNM 179
                 L + GIEV S  L   + I  V+    +Y   L  L   IP+   ++L  VS  
Sbjct: 120 RSDHSALEELGIEVLSSELSRANLI--VIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQK 177

Query: 180 LRPDNITFDTDVQKINSMESLKLVPXXXXXXXXXXXXQDYFFIITLNKSSVSEHADKSFI 239
           +      FD+   KI +  SL+               Q+  F+      +V +  D S  
Sbjct: 178 VSGHETEFDSIWTKIMNDGSLRY----KSWEVQAQVLQNLEFL------TVGKDEDTSL- 226

Query: 240 LRKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKRMIMNF-ECRNVKD 298
              +++  GG+   +    EL+ +V +    S  N+VI+         +    +   V+D
Sbjct: 227 ---AIEAAGGKYSAVLSVEELREAVKRKGDLS--NVVILKSHLTPAEELAPLGKTFTVQD 281

Query: 299 IFDSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEPPIEAAITEESTSSKNLK 358
           + ++ +K++   LK+ +       P+A              E P+E  +T++   ++   
Sbjct: 282 VVEAILKDEVNSLKNGVIGEVAKRPEA--------------EVPMEKPVTKKRRLNR--- 324

Query: 359 HTPPEPVTTHIXXXXXXXXXXXXPLESLDFFVXXXXXXXXXXXXXXXL---QQEIIEPKV 415
                                  PL+ L FF                L   ++E  +P+ 
Sbjct: 325 -------------------PRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEESKDPRK 365

Query: 416 ---PDVAPILNEQIQQSQVNKSIN-----EPAKDIYSIGGSDRKETAALTYATIDKHMQE 467
              P      ++++ Q +V K  N     EP +  Y    +D  E +        +   E
Sbjct: 366 LEDPKEESKESKEVLQPEVPKEFNEYSKEEPGQKSYEESKADENEKSL-------EETVE 418

Query: 468 PTQQIDDIPSQHI-----DISPHGNSNEQEKRSNSSEKSPMITQQVNDEKDEKISNAKAL 522
           PT Q+ + P         +  PH      + R   S     + Q + D K+ ++      
Sbjct: 419 PTLQVTEPPPTSAAEKPNNARPHRKPTLSDYRKGESPSQNDMIQMIQDTKNHEV------ 472

Query: 523 KIGKREDSKRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIV 582
                           K +  TI  + + E+T               EDAIN+  NL +V
Sbjct: 473 ----------------KRLNSTIIQVGDEELT---------------EDAINQLGNLVLV 501

Query: 583 ESNASLIRRTENN---DNTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKN 639
           + N +L+RR + +   D+ N + N+                R+NFK FVKV+PKY     
Sbjct: 502 DRNDNLMRRRDRSPTVDSHNPNWNN----------------RKNFKNFVKVWPKY--GGQ 543

Query: 640 DSNNERGDNGASDFIRNNAFLITRNYVPLKQYSKYDDSHGGKNGFND 686
           DS +     G+SD IRN AFL+TR YVP + Y+  D S   +    D
Sbjct: 544 DSTSR---EGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYD 587

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 117/201 (58%), Gaps = 13/201 (6%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWE---- 56
           MW++RYQ  LEDG I  +S CL+    YSIGRSSKNPL IKNDKSISRQHIT KWE    
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 57  ---PSGQLHLVNQGKLTSVKERYLAIDESLIFNVVDT-KELDVHLGTNPVIVQIRWQPMN 112
                  L LVN+GKLTS+ ++++ + E+   N  D  K   + LGT P+ ++  W    
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 113 LYIPNMYEQFRGLLTKYGI--EVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKS 170
             IP    QFR +L++YGI  E++ + +  +  I+    + ++    L AL   IP+ KS
Sbjct: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS 180

Query: 171 QYLTEVSNMLRP---DNITFD 188
           ++L E+ N L P    N+ FD
Sbjct: 181 RFLMELCNTLLPTSKTNLKFD 201

 Score =  123 bits (308), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 90/240 (37%), Positives = 139/240 (57%), Gaps = 28/240 (11%)

Query: 537 TPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENND 596
           TP + VE IQ+ KNREV R++S+I  +  EEL+E+AIN+  NLAIVE + +L+R++ +++
Sbjct: 555 TPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSE 614

Query: 597 NTNKSTNSVVRHDSPDNIMN-VLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIR 655
             NK++ +  + +  +++M      R+NFK FVKV PK   +K +  N   +  +SDFIR
Sbjct: 615 G-NKTSRTTEKWE--NSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKN---NTQSSDFIR 668

Query: 656 NNAFLITRNYVPLKQYSKYDDSHGGKNGFNDEEMLEKEYVEYDNEEAGNGLSSTQHENEN 715
           N AFLITRNYVPLK+YSK D +   K G  + E +   +   + E  G+    + + N N
Sbjct: 669 NAAFLITRNYVPLKKYSKKDTT--TKWGTEENEDM---FALTEMERFGSNTFMSDNINSN 723

Query: 716 GVHLSATNQAHFQRSRSSQSSYNVDADEDSNEDDNIKSFSFSR---TSLPKEPAPNKLFV 772
            +          +RS++     N D+  +  ED    SFSFSR   T+   +P  NK+F+
Sbjct: 724 TIQ---------KRSQALNRFTNEDSSNEGEED----SFSFSRCSGTAASVQPLKNKIFI 770

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  147 bits (372), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 82/196 (41%), Positives = 118/196 (60%), Gaps = 10/196 (5%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEP-SG 59
           MW++RYQ  LEDG I  +S CL+ S +YSIGRSSKNPL IK+DKSISRQHIT+KW+  SG
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 60  ------QLHLVNQGKLTSVKERYLAIDESLIFNVVD-TKELDVHLGTNPVIVQIRWQPMN 112
                  L L+NQGKLTS+  +++ + E+ I   +  +    + LG  P+ +++ W+   
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120

Query: 113 LYIPNMYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYV--PLLALALGIPVFKS 170
             IP+   QFR  L+++GI   + I +  ++I       +D  V   L ALA  IP+ KS
Sbjct: 121 WNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKKS 180

Query: 171 QYLTEVSNMLRPDNIT 186
           Q L ++ N L   +IT
Sbjct: 181 QLLVKLCNTLLSASIT 196

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 133/260 (51%), Gaps = 48/260 (18%)

Query: 527 REDSKRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNA 586
           +E S R   + P S V+ IQ  K REV R++S+I  ++ +EL+E+AIN+   LAIVE+N 
Sbjct: 541 KEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANN 600

Query: 587 SLIRRTEN------NDNTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKND 640
            L+R+  +      + +T K  N V+R +         + R+NFK FVK +PK+   K  
Sbjct: 601 DLLRKLPDYRLNTVSSSTEKGGNGVIRQE--------WQRRKNFKTFVKAWPKFKAQKEG 652

Query: 641 SNNERGDNGASDFIRNNAFLITRNYVPLKQYSKYDDSHGGKNGFNDEEMLEKEYVEYDNE 700
           S N   D   SDFIR  AFLITRNYVPLK+YSK                 + +  ++D E
Sbjct: 653 SKN---DTQKSDFIRGAAFLITRNYVPLKKYSK-----------------KNKVTKWDKE 692

Query: 701 EAGNGLSSTQHE--NENGVHLSATNQAHFQRSRSSQSSYNVDADEDSNEDDNIKSFSFSR 758
           E+ +  + T+ E    N      TN     +   +Q  +  +   D+ E+D   SFSFSR
Sbjct: 693 ESDDMHALTEMEKIGSNAYISDTTNSTTIHKRPQTQRIFISEDSSDNGEED---SFSFSR 749

Query: 759 TSLPKEPAPN------KLFV 772
            S   + APN      KLF+
Sbjct: 750 GS---DAAPNAQPGTIKLFI 766

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  145 bits (367), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 117/201 (58%), Gaps = 13/201 (6%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWE---- 56
           MW++RYQ  LEDG I  +S CL+ S +YSIGRSSKN L IKNDKSISRQH+T KWE    
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 57  --PSG-QLHLVNQGKLTSVKERYLAIDESLIFNVVD-TKELDVHLGTNPVIVQIRWQPMN 112
             P G +L LVNQGKLTS+ ++++ + E+   +V   +   ++ LGT P+ ++  W    
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 113 LYIPNMYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPN--DYYVPLLALALGIPVFKS 170
             IP+   QF+ +L+++GI   + I  + + I       N  D    L AL   IP+ KS
Sbjct: 121 WNIPSNLAQFQTILSQFGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHTIPLKKS 180

Query: 171 QYLTEVSNMLRPD---NITFD 188
           Q L ++ N L      N+ FD
Sbjct: 181 QLLVDLCNSLLSSSVMNLKFD 201

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 98/254 (38%), Positives = 135/254 (53%), Gaps = 36/254 (14%)

Query: 527 REDSKRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNA 586
           RE S +    TP S VE IQ  KNREV R++S+I  ++ +EL+E+AIN+ +NLAIVE + 
Sbjct: 562 RELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSN 621

Query: 587 SLIR--RTENNDNTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNE 644
            L+R  R+  ++ T  S     R      I      R+NFK F KV+P    +K     +
Sbjct: 622 ELLRDPRSVGSNRTRSS----ARRSEKGAIRQEWPKRKNFKTFAKVWP---NSKTPKEGD 674

Query: 645 RGDNGASDFIRNNAFLITRNYVPLKQYSKYDDSHGGKNGFNDEEMLEKEYVEYDNEEAGN 704
           +G+N  SDFIR+ AFLITRNYVPLK+YSK D +                   +D E   +
Sbjct: 675 KGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASN-----------------WDKENNDD 717

Query: 705 GLSSTQHEN-ENGVHLSATNQAHFQRSRSSQSSYNVDADEDSNEDDNIK--SFSFSR--- 758
            L+ T+ EN E+  H+     A   + R    SY  D+    N  D++K  SFSFSR   
Sbjct: 718 VLALTEMENLESDTHIPDNTDASVIQER----SYAQDSVMKENNSDDMKERSFSFSRRSD 773

Query: 759 TSLPKEPAPNKLFV 772
           T+   +P  NKLFV
Sbjct: 774 TASTYQPVKNKLFV 787

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 83/199 (41%), Positives = 114/199 (57%), Gaps = 15/199 (7%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60
           MWILRY+  LEDG ++KVS CL++   YSIGRSSKNPL+IKNDKSISRQHITI+W+ + +
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 61  -----LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYI 115
                L +VNQGKLT++ E Y+  DES  F+      + V LGT PV+V+I W P+   +
Sbjct: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIFWDL 120

Query: 116 PNMYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPND-----YYVPLLALALGIPVFKS 170
              + QF   +   GI        + S++  + +  ND       +    L     + K 
Sbjct: 121 SKDFLQFEKSINSMGICTQ----MQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKP 176

Query: 171 QYLTEVSNMLRPDNIT-FD 188
             L+EV N+L  D  T FD
Sbjct: 177 VLLSEVCNVLLADCQTNFD 195

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 86/157 (54%), Gaps = 33/157 (21%)

Query: 537 TPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENND 596
           +P + +E +Q  K REV R+++ I  V   EL+E+AIN+ SNL IVESN +LIR      
Sbjct: 578 SPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRER---- 633

Query: 597 NTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRN 656
                     R D  D++ ++ +GRRNFK+F KV+P++                 D +RN
Sbjct: 634 ----------RADKNDSVNDMWKGRRNFKKFNKVWPQH-------------RDGYDSLRN 670

Query: 657 NAFLITRNYVPLKQY------SKYDDSHGGKNGFNDE 687
           NAFLI RNYV LK Y      +   D H G++ FNDE
Sbjct: 671 NAFLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFNDE 707

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 116/203 (57%), Gaps = 17/203 (8%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSG- 59
           MW++RYQ  +EDG I  +S CL+ S +YSIGRSSKN L IKNDKSISRQHIT KWE +G 
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 60  ------QLHLVNQGKLTSVKERYLAIDESLIFNVVDTKEL-DVHLGTNPVIVQIRWQPMN 112
                  L L+NQGKLTS+ +++L + E  I    +   L  + LGT+P  +++ W    
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 113 LYIPNMYEQFRGLLTKYGIEVTSDILQEDSHITAVV----MTPNDYYVPLLALALGIPVF 168
             IP+   +FR  L+++GI   S I  +D  I  ++     + ++    L AL   IP+ 
Sbjct: 121 WNIPSHLTEFRTTLSQFGISTESSI--DDGPINLMISDFPSSDDNGMRELYALVNAIPLK 178

Query: 169 KSQYLTEVSNMLRPD---NITFD 188
           K + L +V   L P    N+ FD
Sbjct: 179 KLRLLVDVCKTLLPASVRNLKFD 201

 Score =  139 bits (350), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 143/241 (59%), Gaps = 33/241 (13%)

Query: 537 TPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENND 596
           TP S VE IQ+ KNREV R +S+I  ++ +EL+E+ IN+  NLAIVE N  L+R+ +   
Sbjct: 547 TPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQ--- 603

Query: 597 NTNKSTNSVVRHDSPDNIMNVLEG----RRNFKRFVKVYPKY-IQNKNDSNNERGDNGAS 651
                TNS VR  +  N   ++      R+NFK F+KV+PK+ +QN+ +    +GD   S
Sbjct: 604 --ILGTNS-VRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGN----KGDTQNS 656

Query: 652 DFIRNNAFLITRNYVPLKQYSKYDDSHGGKNGFNDEEMLEKEYVEYDNEEAGNGLSSTQH 711
           DFIR+ AFLITRNYVPL++YSK + +    NG  +E+ML    +E +N  +  G+S    
Sbjct: 657 DFIRSAAFLITRNYVPLRKYSKNNKATEC-NGKENEDML--GLIEMENLVSNTGVSGN-- 711

Query: 712 ENENGVHLSATNQAHFQRSRSSQSSYNVDADEDSNEDDNIKSFSFSRTSLPKEPAPNKLF 771
                     T+ A  Q+   +Q+++    +ED +++ N +SFSFSR S   +PA NKLF
Sbjct: 712 ----------TSSAVIQQGPRTQNTF---INEDISDEGNQQSFSFSRHSDIAQPAKNKLF 758

Query: 772 V 772
           V
Sbjct: 759 V 759

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 56/143 (39%), Gaps = 30/143 (20%)

Query: 275 IVIVTDEDNGKRM----------IMNFECRNVKDIFDSFVKNDPK-----LLKSNLTETG 319
           I+++T   N +R+          ++NF+  N+K +++      P      L  +N TE G
Sbjct: 233 IIVLTTTSNERRLSATLRGLNVKLLNFD--NMKSLYEHVDGLKPSIKYLILTSTNKTENG 290

Query: 320 ------------VVSPKAPEIFENEKLMVEIQEPPIEAAITEESTSSKNLKHTPPEPVTT 367
                       V+    P I   + +  EIQ    E     +STSSK L HTP   V  
Sbjct: 291 QIQCTINGLITSVIEDALPAITNTKSVPCEIQNKKFERVSEVQSTSSKTL-HTPEIEVGP 349

Query: 368 HIXXXXXXXXXXXXPLESLDFFV 390
            I            PL+SL FF 
Sbjct: 350 AILKKRRLNRRRVQPLDSLSFFA 372

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 113/197 (57%), Gaps = 4/197 (2%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60
           MW+LRY Y  E G +KKVS C+ +++ Y+IGRSSKN L IKNDKSISRQH+++KW  S  
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60

Query: 61  -LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMY 119
            + L N GKLT   E+YL  +E LI    D  ++++ LG  PV + +        IPN  
Sbjct: 61  CIELTNTGKLTKSSEKYLGSNE-LITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSL 119

Query: 120 EQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVSNM 179
            QFR  L   GI+++ D    +S  T+++   +  Y  L A    I ++ S  LTE+ N 
Sbjct: 120 SQFRETLETLGIQISVDNANVNS--TSLITVGDFGYRELFAACNDINIYSSGLLTEICNK 177

Query: 180 LRPDNITFDTDVQKINS 196
           L  D+  FD + + + S
Sbjct: 178 LVNDHDNFDAEWRSMQS 194

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 83/160 (51%), Gaps = 20/160 (12%)

Query: 529 DSKRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASL 588
           D KR  +     +V+ +Q  K  EV RL S+I  ++  ELTE+AIN+ ++L +VE  A L
Sbjct: 541 DPKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADL 600

Query: 589 IRRTENNDNTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDN 648
           I RT+++ + N +T    ++            R+NFK+FVK+ PKY       + +    
Sbjct: 601 I-RTKSDISANNTTQQQWKN------------RKNFKKFVKICPKY------KSEQSSIE 641

Query: 649 GASDFIRNNAFLITRNYVPLKQYS-KYDDSHGGKNGFNDE 687
             S  IR +  ++TR ++  K     Y +SH  +N F DE
Sbjct: 642 SMSRHIRGSGEILTREFLQTKNVPVDYYNSHHDQNDFVDE 681

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 68/186 (36%), Positives = 106/186 (56%), Gaps = 11/186 (5%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60
           MWILRY+Y  EDG    +S CL++ + Y IGRS+K+PL IKNDKSISR+HI +K     +
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVNKENE 60

Query: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPM------NLY 114
           L+L+N GKLT++    L +D+SL F+     +L + LG  P+I  I WQ        +L 
Sbjct: 61  LNLLNTGKLTTLNAEVLMVDQSLNFH--PKGQLRLELGIKPIIATIEWQDQVWKVSHDLL 118

Query: 115 IPNMYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLT 174
             +M++  R     YGI VT+  +   +++  +    + Y   L +L  GI + +  +L+
Sbjct: 119 YNSMFK--RQEFNSYGISVTT-TMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLS 175

Query: 175 EVSNML 180
           +  + L
Sbjct: 176 DFQSHL 181

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 81/132 (61%), Gaps = 19/132 (14%)

Query: 540 SMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTN 599
           ++VE IQD K+REV+RL++++  +D  ELTE+AIN  SNLAIVE    LIR+       N
Sbjct: 574 ALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEK-KDLIRK-------N 625

Query: 600 KSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAF 659
                 +  D+      + EGR+NFK+F+KV P+       S  E  D+   + ++N+AF
Sbjct: 626 SERGHCISSDTC-----LWEGRKNFKKFIKVQPRR------SQRETFDSDGKNIVKNSAF 674

Query: 660 LITRNYVPLKQY 671
           LITR YVPLK++
Sbjct: 675 LITREYVPLKKF 686

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 111/203 (54%), Gaps = 10/203 (4%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKW--EPS 58
           MWI+ Y Y   D  +  VS CL+++  YSIGRS K+PL +KNDKSISRQH+T  W    +
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 59  GQLHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNM 118
            QL L+NQGKLT V  R L   E+L+FN       +V LG  PV+V   W      IP  
Sbjct: 61  NQLSLLNQGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120

Query: 119 YEQFRGLLTKYGIEVTSDILQEDSHITAVV-MTP----NDYYVPLLALAL--GIPVFKSQ 171
           ++QF   L  YG  +     Q++  IT V+ + P    N++    L  +L     + KS 
Sbjct: 121 FQQFESQLKDYGFNINFG-PQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIILKSS 179

Query: 172 YLTEVSNMLRPDNITFDTDVQKI 194
           +LT + N+L P+  TF+ D Q +
Sbjct: 180 FLTSLLNLLNPNVTTFNIDFQNL 202

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 115/207 (55%), Gaps = 14/207 (6%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60
           MW+LRYQY L+DG ++K+S C+     Y +GRSSKN LS++NDKSISRQ I+I+W+    
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 61  LHLV-NQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMY 119
             +V N GK+T V+ERYL+  E+L F   +   + + +GT P++V + W+          
Sbjct: 61  CIMVKNLGKVTMVEERYLSDGETLSFQSKNDL-VTMKIGTTPIVVNLSWEVKRCNYMKTD 119

Query: 120 EQFRGLLTKYGIEVTSDILQEDSH-----ITAVVMTPNDYYVPLLALALGIPVFKSQYLT 174
                LL  YG + T+    E+SH     I   V T +D Y+   ++     +  S+ L 
Sbjct: 120 MDMVHLLQSYGFQPTT---IENSHSLDMIIQNDVTTISDKYLKCYSMIHDTILINSKTLR 176

Query: 175 EV--SNMLRPDNITFDTDVQKINSMES 199
           ++  +N++      FD+   K+NS ES
Sbjct: 177 DILTNNIIMTKK--FDSYWVKLNSHES 201

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 106/192 (55%), Gaps = 26/192 (13%)

Query: 494 RSNSSEKSPMITQQVNDEKDEKISNAKALKIGK---------REDSKRYSETTPKSMVET 544
           +S S   S +I  Q+  E     SN KA++ GK         +  S    E     +V  
Sbjct: 473 KSTSDTSSVLIETQIAKE-----SNTKAIEYGKVRQKTLTDYKHTSDERIERPSVDLVHA 527

Query: 545 IQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNKSTNS 604
           IQDIK RE  R+++SI  +   ELTE+AIN+FS+L +V+ N  L +  + + + NK  N 
Sbjct: 528 IQDIKERETLRVKTSIVEIKENELTEEAINKFSDLTVVDINTRLFK--DKSLDINKPAN- 584

Query: 605 VVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAFLITRN 664
                S  N M+   G++NFK+FVK+ PKY   K    N +  +  S FIRN+A LITRN
Sbjct: 585 -----SNQNNMD-WSGKKNFKKFVKMVPKY---KRSQGNGQHADSCSTFIRNSAMLITRN 635

Query: 665 YVPLKQYSKYDD 676
           +VP+KQYSK D+
Sbjct: 636 FVPMKQYSKLDN 647

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 1/110 (0%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSK-NPLSIKNDKSISRQHITIKWEPSG 59
           MWILRY Y  ED G   VS CL+RS  YSIGRSSK N L IKNDKSISRQHI+ +W    
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60

Query: 60  QLHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQ 109
            + +VN GKLT + + +L   E+   ++  +KE ++ +G+ PVIV + W+
Sbjct: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWE 110

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 79/134 (58%), Gaps = 29/134 (21%)

Query: 540 SMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTN 599
           S+VETIQ +K+ E  RLQ ++  VD  ELT++AI +FSN+AIVE   +++R+        
Sbjct: 546 SLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRK-----KPA 600

Query: 600 KSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAF 659
             T S +R D P           NFK+F+KV+PK  +  NDS            +RNNA+
Sbjct: 601 MVTESSIRSDRP-----------NFKKFMKVWPK-ARKGNDS------------LRNNAY 636

Query: 660 LITRNYVPLKQYSK 673
           LITR+YVP+K Y++
Sbjct: 637 LITRDYVPMKAYNR 650

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 111/191 (58%), Gaps = 18/191 (9%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60
           M ILRY+  L DG +  VS CL   + Y+IGRSSKN  +IKNDKSISRQH+++ W+ S  
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSD 60

Query: 61  -----LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYI 115
                + + N GK+T +K++YL+ DE+L F ++D K+L+V++GT+P+ ++I  Q +   +
Sbjct: 61  DKNVIIQIKNFGKVTMIKDKYLSQDETLQFTLID-KKLEVNIGTSPITLEIFNQEV---V 116

Query: 116 PNMYEQFRGLLTKYGIEVTSDILQEDSHIT-----AVVMTPNDYYVPLLAL---ALGIPV 167
            N  E  +   +K  I    +ILQ+D          +++  N Y   LL L     GIP+
Sbjct: 117 CNSIEDIQNSDSKL-ILNNLNILQDDPLTLKREGPTIIIKENSYTDILLELFSNVFGIPI 175

Query: 168 FKSQYLTEVSN 178
              + L  ++N
Sbjct: 176 VTIEELRGIAN 186

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 93/184 (50%), Gaps = 27/184 (14%)

Query: 503 MITQQVNDEKDEKISNAKALKIGKREDSKRYSETTPKS---MVETIQDIKNREVTRLQSS 559
           +I +Q+N+    K ++A  ++  +R     Y  T   S   +V TIQ++K+R V R+ S 
Sbjct: 485 LIAEQINEALSAKTNDAPVVR--RRRTLLDYGNTDKSSSTDLVRTIQNVKSRGVDRVNSK 542

Query: 560 IAHVDAEELTEDAINEFSNLAIVESNASLIRRTENN----DNTNKSTNSVVRHDSPDNIM 615
           I  VD  EL E+ +N+F ++ +V+ N  L+++  N     DN N      + H+S     
Sbjct: 543 IVTVDENELNEEELNKFFDVVVVDVNDKLMKKHPNAQKVIDNAN------IDHNSN---- 592

Query: 616 NVLEGRRNFKRFVKVYPKYIQNKNDSNNE-RGDNGASDFIRNNAFLITRNYVPLKQYSKY 674
              + R+++K F K  PK+    N  ++    DNG +  +  N     RN +PL++Y++ 
Sbjct: 593 --FKNRKDYKLFKKSIPKWQSKLNKQHHSMTSDNGENLVVSKN-----RNKIPLRKYNEN 645

Query: 675 DDSH 678
           +  H
Sbjct: 646 EKIH 649

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  109 bits (272), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 90/333 (27%), Positives = 155/333 (46%), Gaps = 45/333 (13%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60
           MWILRYQY  E G   +VS CL++   Y +GRS K+PL IK DKSISR+H+ ++   + +
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60

Query: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPN--- 117
           L ++N GKLT +    + +D+ L F    +  L+  +G  PV   + ++P    IP+   
Sbjct: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALE--MGAGPVKGTVTYEPAIWKIPHDLA 118

Query: 118 MYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVS 177
           + E  +  L+ Y I+VT+ +  + S +  +      +   L AL   IP+    ++ +  
Sbjct: 119 ITESLKNHLSLYDIQVTNSLTSKTS-VQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDFV 177

Query: 178 NMLRPDNITFDTDVQKINSMESLKLVPXXXXXXXXXXXXQDYFFIITLNKSSVSEHADKS 237
           +      I FD   ++I    +LK  P            +   F++T           K+
Sbjct: 178 SQFADTQIDFDAKWEQI----TLKNAP-FLELQTKDAAFKGLNFVVT---------NQKT 223

Query: 238 FILRKSLQLIG-GEEEIIKDPTELQNSVTKILSTSGKNIVIV-----------TDEDNG- 284
           F + KS+   G G   +  D + L   + K + +  +N+VI+           ++++N  
Sbjct: 224 FAIYKSIIDAGSGNLWLCGDVSNLGTFIEKQIKS--ENVVILIHLIEEAPALASEQNNSM 281

Query: 285 ----------KRMIMNFECRNVKDIFDSFVKND 307
                     K   + F+ R+V DI D+ +KND
Sbjct: 282 HIQEAKLLKNKARSLGFKTRDVNDIVDAVLKND 314

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 108/215 (50%), Gaps = 32/215 (14%)

Query: 538 PKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDN 597
           P+S+++  Q+ K  EV RL+ ++A V +EELTE+AIN+  NLA VE    + R +E  +N
Sbjct: 525 PRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPEN 584

Query: 598 TNKSTNSVVRHDSPDNIMNVLEGRR-NFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRN 656
           +N+             + N    RR NFK+FVK++P +      S+    DN  +D +RN
Sbjct: 585 SNQRI-----------LTNPQWARRKNFKKFVKLWPSH------SSRSSPDN-ITDAVRN 626

Query: 657 NAFLITRNYVPLKQYSKYDDSHGGKNGFNDEEMLEKEYVEYDNEEAGNG-LSSTQHENEN 715
            A+LITR+YV L  Y    + +   +GF D    +    E  N  A  G L+    E EN
Sbjct: 627 KAYLITRDYVSLCPYDGTRN-NSADDGFGD-ACQQHAAAEQSNLTASPGNLALLGVEVEN 684

Query: 716 GVHLSATNQAHFQRSRSSQSSYNVDADEDSNEDDN 750
           G   +      FQ    SQ + N  A+   NE DN
Sbjct: 685 GPAFA------FQ----SQRAANSQANSLFNETDN 709

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 98/192 (51%), Gaps = 6/192 (3%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60
           MWILRYQY   +G    VS CL++ + YSIGRS+KNPL IK+DKSISR H+ ++ + S  
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60

Query: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPN--- 117
           + L   GKLT V  + +   + L F     +E+   +G +P+   +  Q     IP+   
Sbjct: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTA--DEEVLFEMGASPIKATVVKQQSFWKIPHDLS 118

Query: 118 MYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVS 177
           + +     L  + I+VT+  L   + I  +  +   +   L +L   IP+ +  ++ +  
Sbjct: 119 LSQSLSRHLADFDIQVTNS-LSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFV 177

Query: 178 NMLRPDNITFDT 189
             +   +  FD+
Sbjct: 178 TQINDVHADFDS 189

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 85/166 (51%), Gaps = 28/166 (16%)

Query: 538 PKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDN 597
           P S  + +++ K+ EV RL+  I +V +EELTE+AIN+   LA+VE+   L+R       
Sbjct: 520 PVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVETK-DLMRADREYAV 578

Query: 598 TNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYP-KYIQNKNDSNNERGDNGASDFIRN 656
             +S  S               GR+NFK+FVK++P +  +N  DS        A++ +RN
Sbjct: 579 CGQSGGS-----------EQWAGRKNFKKFVKLWPSRSSRNSPDS--------ATNALRN 619

Query: 657 NAFLITRNYVPLKQYSKYDDSHGGKNGFNDEEMLEKEYVEYDNEEA 702
            A LITR YVPL+ Y        G+N  N ++   K   +   EEA
Sbjct: 620 RAHLITREYVPLRPYE-------GQNANNQDDSFLKNSQDDLQEEA 658

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 100/405 (24%), Positives = 188/405 (46%), Gaps = 65/405 (16%)

Query: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60
           MWI+ + +  E     KV   L+  + YSIGRS+K    I+ DKSISR H+ IK++ S  
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGS-D 59

Query: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMYE 120
           L + N+GKLT   E  + +DE++   VV  +   +++G  P+ V +R+      IP+  E
Sbjct: 60  LIITNKGKLTKFNEEIIPLDETI---VVHNQNTVINIGGMPIDVNVRYFYEEWKIPHRLE 116

Query: 121 --QFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVSN 178
             + + L++ +G++++    ++ +  T +    + Y   L AL  G+PV   ++L ++  
Sbjct: 117 LNETKSLVSDFGVKLSESFSKKTT--TQICSDSSSYSGCLFALLKGVPVVSIEFLNQMGK 174

Query: 179 MLRPDN-ITFDTDVQKINSMESLKLVPXXXXXXXXXXXXQDYFFI--ITLNKSSVSEHAD 235
           +L+  N + F +  Q +  +   KL P              Y ++  +  N + +     
Sbjct: 175 LLQQGNYLDFQSMYQGL--LNRHKLFP-------------SYRYVPNVLSNMTLIVFEQK 219

Query: 236 KSFILRKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKRMIMNFECRN 295
               LR ++++ GG+ +++ + +EL     K LST+ +  V++    + K   MN E   
Sbjct: 220 MYDTLRYTIEVGGGDAKLLANSSELD----KFLSTNHEPAVVLGSSISQK---MNSESTK 272

Query: 296 V-----KDIFDSFVKNDPKLLKSN-----LTETGVVSPKAPEIFENEKLMVEIQEP-PIE 344
           +     K I ++ +++  KLL  N     L E  +   K  ++       V++  P P++
Sbjct: 273 LLEEFDKSIAETSLRHGVKLLNINQFVNILLENKINGLKKRDV-------VDLTSPSPVQ 325

Query: 345 AAITEESTSSKNLKHTPPEPVTTHIXXXXXXXXXXXXPLESLDFF 389
               + + +S N K T  +P                  L+SL+FF
Sbjct: 326 QKKIQSAKASVNGKKTKSKP--------------NIQSLDSLNFF 356

 Score = 35.4 bits (80), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 541 MVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLA 580
           ++  I + K +EV RLQ  I  VD  ELTE A+ +F + A
Sbjct: 594 IITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAA 633

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 106/211 (50%), Gaps = 32/211 (15%)

Query: 490 EQEKRSNSSEKSPMITQQVNDEKDEKISNAKALKIGKREDSKRYSETTPKSMVETIQDIK 549
           E EK +  S K  +  + + DEK E +SN +   +         S  +  S+V  I++IK
Sbjct: 477 EVEKSAEPSHKK-LKVEGIFDEKVE-MSNEQKYHLNAESKDSTLSTQSHSSIVNAIKEIK 534

Query: 550 NREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNKSTNSVVRHD 609
            REV+R++++I  +  +ELTE+AI + S LA+VES   ++R+T++    +  T +  RH 
Sbjct: 535 EREVSRIKTTIVEIGPDELTEEAICKLSTLAVVES-VDMLRKTQSR---HMKTETNKRH- 589

Query: 610 SPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAFLITRNYVPLK 669
                      RRNFKRFVKV+P Y+ NK    +  G    S+          R  VPLK
Sbjct: 590 ---------HVRRNFKRFVKVWPAYL-NKAICQDPMGAQRYSN----------RQCVPLK 629

Query: 670 QYSKYDDSHGGKNGFNDEEMLEKEYVEYDNE 700
            Y   +     KN   D++++++   E  N+
Sbjct: 630 VYEPMN-----KNELTDDQLVDENSSEEKND 655

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 94/201 (46%), Gaps = 10/201 (4%)

Query: 1   MWILRYQYGLEDG--GIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPS 58
           MWI + QY  +     +  +S  ++    Y +GR+SK+ L I +++ +SR H+ +K    
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKAN-R 58

Query: 59  GQLHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPN- 117
             + +   G    +  + +    S  F+   +  L + +G++ +  ++ W      +P+ 
Sbjct: 59  NIIEITLLGAQLKIGHKTIEKGISCEFHPKQSP-LRLEVGSHSIECKLLWTQWEFKVPSD 117

Query: 118 ---MYEQFRGLLTKYGIEVTSDILQEDSH-ITAVVMTPNDYYVPLLALALGIPVFKSQYL 173
               Y     +  + GI++   + +E SH I        DY   L AL  G+P+ +  +L
Sbjct: 118 LEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFL 177

Query: 174 TEVSNMLRPDNITFDTDVQKI 194
             +S++L  D + F++ V+++
Sbjct: 178 KGISSLLNSDTLKFESKVKEL 198

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 71/142 (50%), Gaps = 27/142 (19%)

Query: 531 KRYSETTP-KSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLI 589
           +R +   P +++V+ I+ IK REV R++++I  +  EELTEDAI +  +LAIV+    ++
Sbjct: 588 RRQAPAVPEQNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQP-VDML 646

Query: 590 RRTENNDNTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNG 649
           R+    D    S  +                R+N+K F KV+PKY+  KN          
Sbjct: 647 RQQHTVDTVGSSPLTFA--------------RKNYKNFKKVWPKYMNRKN---------- 682

Query: 650 ASDFIRNNAFLITRNYVPLKQY 671
            S   RN   +  R Y+PL+ Y
Sbjct: 683 -SPETRNATAISNRKYLPLELY 703

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 93/208 (44%), Gaps = 24/208 (11%)

Query: 1   MWILR--YQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPS 58
           MW+ +  YQ   + G ++ +S  L     + +GR+SK+ L I+ +K +SR H+ ++    
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVI-D 58

Query: 59  GQLHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPN- 117
             ++++  G    V     +    L F    +  + + +G++ V   + W      +PN 
Sbjct: 59  DHVNILLLGSQLKVGGEDASKGSVLPFGPSQSPVI-LEVGSHSVQCILEWAQWEFKVPNT 117

Query: 118 -------MYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPN----DYYVPLLALALGIP 166
                  + E  +GL    GI V +   +  +H    ++ P+    DY   L AL  GIP
Sbjct: 118 LLQEDPALLEVIKGL----GIRVVTSFSKATTH---HIIRPHEDDQDYEKYLFALVKGIP 170

Query: 167 VFKSQYLTEVSNMLRPDNITFDTDVQKI 194
           +   ++L + + +LR     FD  ++ I
Sbjct: 171 ILHLEFLKQFTALLRQPVTDFDPQLRSI 198

>KAFR0D02940 Chr4 complement(578907..581132) [2226 bp, 741 aa] {ON}
           Anc_2.430 YKL135C
          Length = 741

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 584 SNASLIRRTENNDNTNKSTNSVVR-HDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKND 640
           S  +L+R   NN+N  K   S++   DSP  ++     + NF   +  YP Y  N ND
Sbjct: 472 SLCNLLRHCSNNENMIKQVCSLLNTWDSPHVLLRTDNAKCNFIWLLGQYPAYFPNLND 529

>TBLA0B03720 Chr2 complement(857518..859401) [1884 bp, 627 aa] {ON}
           Anc_8.699 YPL169C
          Length = 627

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 711 HENENGVHLSATNQAHFQRSRSSQSSYNVDADEDSNEDDNIKSFSFSRTSLPKE 764
             N N + L   N+ H Q   +S+ +Y +      N D+ +KSF  S  +LP+E
Sbjct: 570 QANLNPIQLDTLNKLHLQTKLNSEYTYMLAEQSGWNYDNALKSFQSSINNLPRE 623

>AAL109W Chr1 (150547..153291) [2745 bp, 914 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL174C (NIP100)
          Length = 914

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 51/100 (51%), Gaps = 13/100 (13%)

Query: 270 TSGKNIVIVTDEDNGKRMIMNFECRNVKDIFDSFVKNDPKLLKSNLTETGVVSPKAPEIF 329
           T  K ++ +  E+N    +M+F+   V  +         KLL+++  ET VVS    E+ 
Sbjct: 613 TIEKILLAIIKENNLHERLMSFKTLEVMPVLSQLFLIVDKLLQNDAAET-VVS----ELQ 667

Query: 330 ENEKLMVEIQEPPIEAAITEESTSSKNL------KHTPPE 363
           E +K+M E +   +EA    ++TS K+L      +HTPPE
Sbjct: 668 ELQKIMAEAELELVEAPA--DATSEKSLDDLPPEEHTPPE 705

>NCAS0E01930 Chr5 complement(372023..375166) [3144 bp, 1047 aa] {ON}
           Anc_7.185
          Length = 1047

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 252 EIIKDPTELQNSVTKILSTSGKNIVIVTDEDN---GKRM--IMNFECRNVKDIFDSFVKN 306
           EI++D  E+ N +TK++ST   +   V D+ N   G ++     F     + +F ++   
Sbjct: 196 EIVQDSQEILNKLTKLISTPTPSFDCVLDKFNQLTGWKLHNFQYFGSETAETVFITYGTL 255

Query: 307 DPKLLKSNLTE---TGVVSPKAPEIFENEKLMVEI 338
           + +L +S + E    G++S + P  F+ EK + +I
Sbjct: 256 ESELFQSIINENSNLGLISIRIPLPFDLEKFVQQI 290

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 89,795,774
Number of extensions: 4348439
Number of successful extensions: 23862
Number of sequences better than 10.0: 788
Number of HSP's gapped: 24793
Number of HSP's successfully gapped: 888
Length of query: 856
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 738
Effective length of database: 39,950,811
Effective search space: 29483698518
Effective search space used: 29483698518
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)