Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B056705.434ON31831816950.0
NCAS0F033805.434ON31331411081e-152
Suva_8.1735.434ON31231410971e-151
YOR120W (GCY1)5.434ON31231210901e-149
NCAS0H020605.434ON32231110631e-145
Skud_15.2835.434ON31231910591e-145
Smik_15.2985.434ON31231210551e-144
KNAG0C049105.434ON31330910351e-141
NDAI0C016005.434ON31330610271e-140
Smik_4.6345.434ON31230810211e-139
TBLA0A02825singletonON31130810171e-138
Suva_2.5405.434ON31231210151e-138
YDR368W (YPR1)5.434ON31231210081e-137
CAGL0A02816g5.434ON3103129991e-136
Skud_4.6375.434ON3123129971e-135
Kpol_1062.295.434ON3113119771e-132
ZYRO0F10032g5.434ON3103189651e-131
KAFR0E03850singletonON3113039631e-130
CAGL0I01100g5.434ON3103179611e-130
SAKL0G02530g5.434ON3123129531e-129
TBLA0A065105.434ON3123129531e-129
KLLA0B14707gsingletonON3103089491e-128
TPHA0G00210singletonON3113009311e-125
KLTH0E15532gsingletonON3093149251e-124
TPHA0E017605.434ON3103059071e-122
KAFR0E038405.434ON3103118911e-119
TDEL0D00230singletonON3123098881e-119
KLTH0E00220gsingletonON3063088871e-119
KLTH0A00528gsingletonON3063088871e-119
Kwal_47.18084na 1ON3093158831e-118
TDEL0E019105.434ON3113088721e-116
KLLA0D10109gsingletonON3093208431e-112
KLTH0F16060g5.434ON3093038421e-112
TBLA0A02835singletonON3113088421e-112
KLTH0A03476gna 1ON3083148041e-106
Kwal_55.214265.434ON3083027871e-103
AER401W5.434ON3133147841e-103
SAKL0C10626gsingletonON3223185254e-64
KNAG0K020703.108ON3233205221e-63
NDAI0A070003.108ON3203075142e-62
KAFR0G013503.108ON3243164863e-58
NCAS0I024203.108ON3203054793e-57
KLTH0C10010g3.108ON3213254767e-57
Smik_2.2883.108ON3443264789e-57
Kwal_56.226113.108ON3213194741e-56
YBR149W (ARA1)3.108ON3443164752e-56
ZYRO0B06138g3.108ON3283204733e-56
Ecym_55085.409ON3263284672e-55
Smik_2.289singletonON3443224641e-54
Skud_2.2763.108ON3443164622e-54
KLLA0F02728g3.108ON3303264584e-54
SAKL0C09922g3.108ON3223184532e-53
Suva_4.3983.108ON3443264542e-53
TDEL0D051603.108ON3252954481e-52
KLTH0F16610g5.409ON3293374472e-52
NCAS0A066605.409ON3263334462e-52
CAGL0I01122g5.409ON3263334463e-52
KNAG0B03780singletonON3263304402e-51
TPHA0E018605.409ON3263334384e-51
NDAI0D016005.409ON3273354351e-50
SAKL0G01914g5.409ON3293294351e-50
ZYRO0A06336g5.409ON3273344342e-50
ACL107C5.409ON3543324274e-49
TBLA0F01720singletonON3263064159e-48
Kwal_55.215365.409ON3293324123e-47
KAFR0C05320singletonON3273344124e-47
Suva_15.3005.409ON3273394114e-47
TBLA0A00630singletonON3283134091e-46
KLLA0E21627g5.409ON3293294063e-46
Skud_8.1655.409ON3273363974e-45
YHR104W (GRE3)5.409ON3273363941e-44
Smik_8.1825.409ON3273393932e-44
TDEL0E021505.409ON3293383905e-44
KLLA0F03256g7.468ON2852843771e-42
Kpol_1013.827.468ON2852813711e-41
SAKL0F14278g7.468ON2862873692e-41
KNAG0D013707.468ON2822913683e-41
Kwal_47.182197.468ON2932813624e-40
KLTH0G05786g7.468ON2862813581e-39
Suva_12.1847.468ON2822803562e-39
Smik_10.3847.468ON2822963536e-39
CAGL0C04543g7.468ON2872813511e-38
YJR096W7.468ON2823023465e-38
KLLA0F05775g7.285ON3093273461e-37
Ecym_7160na 2ON2712773422e-37
Skud_10.3187.468ON2823003388e-37
Kwal_47.18893na 3ON2892983362e-36
TDEL0C033207.468ON2833093352e-36
ZYRO0G17600g7.468ON2833063353e-36
KLTH0G02420gna 3ON2893143353e-36
Smik_4.1137.285ON3123273355e-36
ABL209Cna 2ON3102783338e-36
Kwal_33.13276na 4ON3022953311e-35
NCAS0H005607.468ON2842953291e-35
KAFR0G009207.468ON2863153283e-35
CAGL0J09394g7.285ON3113253294e-35
Kpol_1020.137.285ON3133363285e-35
KLTH0F01892gna 4ON3022833251e-34
SAKL0F02574gna 3ON2893163231e-34
YDL124W7.285ON3123253172e-33
NCAS0A137407.285ON3092853154e-33
KNAG0C041107.285ON3113153092e-32
Skud_4.1317.285ON3123173076e-32
ZYRO0E09614gna 5ON3083163058e-32
NDAI0A023007.285ON3133243023e-31
Kwal_47.19278na 5ON3143113014e-31
KAFR0B012007.285ON3153042971e-30
SAKL0F09746g7.285ON3122882874e-29
TBLA0F019807.285ON3022722865e-29
SAKL0F00704gna 5ON3153102865e-29
Kpol_381.8singletonON3092842813e-28
ZYRO0C09196g7.285ON3122872761e-27
KLTH0G00638gna 5ON3133112692e-26
TDEL0D02790singletonON3292782692e-26
Ecym_32647.285ON3113012576e-25
Kwal_33.13274singletonON108951562e-12
Suva_4.1227.285ON2061831144e-06
Suva_12.272singletonON2652451013e-04
Ecym_22962.604ON340186950.002
NCAS0A129502.604ON32381930.003
KNAG0M023402.604ON309229900.007
TBLA0B10110singletonON345358900.009
TPHA0C025602.604ON340216870.021
ZYRO0F00858g2.604ON34696840.044
NCAS0C02450singletonON343262820.079
Suva_13.2102.604ON34481820.085
Kwal_26.83772.604ON33881800.15
NDAI0G01600singletonON344236760.45
TBLA0G01120singletonON343111750.56
Kpol_2000.109singletonON342231750.57
TBLA0E05040singletonON342163750.58
ADL119W7.195ON18558740.59
TPHA0E017905.429ON441148750.64
Suva_14.10na 6ON376118750.70
Kpol_449.4singletonON341277740.74
YBL037W (APL3)3.325ON1025144740.96
Suva_16.5107.534ON46585721.5
Skud_10.383na 7ON376118721.6
Kwal_26.9129singletonON53861712.3
AER053C4.246ON101388693.8
SAKL0D11308g1.464ON110139693.9
TDEL0A021502.440ON124981694.5
YNL331C (AAD14)na 6ON376118685.2
TPHA0I022707.146ON23446665.9
NCAS0B020608.562ON59566676.3
KNAG0L023802.54ON179366686.6
TDEL0C033507.472ON33583667.3
Ecym_44787.149ON64473669.0
Skud_13.2202.631ON501108669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05670
         (318 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   657   0.0  
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     431   e-152
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   427   e-151
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   424   e-149
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     414   e-145
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   412   e-145
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   410   e-144
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   403   e-141
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   400   e-140
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   397   e-139
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     396   e-138
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   395   e-138
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   392   e-137
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   389   e-136
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   388   e-135
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   380   e-132
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   376   e-131
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     375   e-130
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   374   e-130
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   371   e-129
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   371   e-129
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   370   e-128
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 363   e-125
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   360   e-124
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   353   e-122
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   347   e-119
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   346   e-119
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   346   e-119
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   346   e-119
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   344   e-118
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   340   e-116
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   329   e-112
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   328   e-112
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     328   e-112
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   314   e-106
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   307   e-103
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   306   e-103
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   206   4e-64
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   205   1e-63
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   202   2e-62
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   191   3e-58
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   189   3e-57
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   187   7e-57
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   188   9e-57
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   187   1e-56
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   187   2e-56
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   186   3e-56
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   184   2e-55
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   183   1e-54
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   182   2e-54
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   181   4e-54
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   179   2e-53
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   179   2e-53
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   177   1e-52
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   176   2e-52
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             176   2e-52
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   176   3e-52
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               174   2e-51
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   173   4e-51
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               172   1e-50
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   172   1e-50
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   171   2e-50
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   169   4e-49
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     164   9e-48
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   163   3e-47
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   163   4e-47
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   162   4e-47
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     162   1e-46
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   160   3e-46
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   157   4e-45
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   156   1e-44
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   155   2e-44
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   154   5e-44
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   149   1e-42
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   147   1e-41
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   146   2e-41
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   146   3e-41
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   144   4e-40
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   142   1e-39
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   141   2e-39
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   140   6e-39
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   139   1e-38
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   137   5e-38
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   137   1e-37
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   136   2e-37
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   134   8e-37
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   134   2e-36
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   133   2e-36
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   133   3e-36
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   133   3e-36
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   133   5e-36
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   132   8e-36
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   132   1e-35
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   131   1e-35
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   130   3e-35
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   131   4e-35
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   130   5e-35
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   129   1e-34
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   129   1e-34
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   126   2e-33
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   125   4e-33
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   123   2e-32
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   122   6e-32
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   122   8e-32
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     120   3e-31
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   120   4e-31
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   119   1e-30
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   115   4e-29
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   114   5e-29
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   114   5e-29
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   112   3e-28
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   110   1e-27
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   108   2e-26
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     108   2e-26
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   103   6e-25
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    65   2e-12
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    49   4e-06
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    44   3e-04
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    41   0.002
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    40   0.003
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    39   0.007
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    39   0.009
TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.6...    38   0.021
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    37   0.044
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    36   0.079
Suva_13.210 Chr13 complement(341369..342400) [1032 bp, 344 aa] {...    36   0.085
Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C...    35   0.15 
NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON}               34   0.45 
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    33   0.56 
Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]...    33   0.57 
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             33   0.58 
ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No...    33   0.59 
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    33   0.64 
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    33   0.70 
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    33   0.74 
YBL037W Chr2 (147209..150286) [3078 bp, 1025 aa] {ON}  APL3Alpha...    33   0.96 
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    32   1.5  
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    32   1.6  
Kwal_26.9129 s26 complement(1087291..1088907) [1617 bp, 538 aa] ...    32   2.3  
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...    31   3.8  
SAKL0D11308g Chr4 (942247..945552) [3306 bp, 1101 aa] {ON} conse...    31   3.9  
TDEL0A02150 Chr1 complement(384458..388207) [3750 bp, 1249 aa] {...    31   4.5  
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    31   5.2  
TPHA0I02270 Chr9 complement(505077..505781) [705 bp, 234 aa] {ON...    30   5.9  
NCAS0B02060 Chr2 (338287..340074) [1788 bp, 595 aa] {ON}               30   6.3  
KNAG0L02380 Chr12 (420356..425737) [5382 bp, 1793 aa] {ON}             31   6.6  
TDEL0C03350 Chr3 complement(594741..595748) [1008 bp, 335 aa] {O...    30   7.3  
Ecym_4478 Chr4 complement(971356..973290) [1935 bp, 644 aa] {ON}...    30   9.0  
Skud_13.220 Chr13 (372489..373994) [1506 bp, 501 aa] {ON} YMR064...    30   9.6  

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60
           MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA
Sbjct: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60

Query: 61  QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR 120
           QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR
Sbjct: 61  QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR 120

Query: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN 180
           SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN
Sbjct: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN 180

Query: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETI 240
           LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETI
Sbjct: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETI 240

Query: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKE 300
           NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKE
Sbjct: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKE 300

Query: 301 KGELRVVDPDWSPFPLFK 318
           KGELRVVDPDWSPFPLFK
Sbjct: 301 KGELRVVDPDWSPFPLFK 318

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  431 bits (1108), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 253/314 (80%), Gaps = 6/314 (1%)

Query: 5   QVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGK 64
           + S   LKL+TGA+IP+I LGTWRS+G  D Y SVIAALK GYRHIDTAAIYGNE QVGK
Sbjct: 6   KASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGK 65

Query: 65  AIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKD 124
           AIRDSG+PR EIFVTSKLW  Q H+P  AL  TL RLGLDY+DLYLMHWPVTFN R++K 
Sbjct: 66  AIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVKG 125

Query: 125 EDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDL 184
            D     FM IP + NG  D+EMDTWNF+KTWELMQ LP +G TKAVGVSNFSINNL +L
Sbjct: 126 TD-----FMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 185 LAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIA 244
           L +   K+ PAANQIE+HPLL +++L+++C+EK I++EAYSP GSINAPILK+  I  I+
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 245 KKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGEL 304
           KKLD+   Q+++SWH+QR GYVVL KS HEERIIANRKV TL  EDF+AI NL KEKG L
Sbjct: 241 KKLDVPPAQLIISWHVQR-GYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTL 299

Query: 305 RVVDPDWSPFPLFK 318
           RVVDPDWSPFPLFK
Sbjct: 300 RVVDPDWSPFPLFK 313

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  427 bits (1097), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 249/314 (79%), Gaps = 7/314 (2%)

Query: 5   QVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGK 64
           Q S   L L+TGA IPQ+GLGTW+S   NDAY SV+AALK+GYRHIDTAAIYGNE QVG+
Sbjct: 6   QYSTKTLPLNTGAKIPQVGLGTWQS-KDNDAYKSVVAALKDGYRHIDTAAIYGNEDQVGQ 64

Query: 65  AIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKD 124
           AI+DSGVPR EIFVT+KLWC Q H+P  AL+Q+LKRLGLDY+DLYLMHWPV  +P  IKD
Sbjct: 65  AIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPNYIKD 124

Query: 125 EDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDL 184
                   ++IPT  +G+  V++  WNFIKTWELMQ LP++ KT+AVGVSNFSINNL DL
Sbjct: 125 -----GHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDL 179

Query: 185 LAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIA 244
           LA+   ++ PAANQ+ELHPLL QNEL+ +CK K I+VEAYSP GS +AP+LK+  +  IA
Sbjct: 180 LASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIA 239

Query: 245 KKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGEL 304
           KK ++Q G VV+SWH QR GYVVLPKSV+ +RI  NRKV TL DEDF+AINN+ KEKGE 
Sbjct: 240 KKNNVQPGHVVISWHAQR-GYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEK 298

Query: 305 RVVDPDWSPFPLFK 318
           RVV+PDWSPF  FK
Sbjct: 299 RVVNPDWSPFEAFK 312

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  424 bits (1090), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 251/312 (80%), Gaps = 7/312 (2%)

Query: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66
           S  IL L+TGA IPQIGLGTW+S   NDAY +V+ ALK+GYRHIDTAAIY NE QVG+AI
Sbjct: 8   STKILSLNTGAQIPQIGLGTWQS-KENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI 66

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
           +DSGVPR EIFVT+KLWC Q H+P++AL+Q+LKRLGLDY+DLYLMHWP   +P  IK+ED
Sbjct: 67  KDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNED 126

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
                 +++PT  +G+  V++  WNFIKTWELMQ LP++GKTKAVGVSNFSINNL DLLA
Sbjct: 127 -----ILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLA 181

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
           +   K+ PAANQ+E+HPLL Q+EL+ +CK K I+VEAYSP GS +AP+LK+  I  IAKK
Sbjct: 182 SQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKK 241

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
            ++Q G VV+SWH+QR GYVVLPKSV+ +RI  NRK+ TL  EDF+AINN+ KEKGE RV
Sbjct: 242 NNVQPGHVVISWHVQR-GYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300

Query: 307 VDPDWSPFPLFK 318
           V P+WSPF +FK
Sbjct: 301 VHPNWSPFEVFK 312

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  414 bits (1063), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 238/311 (76%), Gaps = 6/311 (1%)

Query: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66
           S    KL+TGA+I  +GLGTW+S   N+ Y +VIAALK GYRHIDTAAIYGNE QVGKAI
Sbjct: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI 76

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
            DSGVPR EIFVT+KLW  Q HDP   LN +LKRLGLDY+DLYLMHWPVT NPRSIKD +
Sbjct: 77  NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
                F++IP   +G  DVE+DTW+++KTWELMQ LP++GKT+AVGVSNFSINNL  +L+
Sbjct: 137 -----FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
           +   KVVPA NQ+E+HPLL Q ELL++C  K IL+EAYSP GS NAPIL +  +  +AKK
Sbjct: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
             +Q  Q+V+SWH+QR GY+VLPKSVH ERI AN K + L DE+ + INN+ KEKGE R+
Sbjct: 252 HGVQTAQIVISWHVQR-GYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRI 310

Query: 307 VDPDWSPFPLF 317
           V P W PF  F
Sbjct: 311 VQPHWEPFVPF 321

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  412 bits (1059), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 201/319 (63%), Positives = 248/319 (77%), Gaps = 8/319 (2%)

Query: 1   MPSP-QVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNE 59
           MP+  Q S   L L+TGA IPQ+GLGTW+S   NDAY SV+AALK+GYRHIDTAAIY NE
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKDGYRHIDTAAIYRNE 59

Query: 60  AQVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNP 119
            QVG+AIRDSGVPR +IFVT+KLWC Q H+P  AL+Q+L+RLGLDY+DLYLMHWPV  +P
Sbjct: 60  DQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDP 119

Query: 120 RSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSIN 179
             IKD +      +++PT  +G+  V++  WNFIKTWELMQ LP++GK KAVGVSNFSIN
Sbjct: 120 DYIKDGN-----ILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSIN 174

Query: 180 NLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDET 239
           NL DLLA+   K+ PAANQ+E+HPLL QNEL+ +C+ K I++E YSP GS +AP+LK+  
Sbjct: 175 NLKDLLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPV 234

Query: 240 INAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVK 299
           I  IAKK ++Q   VV+SWH QR GYVVLPKSV+ +R+ ANRK+ TL DEDF+AIN + K
Sbjct: 235 ILEIAKKNNVQPAHVVISWHAQR-GYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISK 293

Query: 300 EKGELRVVDPDWSPFPLFK 318
            KGE RVV P+WSPF  FK
Sbjct: 294 AKGEKRVVHPNWSPFEAFK 312

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  410 bits (1055), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 247/312 (79%), Gaps = 7/312 (2%)

Query: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66
           S   L L+TGA IPQ+GLGTW+S   NDAY SV+AALK GY+HIDTAAIY NE QVG+AI
Sbjct: 8   STKTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI 66

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
           +DSGVPR EIFVT+KLW  Q H+P  AL+++L+RLGLDY+DLYL+HWP   +   IKD D
Sbjct: 67  KDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYIKDGD 126

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
                 +++PT ++G+  V++  WNFIKTWELMQ LP++GKTKA+GVSNFSINNL DLLA
Sbjct: 127 -----ILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLA 181

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
           +   K+ PAANQ+E+HPLL QNEL+ +CK K I++EAYSP GS +AP+LK+ TI  IAKK
Sbjct: 182 SPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKK 241

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
            ++Q G VV+SWH QR GYVVLPKSV+ +RI  NRK+ TL +EDF+AINN+ KEKGE RV
Sbjct: 242 NNVQPGHVVISWHAQR-GYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300

Query: 307 VDPDWSPFPLFK 318
           V+P+WSPF  FK
Sbjct: 301 VNPNWSPFEAFK 312

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  403 bits (1035), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 239/309 (77%), Gaps = 6/309 (1%)

Query: 9   NILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD 68
           ++LKL+TGA+I  IGLGTWRS    DAY SVIAAL+ GYRHIDTAAIYGNEA+VG+AIR+
Sbjct: 10  SLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEVGRAIRE 69

Query: 69  SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGS 128
           SGVPR EIFVT+KLWC Q  +P+LAL+Q+LKRLGLDY+DLYLMHWPV     ++ + D  
Sbjct: 70  SGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENMPEGDKI 129

Query: 129 GDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAAS 188
           G      PT  NG  D+++  WNF+KTWELMQ LPE+GKT+A+GVSNFSINNL DLLA+ 
Sbjct: 130 G-----FPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASP 184

Query: 189 TTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLD 248
             K+VPAANQ+E+HPLL Q EL+ +C  K I++EAYSP GS +APILK+  I  IAKK  
Sbjct: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKNG 244

Query: 249 IQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVD 308
           +   QVV+SW++QR GY+VLPKSV++ERI AN    TL  EDF+A+NN+ K +G  R++D
Sbjct: 245 VSAAQVVISWNVQR-GYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIID 303

Query: 309 PDWSPFPLF 317
           PDW PF  F
Sbjct: 304 PDWEPFKPF 312

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  400 bits (1027), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 238/306 (77%), Gaps = 6/306 (1%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSGV 71
           KL+TGA+IP +GLGTW+S   N+ Y +V+ ALK GYRHIDTAAIY NE QVGKAI DSG+
Sbjct: 13  KLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNEDQVGKAINDSGI 72

Query: 72  PRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDA 131
           PR EIFVT+KLW  Q  DP+ ALNQ+L+RLGLDY+DLYLMHWPV F P SIKD +     
Sbjct: 73  PREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKPDSIKDGN----- 127

Query: 132 FMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTTK 191
           + T+P   NG  D+++ TWNF+KTWELMQ LP++GKT+AVGVSNFSINNL  LL++   K
Sbjct: 128 YSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKALLSSPGNK 187

Query: 192 VVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQV 251
           +VPAANQ+E HPLL Q+EL ++CKEK I++EAYSP GS NAPIL +  I  IAKK ++Q 
Sbjct: 188 LVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIAKKHNVQP 247

Query: 252 GQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPDW 311
            QVV+SWH+Q+ G+VVLPKSVHEERI AN +   L  ++  ++NNL KEKGE R+V P+W
Sbjct: 248 AQVVISWHVQK-GHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERRIVQPNW 306

Query: 312 SPFPLF 317
           +PF  F
Sbjct: 307 APFVPF 312

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  397 bits (1021), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 193/308 (62%), Positives = 242/308 (78%), Gaps = 7/308 (2%)

Query: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSG 70
           LKL+TGASIP +G GTWRSV  N+ YHSVIAALK GYRHID AAIY NE +VG+AI+DSG
Sbjct: 12  LKLNTGASIPVLGFGTWRSV-ENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSG 70

Query: 71  VPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGD 130
           VPR +IF+T+KLW  +  DP+ ALN++LKRLGLDY+DLYLMHWPV     +I D +    
Sbjct: 71  VPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDGN---- 126

Query: 131 AFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT 190
             + IPT  +G VDV+   WNFIKTW+LMQ LP++GKTKAVGVSNFSINN+  LL + + 
Sbjct: 127 -VLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSN 185

Query: 191 KVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQ 250
           K+VPAANQIE+HPLL QNEL+ +CKEK I+VEAYSPFGS+NAP+L+++ I  +AKK  + 
Sbjct: 186 KLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVA 245

Query: 251 VGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPD 310
             Q+++SW IQR GYVVL KSV+ ERI++N K+ TLP++DF+ I+NL K  GE RVVD  
Sbjct: 246 PAQLIISWSIQR-GYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMK 304

Query: 311 WSPFPLFK 318
           WS FP+FK
Sbjct: 305 WSSFPIFK 312

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  396 bits (1017), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 196/308 (63%), Positives = 236/308 (76%), Gaps = 8/308 (2%)

Query: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSG 70
           +KL+TGA+IP IGLGTWRS   ND Y SVIAA K GYRHIDTAAIYGNE QVGKAI + G
Sbjct: 12  VKLNTGANIPAIGLGTWRS-ENNDGYDSVIAAAKVGYRHIDTAAIYGNEDQVGKAINECG 70

Query: 71  VPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGD 130
           V R+E+FVT+KLW  Q  DP+ ALNQ+LKRLGLDY+DLYL+HWPV F   +IKD +    
Sbjct: 71  VTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTDTIKDGN---- 126

Query: 131 AFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT 190
             +TIP   +G  D++   WNFIKTWELMQ+L ++GKTKA+G+SNFSINN+ +LLAA TT
Sbjct: 127 -LLTIP-KKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELLAAPTT 184

Query: 191 KVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQ 250
            V PA NQ+E+HPLL Q+EL+ +CKEK I++EAYSP G INAP+LKDETI  IAK+ ++ 
Sbjct: 185 TVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAKRNNVD 244

Query: 251 VGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPD 310
            GQVV SWH+QR GYVVLPKSV E RII+N K  TL D+D   INNLVK KGE R  D  
Sbjct: 245 AGQVVTSWHVQR-GYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRTCDLG 303

Query: 311 WSPFPLFK 318
              FP+F+
Sbjct: 304 IKGFPMFQ 311

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  395 bits (1015), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 190/312 (60%), Positives = 243/312 (77%), Gaps = 7/312 (2%)

Query: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66
           S   LKL+TGASIP +G GTWRSV  N  YHSVIAALK GYRHID AAIY NE +VGKAI
Sbjct: 8   SSATLKLNTGASIPVLGFGTWRSVD-NSGYHSVIAALKAGYRHIDAAAIYLNEEEVGKAI 66

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
           +DSGVPR EIF+T+KLW  +  DP+ AL+++LKRLGLDY+DLYLMHWPV     +I D D
Sbjct: 67  KDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTDTITDGD 126

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
                F+ IPT  +G +DV+   WNF+KTW+LMQ LP++GKTKAVGVSNFSINN+ +LL 
Sbjct: 127 -----FLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELLK 181

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
           + + K+VPA NQIE+HPLL Q+EL+ +CKEK I+VEAYSPFGS NAP+LK++ I  +AKK
Sbjct: 182 SPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
             ++  Q+++SW IQR GYVVL KSV+ ER+++N K+ TLP++DF+ I+NL K  GE RV
Sbjct: 242 HGVEPAQLIISWSIQR-GYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRV 300

Query: 307 VDPDWSPFPLFK 318
           V+  W+ FP+F+
Sbjct: 301 VNMQWNSFPIFE 312

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  392 bits (1008), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 191/312 (61%), Positives = 239/312 (76%), Gaps = 7/312 (2%)

Query: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66
           S   LKL+TGASIP +G GTWRSV  N+ YHSVIAALK GYRHID AAIY NE +VG+AI
Sbjct: 8   SSATLKLNTGASIPVLGFGTWRSVD-NNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
           +DSGVPR EIF+T+KLW  +  DP+ ALN++LKRLGLDY+DLYLMHWPV      + D +
Sbjct: 67  KDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGN 126

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
                 + IPT  +G VD++   WNFIKTWELMQ LP++GKTKAVGVSNFSINN+ +LL 
Sbjct: 127 -----VLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLE 181

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
           +   KVVPA NQIE+HPLL Q+EL+ +CKEK I+VEAYSPFGS NAP+LK++ I  +AKK
Sbjct: 182 SPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
             ++  Q+++SW IQR GYVVL KSV+ ERI++N K+ TLP++DF+ I+NL K  G  RV
Sbjct: 242 HGVEPAQLIISWSIQR-GYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300

Query: 307 VDPDWSPFPLFK 318
           VD  W  FP+F+
Sbjct: 301 VDMKWGSFPIFQ 312

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  389 bits (999), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 186/312 (59%), Positives = 234/312 (75%), Gaps = 7/312 (2%)

Query: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66
           S   LKL+TGA IP +GLGTWRS   ND Y SV+AALK GYRHID AAIYGNE QVG+AI
Sbjct: 6   STATLKLNTGAEIPVVGLGTWRSAA-NDGYDSVLAALKLGYRHIDAAAIYGNEDQVGRAI 64

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
           +DSGVPR EIF+T+KLW  +  +P  AL+ +LKRLGLDY+DLYLMHWPV       +++D
Sbjct: 65  KDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGSEEKD 124

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
                 + IP   +G  D++++ W+FIKTWELMQ LP++GKTKA+GVSNFSINNL  L  
Sbjct: 125 -----LLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKN 179

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
           +     VPAANQ+E+HPL  Q EL++YCK +NIL+EAYSPFGS +AP+LK+  ++ +A+K
Sbjct: 180 SPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEK 239

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
            +I   Q+++SW +QR GYVVLPKSVH ERI AN KV+TL DED + I NL K KGE R+
Sbjct: 240 YNISTAQLIISWSVQR-GYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRL 298

Query: 307 VDPDWSPFPLFK 318
           V  DWSPFP F+
Sbjct: 299 VQLDWSPFPTFE 310

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  388 bits (997), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 185/312 (59%), Positives = 242/312 (77%), Gaps = 7/312 (2%)

Query: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66
           S   LKL+TGASIP +G GTWRSV  N+ YHSVIAALK GYRHID AAIY NE +VG+AI
Sbjct: 8   SSATLKLNTGASIPALGFGTWRSVD-NNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI 66

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
           +DSG+ R EIF+T+KLW  +  DP+ ALN++LKRLGLDY+DLYLMHWPV     ++ D +
Sbjct: 67  KDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVTDGN 126

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
                 + IPT  +G VDV+   WNFIKTW+LMQ LP++GKT+AVGVSNFSINN+ +LL 
Sbjct: 127 -----VLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLK 181

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
           + + K+VPA NQ+E+HPLL Q+EL+ +CKEK I+VEAYSPFGS NAP+LK++ I  +AKK
Sbjct: 182 SPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
             ++  Q+++SW IQR GYVVL KSV+ ER+++N K+ TLP++DF+AI +L K  GE RV
Sbjct: 242 HGVEPSQLIISWSIQR-GYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300

Query: 307 VDPDWSPFPLFK 318
           V+  W+ FP+F+
Sbjct: 301 VNMKWASFPIFE 312

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  380 bits (977), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 187/311 (60%), Positives = 232/311 (74%), Gaps = 6/311 (1%)

Query: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66
            E  +KL+TGA +P +GLGTW+S+  NDAY +V+ ALK GYRHID AAIY NE +VGKAI
Sbjct: 6   CETRVKLNTGAELPAVGLGTWQSL-ENDAYKAVLTALKTGYRHIDGAAIYCNEGEVGKAI 64

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
           RDSGVPRNEIFVT+KLW  Q   P+LAL Q+L+RLGLDY+DLYL+HWP+  NP   ++  
Sbjct: 65  RDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQCEE-- 122

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
            SG+ ++T P   NG  DV++DTWNF+KTWELMQ LP +GK KAVGVSNFSINN+ +LL+
Sbjct: 123 -SGN-YLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLS 180

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
           +   K+VPA NQIELHPLL Q EL+ +CKEK I+VEAYSP G   A ILK+  +  +AKK
Sbjct: 181 SPGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKK 240

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
            +I    +V+SW +QR G VVLPKSV E RII+N + +TL  ED + I NL KEKGE R 
Sbjct: 241 YNIPAANLVVSWDVQR-GVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRT 299

Query: 307 VDPDWSPFPLF 317
             PD+SPF  F
Sbjct: 300 CAPDFSPFNTF 310

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  376 bits (965), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 236/318 (74%), Gaps = 8/318 (2%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60
           M + Q S + LKL+TG +IPQ+GLGTWRS   N+ Y +VI ALK GYRHID AA+YGNE 
Sbjct: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRS-KENEGYKAVIEALKAGYRHIDGAAVYGNEG 59

Query: 61  QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR 120
           +VGKAI+DSGVPRNEIF+T+KLWC Q  +P+ AL+Q+L+RLGLDY+DLYL+HWPV     
Sbjct: 60  EVGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTE 119

Query: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN 180
           +IKD  G+   F   P D + +VD+E   WNFIKTWELMQ L ESGKTKA+GVSNFS+NN
Sbjct: 120 NIKD--GNLFQFAEKP-DGSKDVDLE---WNFIKTWELMQKLLESGKTKAIGVSNFSVNN 173

Query: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETI 240
           L DLLAA TTKV PA NQ+ELHPLL Q +L+++ KE  I++EAYSP G  NAPIL D T+
Sbjct: 174 LKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTV 233

Query: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKE 300
             IAK   ++ G VV+SW +Q+ G V LPKSV   RI+ N KV+TL D D   ++ L+K 
Sbjct: 234 QEIAKANGVEAGHVVISWAVQK-GLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKA 292

Query: 301 KGELRVVDPDWSPFPLFK 318
           KGE R    D+SPFP+F+
Sbjct: 293 KGERRTCYQDFSPFPIFQ 310

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  375 bits (963), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 177/303 (58%), Positives = 234/303 (77%), Gaps = 8/303 (2%)

Query: 16  GASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSGVPRNE 75
           GAS+P +GLGTWR+    + Y++V +AL+ GYRHIDTAAIY NE  VG+AIR+SG+PR+E
Sbjct: 17  GASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNEEVVGRAIRESGIPRDE 76

Query: 76  IFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDAFMTI 135
           IFVT+KLW  Q  DP  AL+Q+L+RLGLDY+DLYLMHWPV    +  K       + +  
Sbjct: 77  IFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEAKYSK-----SSSLLEF 131

Query: 136 PTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTTKVVPA 195
           P   +G++ VE D W+FIKTWELMQ LP++ KT+A+GVSNFSINN+NDLL +   K+VPA
Sbjct: 132 PYRPDGSLAVESD-WDFIKTWELMQELPKT-KTRAIGVSNFSINNINDLLKSPGNKIVPA 189

Query: 196 ANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQVGQVV 255
           ANQ+ELHPLL Q EL+ +C+EK I+VEAYSPFGS++AP+L ++ I  +AKK D+   QV+
Sbjct: 190 ANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVAKKHDVSAAQVI 249

Query: 256 MSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPDWSPFP 315
           +SWHI+R G  VLPKSVH+ER+++N K  +LP++DF  INN+ KEKGE RVV+ DWSPF 
Sbjct: 250 LSWHIKR-GIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKRVVNFDWSPFK 308

Query: 316 LFK 318
           +F+
Sbjct: 309 IFE 311

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  374 bits (961), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 184/317 (58%), Positives = 233/317 (73%), Gaps = 8/317 (2%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60
           M +   + + LKL+TGA IP IGLGTW+S   N+ Y++ + ALK GYRHIDTAAIY NE 
Sbjct: 1   MAALHKNTSTLKLNTGAHIPVIGLGTWQS-SENEGYNATLEALKAGYRHIDTAAIYKNEE 59

Query: 61  QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR 120
           ++G+AIRDS +PRNE+FVT+KLW  Q  +P  AL+Q+LKRLGLDY+DLYLMHWPV     
Sbjct: 60  EIGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTD 119

Query: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN 180
            IKD +      + IP   +G+ DV+++ WNF+KTWELMQ LP+  K +A+GVSNFSINN
Sbjct: 120 LIKDGN-----LLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINN 173

Query: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETI 240
           L +LL +   KVVPAANQIE+HPLL Q+EL+ +CKEK I++EAYSP GS +APILK+E I
Sbjct: 174 LKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEI 233

Query: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKE 300
             IAKK  +  GQ+V+SWH QR GYVVLPKSV  ERI  N++   L DEDF  ++N  K+
Sbjct: 234 TEIAKKNGVNAGQLVISWHAQR-GYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKK 292

Query: 301 KGELRVVDPDWSPFPLF 317
            GE RVV P+W PF  F
Sbjct: 293 HGERRVVSPNWGPFKPF 309

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  371 bits (953), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 178/312 (57%), Positives = 237/312 (75%), Gaps = 7/312 (2%)

Query: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66
           S   +KL+TGA IPQ+GLGTWRS    +AY+SV++A+K GYRHID+AAIYGNE  VGKAI
Sbjct: 8   SSATVKLNTGAIIPQLGLGTWRS-SDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI 66

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
           RDSGVPRNE+FVT+KLW  Q  +P+ AL+ +LKRLGLDY+DLYL+HWP+ F   +IKD+D
Sbjct: 67  RDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKDDD 126

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
                ++T+PT  +G  DV++  WNF+KTWEL+Q LP +GK KAVGVSNFS+NNL +LLA
Sbjct: 127 -----YLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLA 181

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
           +   K+VPA NQ+ELHPLL Q+EL+++ K K I++EAYSP GS  +P+LK+  I  +AKK
Sbjct: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK 241

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
             ++  QV+++W IQR GYV+LPKSV+ +R+ +N KV  L  ED   I+ + KE+G  R 
Sbjct: 242 YGVEPAQVLINWGIQR-GYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300

Query: 307 VDPDWSPFPLFK 318
           V PDW  FP+F+
Sbjct: 301 VHPDWPSFPIFE 312

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  371 bits (953), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 181/312 (58%), Positives = 228/312 (73%), Gaps = 7/312 (2%)

Query: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66
           S+  + L+ G  IP +GLGTW+S   ND Y+SVI ALK GYRHIDTAAIY NE +VG+AI
Sbjct: 8   SDTYVTLNNGEKIPSVGLGTWKS-QENDGYNSVIYALKAGYRHIDTAAIYRNEGEVGRAI 66

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
           +DSGVPR++IF+T+KLWC +  +PK AL  +LKRLGLDY+DLYLMHWPV  NPR IKD+D
Sbjct: 67  KDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPRYIKDDD 126

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
                ++ +P   +G  DV+M+TW++IKTWEL+Q LP +G T++VGVSNFSINNL  +L+
Sbjct: 127 -----YLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVLS 181

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
           +   K+ PA NQ+ELHPLL Q EL +YC  K I +EAYSPFGS NAP LK +TI  IA K
Sbjct: 182 SPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAAK 241

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
             +   QV+ SW +QR   VVLPKSVHEER+I+N KV  L  ED   I+ L K  GE R+
Sbjct: 242 NGVSPAQVITSWIVQR-DIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 307 VDPDWSPFPLFK 318
             PDW PFP+F+
Sbjct: 301 NKPDWDPFPVFE 312

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  370 bits (949), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 229/308 (74%), Gaps = 7/308 (2%)

Query: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSG 70
           LKL+TGASIP +GLGTW+S    DAY++V++AL+NGYRHIDTAAIYGNE  VGK IRDSG
Sbjct: 10  LKLNTGASIPVVGLGTWKS-PEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGIRDSG 68

Query: 71  VPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGD 130
           VPR EIFVT+KLW  Q  DP+ AL+ +L+RLGLDY+DLYL+HWPV  N  SI D +    
Sbjct: 69  VPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSITDGN---- 124

Query: 131 AFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT 190
            ++T P  ++G +D++++ WNFIKTWE MQHLP+SGKTKA+GVSNFSI N+  LLAA+  
Sbjct: 125 -YLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPD 183

Query: 191 KVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQ 250
            +VPAANQIE+HP L Q EL+ YCK K IL+EAYSP GS ++ IL D TI  IA K + +
Sbjct: 184 FIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNAE 243

Query: 251 VGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPD 310
              +++SW   R GYVVLPKSV+ +RI  N K++ L  ED + IN L +  G  R V PD
Sbjct: 244 PANILISWGASR-GYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAPD 302

Query: 311 WSPFPLFK 318
           +SPF +F+
Sbjct: 303 FSPFAIFE 310

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  363 bits (931), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 223/300 (74%), Gaps = 8/300 (2%)

Query: 19  IPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSGVPRNEIFV 78
           IP + LGTW++   N+ Y +V+ ALK GYRHID AAIY NE +VGKAIRDSG+PR +IFV
Sbjct: 20  IPAVALGTWKA-APNEVYTAVLEALKAGYRHIDGAAIYCNEEEVGKAIRDSGIPRKDIFV 78

Query: 79  TSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDAFMTIPTD 138
           T+KLW  +  +P  AL+ +LKRLGLDY+DLYLMHWPV     SI D D      +TIP  
Sbjct: 79  TTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKADSITDND-----LLTIPKL 133

Query: 139 SNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTTKVVPAANQ 198
            +G  D++++ WNFIKTWELMQ LP S K KA+GVSNFSINNLN+LLAA TTK +PAANQ
Sbjct: 134 PSGKTDIDIENWNFIKTWELMQELPTS-KAKAIGVSNFSINNLNELLAAPTTKTIPAANQ 192

Query: 199 IELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQVGQVVMSW 258
            E+HPLL QNEL++YC++K I+VEAY P G  N P++ +  I  IA KL +  GQ+++SW
Sbjct: 193 FEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIATKLGVNAGQLLISW 252

Query: 259 HIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPDWSPFPLFK 318
            IQR GYVVLPKSV +ERI+ N + +T+P E+F+ +NNL KE G  R V+ D+SPFP ++
Sbjct: 253 GIQR-GYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRSVNIDFSPFPTYQ 311

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  360 bits (925), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 176/314 (56%), Positives = 233/314 (74%), Gaps = 8/314 (2%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60
           M  P  S  + KL TGA+IP +G GTWRS    D Y++V+ ALK GYRHIDTAA+YGNEA
Sbjct: 1   MSGPTNSSAVGKLRTGATIPLLGFGTWRST-EEDGYNAVLTALKVGYRHIDTAAVYGNEA 59

Query: 61  QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR 120
            VG+AIRDSGVPR+++FVT+KLW  Q  DP+LAL+Q+L+RLGLDY+DLYL+HWP+    +
Sbjct: 60  AVGRAIRDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQ 119

Query: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN 180
            I D    G+ F T+PT  +G  DV+ + W+++KTWE+MQ LP++ KT+AVGVSNFS+  
Sbjct: 120 RITD----GNLF-TVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQ 173

Query: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETI 240
           L +LLAAS TKV+PA NQ+E HPLL Q++L ++C E NIL+EAYSP GS  +P++++  +
Sbjct: 174 LQNLLAASGTKVIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAV 233

Query: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKE 300
             IA K +    QV++SW I+R GYV+LPKSV   RI +N K+V L D+DF  INN+ KE
Sbjct: 234 KEIASKHNADPAQVLISWGIKR-GYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKE 292

Query: 301 KGELRVVDPDWSPF 314
           KGE R+ DPDW  F
Sbjct: 293 KGEKRINDPDWFHF 306

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  353 bits (907), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 224/305 (73%), Gaps = 7/305 (2%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSGVP 72
           L+ G  +P +GLGTW+S   NDAY +V+AALK GYRHIDTAAIYGNE +VG+AI+DSGV 
Sbjct: 12  LNDGNQLPYVGLGTWQS-KENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAIKDSGVR 70

Query: 73  RNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDAF 132
           R+EIFVT+KLW  Q   P  ALNQ+L+RLGLDY+DLYLMHWPV  N    K ++     +
Sbjct: 71  RSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCKKDNN----Y 126

Query: 133 MTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTTKV 192
           + IP + +G  D+++ +W+FIKTWELMQ LP+S K K++GVSNFSINN+ DLLA+   K 
Sbjct: 127 LQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASPGNKE 185

Query: 193 VPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQVG 252
           VP  NQ+ELHPLL Q EL+++CK KNI+VEAYSP GS  APIL+  TIN ++KKL I   
Sbjct: 186 VPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLAIPPA 245

Query: 253 QVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPDWS 312
            VV SW IQR   VVLPKSV E RII+N + + LP E+F  +NN+  E GE R V P+W+
Sbjct: 246 NVVFSWLIQR-KIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKPNWT 304

Query: 313 PFPLF 317
           PF  F
Sbjct: 305 PFIPF 309

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  347 bits (891), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 174/311 (55%), Positives = 225/311 (72%), Gaps = 9/311 (2%)

Query: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66
           S   LKL+ G+ IP +GLGTW++    DAY++V AAL  GYRHIDTAAIY NE QVG+AI
Sbjct: 8   STKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI 67

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
           RDSGVPR EIFVT+KLW AQ H+P++AL+++L+RLGLDY+DLYLMHWPV+ +   +K+  
Sbjct: 68  RDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMKE-- 125

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
            S    M  P   +G   VE D W FI TWELMQ LP++ K +++GVSNFS+NNL DLL 
Sbjct: 126 -SPLELMKRP---DGTRPVETD-WTFINTWELMQKLPKN-KVRSIGVSNFSVNNLKDLLK 179

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
           A TT VVP  NQ+ELHPLL Q EL+ YC++  I VEAYSP GS +AP+L +  +  +AKK
Sbjct: 180 APTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKK 239

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
             +Q   VV+SW +QR   +VLPKSVH ER+ AN K  TLP+EDF AI  + +++GE R+
Sbjct: 240 NGVQPAHVVLSWIVQR-NIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRI 298

Query: 307 VDPDWSPFPLF 317
            +P++ PF  F
Sbjct: 299 NNPNFEPFKTF 309

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  346 bits (888), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 223/309 (72%), Gaps = 8/309 (2%)

Query: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSG 70
            KL+TGA +P IGLGTW+S    DAY +V++ALK GY+HIDTAAIY NE  VGKAIRDSG
Sbjct: 11  FKLNTGALLPAIGLGTWKS-SEEDAYTAVLSALKAGYKHIDTAAIYRNERAVGKAIRDSG 69

Query: 71  VPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGD 130
           +PR+E+F+T+KLW  Q  DPK AL+ +L+RLGLDY+DLYL+H+PV F    I  EDG+  
Sbjct: 70  IPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRI--EDGNPF 127

Query: 131 AFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT 190
            F  +P   NG  DV++  W+F+KTW L+QHLPESGK KAVGVSNFSINNL  LL +   
Sbjct: 128 CFPLLP---NGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESDEK 184

Query: 191 KVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK-LDI 249
             VPA NQ+E+HP L Q EL+ +CK K+I+VEAYSP GS  + +L D+T+  IA+K  D 
Sbjct: 185 FAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXXDA 244

Query: 250 QVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDP 309
           Q  Q++++W I R GY VLPKSV  +RI AN +++ +  ED   + NL+   G  R ++P
Sbjct: 245 QPAQILINWGISR-GYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYLEP 303

Query: 310 DWSPFPLFK 318
           DWSPFP+F+
Sbjct: 304 DWSPFPIFE 312

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  346 bits (887), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 162/308 (52%), Positives = 226/308 (73%), Gaps = 7/308 (2%)

Query: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSG 70
           L+++TG  IP +GLGTW++    D Y +V+AAL++GYRHIDTAAIY NEA VG+AIRDSG
Sbjct: 6   LQMNTGKPIPVLGLGTWKA-ADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSG 64

Query: 71  VPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGD 130
           VPR +IFVT+KLWC Q  DP+ ALN +L+RLGLDY+DLYLMH+PV      IKD +    
Sbjct: 65  VPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGN---- 120

Query: 131 AFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT 190
             ++IP  ++G  DV++D W+F+KTW+LMQ LP+SGKTKA+GVSNFSI N+ ++L     
Sbjct: 121 -VLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELG 179

Query: 191 KVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQ 250
             VPAANQIE+HP L Q+EL++YCK K I+VEAYSP GS  + +L D  +  +A+K  ++
Sbjct: 180 LSVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVE 239

Query: 251 VGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPD 310
             Q+++SW + R GY +LPKSV+ +R+ +N K+V L   D Q I+ ++++ G  R V P 
Sbjct: 240 PAQILISWGVTR-GYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPS 298

Query: 311 WSPFPLFK 318
           W+PFP+++
Sbjct: 299 WAPFPMYE 306

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  346 bits (887), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 162/308 (52%), Positives = 226/308 (73%), Gaps = 7/308 (2%)

Query: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSG 70
           L+++TG  IP +GLGTW++    D Y +V+AAL++GYRHIDTAAIY NEA VG+AIRDSG
Sbjct: 6   LQMNTGKPIPVLGLGTWKA-ADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSG 64

Query: 71  VPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGD 130
           VPR +IFVT+KLWC Q  DP+ ALN +L+RLGLDY+DLYLMH+PV      IKD +    
Sbjct: 65  VPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGN---- 120

Query: 131 AFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT 190
             ++IP  ++G  DV++D W+F+KTW+LMQ LP+SGKTKA+GVSNFSI N+ ++L     
Sbjct: 121 -VLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELG 179

Query: 191 KVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQ 250
             VPAANQIE+HP L Q+EL++YCK K I+VEAYSP GS  + +L D  +  +A+K  ++
Sbjct: 180 LSVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVE 239

Query: 251 VGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPD 310
             Q+++SW + R GY +LPKSV+ +R+ +N K+V L   D Q I+ ++++ G  R V P 
Sbjct: 240 PAQILISWGVTR-GYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPS 298

Query: 311 WSPFPLFK 318
           W+PFP+++
Sbjct: 299 WAPFPMYE 306

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  344 bits (883), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 171/315 (54%), Positives = 229/315 (72%), Gaps = 8/315 (2%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60
           MP+ + + +I KL+TGA+IP +G GTWRS    + Y++V++A+K+GYRHID+AA+YGNEA
Sbjct: 1   MPALKNNTDIGKLNTGATIPLLGFGTWRST-EEEGYNAVLSAIKDGYRHIDSAAVYGNEA 59

Query: 61  QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR 120
            VG+AIRDSGVPR E+FVT+KLW  Q  +P  AL+Q+L+RLGLDY+DLYL+HWP+     
Sbjct: 60  AVGRAIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTD 119

Query: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN 180
            I D    G+ F +IPT  +G  DV+ + W++IKTW+LMQ LP +GKT+AVGVSN S++ 
Sbjct: 120 RITD----GNLF-SIPTKEDGKPDVDTE-WDYIKTWQLMQELPSTGKTRAVGVSNVSVSQ 173

Query: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETI 240
           L  LLA    KVVPA  Q+E HPLL QN+LL +C + +IL+EAYSP GS  +P++ +  I
Sbjct: 174 LEKLLADKGNKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVI 233

Query: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKE 300
             IAKK +    Q+++SW I+R GYVVLPKSV   RI +N + + L DEDF+ IN L  E
Sbjct: 234 KEIAKKYNADPAQIIISWDIKR-GYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVE 292

Query: 301 KGELRVVDPDWSPFP 315
           KGE RV DP+W  FP
Sbjct: 293 KGEKRVNDPEWFTFP 307

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  340 bits (872), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 216/308 (70%), Gaps = 8/308 (2%)

Query: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSG 70
           +KL+TG +IPQ+GLGTWRS    D Y +V AALK GYRHID AAIY NE +VGKAIRDSG
Sbjct: 12  VKLNTGYTIPQVGLGTWRS-KEGDGYKAVTAALKAGYRHIDGAAIYLNEEEVGKAIRDSG 70

Query: 71  VPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGD 130
           +PR E+F+T+KLW  Q  +P+ AL Q+L+RLGL+Y+DLYLMHWPV    + I D +    
Sbjct: 71  IPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRITDGN---- 126

Query: 131 AFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT 190
             ++ P   +G  DV+ + W+F+KTWELMQ LP++ K ++VGVSNFSINNL +LLA+   
Sbjct: 127 -LLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASPGN 184

Query: 191 KVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQ 250
           K+VPA  Q+E+HPLL Q  L  +CKE NI VEAYSP G   AP+L D  I  IA + +  
Sbjct: 185 KLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHNAD 244

Query: 251 VGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPD 310
            G VV+SW +QR G V LPKS   ER+++N +   L DE+  +INNL K +G+ R   PD
Sbjct: 245 AGNVVVSWGVQR-GIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAPD 303

Query: 311 WSPFPLFK 318
            SPFPLF+
Sbjct: 304 MSPFPLFE 311

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  329 bits (843), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 172/320 (53%), Positives = 214/320 (66%), Gaps = 13/320 (4%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60
           M SP      LKL+TGASIPQ+G GTW S    DAY +VI ALK GYRHID AA+YGNEA
Sbjct: 1   MTSPSGEFPSLKLNTGASIPQLGFGTWPS-SHADAYTAVITALKTGYRHIDAAAMYGNEA 59

Query: 61  QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR 120
            VGK IRDSG+PR EIFVT+KLW  Q  DP  AL+++L+RLGLDY+DL+L+HWPV   P 
Sbjct: 60  AVGKGIRDSGIPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPV 119

Query: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDT--WNFIKTWELMQHLPESGKTKAVGVSNFSI 178
                 G  +  +  PT     +  ++DT  W+FIKTWELMQ LP++GKT+AVGVSNFSI
Sbjct: 120 ------GGPENLLKYPTP---GIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSI 170

Query: 179 NNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDE 238
            NL DLL +S   +VPA NQ E+HP L Q EL+ YCK K I+VEAY P GS ++ +L D 
Sbjct: 171 KNLEDLLNSSPDVLVPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDP 230

Query: 239 TINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLV 298
           TI  IA K  ++   V+++W I R GY VLPKS    RI +N+  V L  ED + I  L 
Sbjct: 231 TIAEIADKYHVKPANVLINWGISR-GYCVLPKSFTPARIASNKTPVHLSREDTERITKLS 289

Query: 299 KEKGELRVVDPDWSPFPLFK 318
           +  G  R V PD+ P+PLF+
Sbjct: 290 ETLGVKRYVHPDFEPYPLFE 309

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  328 bits (842), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 157/303 (51%), Positives = 213/303 (70%), Gaps = 8/303 (2%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSGV 71
           KL+TGA IP +GLGTWRS   N  Y++ +AA+K GYRHID AA+  NE  VG+AIRDSGV
Sbjct: 13  KLNTGAQIPLLGLGTWRSTKEN-GYNATLAAIKAGYRHIDIAAVCMNEQVVGRAIRDSGV 71

Query: 72  PRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDA 131
           PR E+FVT+KLWC Q  DPK AL+Q+LKRLGLDY+DLY+MHWPV F    +K  +     
Sbjct: 72  PREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKHTN----- 126

Query: 132 FMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTTK 191
           +M IP   +G  DV+ + W+++KTWELMQ LP +GKT A+GV+NFS++ L  L+ +   K
Sbjct: 127 YMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGNK 185

Query: 192 VVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQV 251
           +VPAA+Q+E HP L QN++L +CK+ NIL+EAYSP GS  AP+L +  +  I+KKL ++ 
Sbjct: 186 IVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVEP 245

Query: 252 GQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPDW 311
            Q+++SW +QR G+ VL KS    RI AN     +P+ D + IN L +E+G  R+ +P W
Sbjct: 246 AQLLVSWGLQR-GHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPTW 304

Query: 312 SPF 314
             F
Sbjct: 305 FSF 307

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  328 bits (842), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 165/308 (53%), Positives = 222/308 (72%), Gaps = 8/308 (2%)

Query: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSG 70
           + L+ G  IP IGLGT+ S   N+ Y +V+ A K GYRH+DTAA Y NE QVGKA++D G
Sbjct: 12  ITLNNGTKIPVIGLGTYLS-KQNEVYEAVVTAAKAGYRHVDTAAFYKNEEQVGKAVKDCG 70

Query: 71  VPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGD 130
           VPR+E++VT+K+W  +  DP+ AL+++LKRLGL+YIDLYLMHWPVT    +IKD +    
Sbjct: 71  VPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTDTIKDGE---- 126

Query: 131 AFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT 190
             M IP   +GN DV+ D W F++ WE MQ L +SGK K++GVSNFSINN+ +LLAA TT
Sbjct: 127 -LMCIPRLPDGNADVDKD-WTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELLAAPTT 184

Query: 191 KVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQ 250
            VVP  NQ+E+ PLL  +EL+++C+ K+I+ +AY PFG   AP++KD T+  IAK   + 
Sbjct: 185 TVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAKGNGVD 244

Query: 251 VGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPD 310
            GQV+ SWH+QR GYVVLPKSV E RII+N K  TL D D   +NN+ K +GE R+ + +
Sbjct: 245 AGQVITSWHVQR-GYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRLNNVN 303

Query: 311 WSPFPLFK 318
           +SPFP+F+
Sbjct: 304 FSPFPIFE 311

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  314 bits (804), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 163/314 (51%), Positives = 211/314 (67%), Gaps = 9/314 (2%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60
           M +P+ S ++ KL+TGASIP +GLGT+ S      Y +V+ A+K GYRHID AA+Y NE 
Sbjct: 1   MSAPKPSTSVGKLNTGASIPLVGLGTYLSEDET-GYKAVLHAIKVGYRHIDCAALYKNED 59

Query: 61  QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR 120
            VG+AIRDSGVPR E+FVT+K+W  Q  +P  AL ++L RLGLDY+DL+LMHWP      
Sbjct: 60  FVGRAIRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTE 119

Query: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN 180
            I D +      +T+P   +   DV+ + WN+IKTW LMQ LP SGKTKAVGVSNFS+  
Sbjct: 120 RITDGN-----MITVPKREDEKPDVDTE-WNYIKTWHLMQDLPASGKTKAVGVSNFSVKQ 173

Query: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETI 240
           L  LLA   +KVVPA NQ+E+HPLL Q  L  +CK+KNI++ AYSP GS  AP+L D  I
Sbjct: 174 LEKLLADPGSKVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVI 233

Query: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKE 300
             IA K      Q+++ W ++R GYV LPKSV   RI +N ++V L D + + IN + K 
Sbjct: 234 LEIAAKHKADPAQIIIGWDVKR-GYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK- 291

Query: 301 KGELRVVDPDWSPF 314
           KGE RVVDP+W  F
Sbjct: 292 KGEKRVVDPEWFDF 305

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  307 bits (787), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 210/302 (69%), Gaps = 9/302 (2%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSGVP 72
           L+TGA IP +GLGTWR +     Y +++AALK GYRHID+AA+  NE  +GKAIRDSGV 
Sbjct: 14  LNTGAKIPLLGLGTWR-LTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAIRDSGVR 72

Query: 73  RNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDAF 132
           R+E+FVT+KLW  Q  DP  AL+Q+LKRLGL+Y+DLY+MHWP+ F    IK ++     F
Sbjct: 73  RDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKAKN-----F 127

Query: 133 MTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTTKV 192
           M IP +S G   V+ D W+++KTWELMQ LP + KT+A+GV+NFS+  L  LL +   K+
Sbjct: 128 MLIPRNSEGKPYVDTD-WDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLLKSPNNKI 185

Query: 193 VPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQVG 252
           +PAA+Q+E HP L  +E+L +C+EK IL+EAYSP G    P++ +  I  I+KKL ++  
Sbjct: 186 IPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVEPA 245

Query: 253 QVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPDWS 312
           Q+++SW ++R G  VLPKS  + RI +N +V  L DED++ I+ + +E+G  R  +P W 
Sbjct: 246 QLLISWGLKR-GCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPWF 304

Query: 313 PF 314
            F
Sbjct: 305 SF 306

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  306 bits (784), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 160/314 (50%), Positives = 224/314 (71%), Gaps = 8/314 (2%)

Query: 5   QVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGK 64
           + S + + L+TGA IP  GLGTW+S   +DA  +V AALK+GY+HIDTA+ Y NE  VGK
Sbjct: 8   KASTDTVTLNTGAKIPLFGLGTWQST-DDDASSAVAAALKHGYKHIDTASFYKNEELVGK 66

Query: 65  AIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKD 124
           A+++SG+PR E+F+T+K+W  Q  DP  AL+ +LK+LG +Y+DL LMHWPV F     + 
Sbjct: 67  AVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFK----EP 122

Query: 125 EDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDL 184
           E+ + DA+  +P   +G V  + + W+F+KTW LMQ L  +GK KA+GVSNFSINNL +L
Sbjct: 123 ENSTLDAY-KVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEEL 180

Query: 185 LAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIA 244
           L A  T VVPA NQ+ELH  L Q EL++YC++K I+VEAYSP GS +AP+LKD T+N +A
Sbjct: 181 LNAEGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVA 240

Query: 245 KKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGEL 304
           +K  +    V++++   R G VVLPKSV E RII+N +   + +ED + +N++ K++G  
Sbjct: 241 EKYGVTPAHVLLNYVANR-GIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQ 299

Query: 305 RVVDPDWSPFPLFK 318
           R VDPD+SPFPLF+
Sbjct: 300 RFVDPDFSPFPLFQ 313

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  206 bits (525), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 120/318 (37%), Positives = 190/318 (59%), Gaps = 22/318 (6%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGT----WRSVGTNDAYHSVIAALKNGYRHIDTAAIY 56
           M  P+ +E    L+TGA IP +GLGT     +   T DA   V  A+KNGYR IDTA +Y
Sbjct: 1   MTHPRATEIYFNLNTGAKIPSLGLGTVNPPEKMPQTKDA---VKHAVKNGYRLIDTAWMY 57

Query: 57  GNEAQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMH 112
           G+E  +G+A+++      V R ++F+T+K+W    +  + +L ++LK+L LDY+DL L H
Sbjct: 58  GSEPYIGEALQELFEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQH 117

Query: 113 WPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPE--SGKTKA 170
           WP+ F    +K  D  G    + P D      V  +  +++ TW+ ++ + +  SG+ + 
Sbjct: 118 WPLCF----VKQYDEHG-KLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRN 172

Query: 171 VGVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSI 230
           +GVSN+ +  L  LL    T+VVP  NQ+ELHPLL Q EL +YC    IL+E++SP GS 
Sbjct: 173 IGVSNYPVEYLERLLKE--TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSS 230

Query: 231 NAPILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDED 290
             P L+   +  ++KK D + G V++++H+++G  VV+P+S++  RII N   V L +ED
Sbjct: 231 GTPHLEHPLVKELSKKYDCEPGSVLLNYHVRKGN-VVVPRSLNHGRIIKNADFVALSEED 289

Query: 291 FQAINNLVKEKGELRVVD 308
              ++ L +EK  +RV+D
Sbjct: 290 LDKLSGLGREK-PVRVMD 306

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  205 bits (522), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 191/320 (59%), Gaps = 15/320 (4%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWR-SVGTNDAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P+ +E   KL+ G ++P +GLGT        +   +V AA+K GYRHIDTA  YG E
Sbjct: 1   MLHPKSTEIYFKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTE 60

Query: 60  AQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
             +G A+++      V R+++F+TSK+W     D  L+LN++LK LGLDY+DLYL HWP+
Sbjct: 61  GYIGDALKELLENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPL 120

Query: 116 TFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHL---PESGKTKAVG 172
            F  + I+D     +     P D +GN  + ++  +++ T++ M+ +   P+  + +A+G
Sbjct: 121 CF--QKIEDSKDGVNGLKGKPIDKDGNALI-VEGADYLSTYKQMEKIYLDPKDNRVRAIG 177

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINA 232
           VSN+ +  L+ LL   T K  PA NQ+E+HP L Q EL ++C+  +I + AYSP GS  A
Sbjct: 178 VSNYPVEYLDRLLKVCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGA 235

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQ 292
           P+LK   +  +++K  + +  V++S+HI++G +V+ P+S++  R+      VTL + +  
Sbjct: 236 PLLKLPLVKELSEKYQVTLNDVLISYHIRKGSFVI-PRSLNPVRLAGCVNFVTLTEGELD 294

Query: 293 AINNLVKEKGELRVVDPDWS 312
            +++ +  K  +R +D  ++
Sbjct: 295 QLDD-IGRKDSIRYIDGSFA 313

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  202 bits (514), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 177/307 (57%), Gaps = 21/307 (6%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAY----HSVIAALKNGYRHIDTAAIY 56
           M  P  +E    L+ G  IP IGLGT       D Y     +V AA++ GYRHIDTA  Y
Sbjct: 1   MTHPTSTEIYFNLNNGTRIPAIGLGT---ASPKDRYPETKEAVKAAIRAGYRHIDTAYFY 57

Query: 57  GNEAQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMH 112
             E  +G+A+++    + + R E+F+T+K+W    ++P  +++Q+LK LG+DY+DL L H
Sbjct: 58  KTEPYIGQALKELFESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQH 117

Query: 113 WPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDT-WNFI-KTWELMQHLPESGKTKA 170
           WPV F     K E+  G+  + +P D +GN   E D  W F  K  E +   P+  + +A
Sbjct: 118 WPVCFQ----KVENSQGN-IIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRA 172

Query: 171 VGVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSI 230
           +GVSN+ I  L  L      KV PA NQ+E+HP L Q EL ++C +  IL+ AYSP GS 
Sbjct: 173 IGVSNYPIEYLERLF--KECKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSD 230

Query: 231 NAPILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDED 290
            AP LK +++  +AKK  ++   ++ S+HI +G  VVLP+S++ +RI AN     L D+D
Sbjct: 231 GAPNLKIKSVQDLAKKYKVEPADILTSYHISKGN-VVLPRSLNPKRIAANVSFAKLTDDD 289

Query: 291 FQAINNL 297
              ++ +
Sbjct: 290 LSKLDQV 296

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  191 bits (486), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 187/316 (59%), Gaps = 15/316 (4%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWR-SVGTNDAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P+ +E   KL+ G +IP +G GT+       +   +V AA+K GYRHIDTA +Y +E
Sbjct: 1   MLHPKSTEIYFKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESE 60

Query: 60  AQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
             VG+AI++      V R+++FVT+K+W     + + +LN++L+ LGLDY+DL L HWP+
Sbjct: 61  PYVGEAIKEMIEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPL 120

Query: 116 TFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHL---PESGKTKAVG 172
            F PR ++DE    +  +  P D  G   +  +  +F++T+  ++ +   P+  + +A+G
Sbjct: 121 CF-PR-VEDEKNGVNGLVAYPEDDEGKPLLN-EKGDFLETYRQIEKIYLNPDDHRVRAIG 177

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINA 232
           VSN++I  L  L      KV P  NQ+E+HP L Q EL ++C    IL+ AYSP GS  A
Sbjct: 178 VSNYAIEYLEALF--KECKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGA 235

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQ 292
           P LK   ++ +A+K D+ +  +++S+HI++G   V+P+S++  RI +  +      E+ +
Sbjct: 236 PNLKIPLVHQLAEKYDMSLNDILISYHIRKGN-TVIPRSLNPVRIASTIEFAPFTQEELK 294

Query: 293 AINNLVKEKGELRVVD 308
            ++N+  E+   R VD
Sbjct: 295 QLDNVGIEE-PARFVD 309

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  189 bits (479), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 106/305 (34%), Positives = 176/305 (57%), Gaps = 17/305 (5%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTN-DAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P+ +E    L+ G  IP IGLGT    G   +   +V AA++ GYR IDTA  Y  E
Sbjct: 1   MSHPRNTEIYFNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTE 60

Query: 60  AQVGKAI----RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
             +G+A+    RD  + R ++F+T+K+W     DP  ++N++LK LG+DY+D+ L HWP+
Sbjct: 61  PYIGEALKELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPL 120

Query: 116 TFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHL---PESGKTKAVG 172
            +  +   DE+G+    +  P D +G V +  +  ++I T++LM+ +   P+  + +A+G
Sbjct: 121 CY--KKTYDENGT---IIGKPLDKDGKV-IFAEGADWITTYQLMEKIYLDPKDTRVRAIG 174

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINA 232
           VSN+ I  L  ++     KV P  NQ+ELHP L Q EL  +C +  IL+ AYSP GS  A
Sbjct: 175 VSNYPIEYLERVI--KECKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGA 232

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQ 292
           P  K   +   AKK ++    ++ S+H+++G  VV+P+S++ ER+ +N     L   + +
Sbjct: 233 PNTKIPLVQEYAKKHEVAPADILTSYHVRKGN-VVIPRSLNPERVASNIYFAPLTKNEMK 291

Query: 293 AINNL 297
           ++++ 
Sbjct: 292 SLDDF 296

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  187 bits (476), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 115/325 (35%), Positives = 185/325 (56%), Gaps = 14/325 (4%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSV-GTNDAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P+ +E    L+ G  +P IGLGT   V        +V AA+K+GYRHIDTA  Y  E
Sbjct: 1   MLHPKNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCE 60

Query: 60  AQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
            +VG+A+++      V R +IFVT+K+W         +++++L+ LGLD++DL L HWP+
Sbjct: 61  DRVGEALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPL 120

Query: 116 TFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQ--HLPESGKTKAVGV 173
            FN   ++D DG  D     P   +G+     +  ++++T++ ++  +L +  + +A+GV
Sbjct: 121 CFN--RLEDPDGI-DGVRRNPYHEDGSPHYN-EKGDYLETFKTLEKLYLAKDPRFRAIGV 176

Query: 174 SNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAP 233
           SN+ +  L  LL     +VVPA NQ+E HP L Q EL  +C + NI +EAYSP G+ NAP
Sbjct: 177 SNYPVEYLERLL--KECQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAP 234

Query: 234 ILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQA 293
           ++ +E +  IA K       V++++H+ R G V +P+SV+ + I +N + V L  ED   
Sbjct: 235 LIDNELVKKIAGKYACSTQNVLIAYHM-RQGVVSVPRSVNPKHIASNVQFVALSKEDIDT 293

Query: 294 INNLVKEKGELRVVDPDWSPFPLFK 318
           +N    E  +  V +P  +  P F+
Sbjct: 294 LNKFGVENTKRIVDEPFAAAIPGFR 318

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  188 bits (478), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 117/326 (35%), Positives = 184/326 (56%), Gaps = 17/326 (5%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWR-SVGTNDAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P+ +E    L+ G  IP +GLGT        +   +V AA+K GYRHIDTA  Y  E
Sbjct: 15  MLHPKTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 60  AQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
             VG+AI++      + R ++F+T+K+W     +   +LN++LK LGLDY+DL L HWP+
Sbjct: 75  PFVGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPI 134

Query: 116 TFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHL---PESGKTKAVG 172
            F    +KD +G    +M +P D +G   V     ++++T++ ++ +       + +A+G
Sbjct: 135 CFG--KVKDPEGIS-GYMKLPVDDSGKT-VYASNGDWLETYKQLEKIYLDSNDHRVRAIG 190

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINA 232
           VSNFSI  L  L+     KV P  NQ+E HP L Q EL ++C   +IL+ AYSP GS  A
Sbjct: 191 VSNFSIEYLERLI--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGA 248

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQ 292
           P LK   +  + +K ++    +++S+HI R G +V+P+S++  RI +N + V L  ++ Q
Sbjct: 249 PNLKIPLVKKLCEKYNVTGNDLLISYHI-RQGTIVIPRSLNPVRISSNIEFVCLTKDELQ 307

Query: 293 AINNLVKEKGELRVVD-PDWSPFPLF 317
            +N    EK  +R +D P  +  P F
Sbjct: 308 ELNEF-GEKYPVRFMDVPSVAILPGF 332

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  187 bits (474), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 110/319 (34%), Positives = 186/319 (58%), Gaps = 15/319 (4%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSV-GTNDAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P+ +E    L+ G  +P +GLGT   +        +V AA+K+GYRHIDTA  Y  E
Sbjct: 1   MLHPKNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCE 60

Query: 60  AQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
            ++G+A+++      + R +IF+T+K+W         +++++L+ LG+DY+DL L HWP+
Sbjct: 61  DRIGEALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPL 120

Query: 116 TFNPRSIKDEDGSGDAFMTIPTDSNG--NVDVEMDTWNFIKTWELMQHLPESGKTKAVGV 173
            FN   ++D +G  D     PT  +G  + + + D     K+ E M +L +  + +++GV
Sbjct: 121 CFN--RLQDPEGI-DGICRNPTHEDGSPHYNEKGDYLQTFKSLEKM-YLSKDPRFRSIGV 176

Query: 174 SNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAP 233
           SN+ +  L  LL     KVVPA NQ+E+HP L Q EL  +C + NI +EA+SPFG+  +P
Sbjct: 177 SNYPVEYLERLL--KECKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSP 234

Query: 234 ILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQA 293
           ++K+E +  +A+K       V++++H+ R G V +P+SV+ + I +N + V L  ED   
Sbjct: 235 MVKNELVQKVAQKYSCTPNDVLIAYHL-RQGVVTVPRSVNPKNIASNVQFVPLSKEDIDE 293

Query: 294 INNLVKEKGELRVVDPDWS 312
           +N    E  + R+VD +++
Sbjct: 294 LNKFGVENPK-RLVDEEFA 311

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  187 bits (475), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 113/316 (35%), Positives = 180/316 (56%), Gaps = 16/316 (5%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWR-SVGTNDAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P+ +E    L+ G  IP +GLGT        +   +V AA+K GYRHIDTA  Y  E
Sbjct: 15  MLHPKTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 60  AQVGKAIR----DSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
             VG+AI+    D  + R ++F+T+K+W     +   +LN++LK LGL+Y+DL L HWP+
Sbjct: 75  PFVGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPL 134

Query: 116 TFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHL---PESGKTKAVG 172
            F    IKD  G     +  P D +G      D  ++++T++ ++ +   P   + +A+G
Sbjct: 135 CF--EKIKDPKGIS-GLVKTPVDDSGKTMYAADG-DYLETYKQLEKIYLDPNDHRVRAIG 190

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINA 232
           VSNFSI  L  L+     +V P  NQ+E HP L Q EL ++C   +IL+ AYSP GS  A
Sbjct: 191 VSNFSIEYLERLI--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGA 248

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQ 292
           P LK   +  +A+K ++    +++S+HI R G +V+P+S++  RI ++ +  +L  ++ Q
Sbjct: 249 PNLKIPLVKKLAEKYNVTGNDLLISYHI-RQGTIVIPRSLNPVRISSSIEFASLTKDELQ 307

Query: 293 AINNLVKEKGELRVVD 308
            +N+   EK  +R +D
Sbjct: 308 ELNDF-GEKYPVRFID 322

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  186 bits (473), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 185/320 (57%), Gaps = 22/320 (6%)

Query: 4   PQVSENILKLSTGASIPQIGLGTWR---SVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60
           P+ +E    L+ G  +P +GLGT      +G      +V AA+K GYRHIDTA  YG+E 
Sbjct: 7   PKGTEISFTLNNGVRMPALGLGTANPHPEIGRTK--QAVKAAVKAGYRHIDTAWAYGSEP 64

Query: 61  QVGKAIRD---SGVPRNE-IFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVT 116
            VG+AI++    GV R E IF+TSK+W     D + +LN++L+ LG+DYIDL+L HWP+ 
Sbjct: 65  FVGEAIKELMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLC 124

Query: 117 FNPRSIKDEDGSG-DAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHL---PESGKTKAVG 172
           +    +K ED  G +     P   NG    E+D  ++++T+  M+ +   P   + +++G
Sbjct: 125 Y----VKQEDTHGINGLARNPETPNGEPYYEVDG-DWLETYVQMEKIYLDPSDNRVRSIG 179

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINA 232
           VSNF +  L   L     K  PA NQ+E+HP L Q EL ++C+  NIL+EAYSP GS NA
Sbjct: 180 VSNFPVQYLERTLFECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNA 237

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQ 292
           P +  + +  +A+K  +    ++ S+HI++G  VV  +SV+  RI +N +   L +E+  
Sbjct: 238 PNVHLQLVQDLAEKYSMSPSGILNSYHIRQGNAVV-SRSVNTMRIASNVEFAALTEEELD 296

Query: 293 AINNLVKEKGELRVVDPDWS 312
            ++ L   K + R V+  W+
Sbjct: 297 NLDQLGITKPK-RFVNEKWN 315

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  184 bits (467), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 176/328 (53%), Gaps = 34/328 (10%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVG----KAIRD 68
           L+ G  +P +GLG W+ +  + A   V  A+K GYR  D A  YGNE ++G    +AI +
Sbjct: 9   LNNGMKMPVVGLGCWK-LSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQAINE 67

Query: 69  SGVPRNEIFVTSKLWCAQTHDP---KLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDE 125
             V R ++F+ SKLWC   H P   KLAL +TL  LGLDY+DLY +H+P+    + +  E
Sbjct: 68  GLVKREDLFIVSKLWC-NFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPI--KYVPLE 124

Query: 126 DGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLL 185
           +       T   D   N+  E      + T+  M+ L + G  K++G+SNF    + DLL
Sbjct: 125 EKYPPEMYTGEEDRRNNIVSEQQV-PILDTYRAMEKLVDEGLVKSLGLSNFQACLIQDLL 183

Query: 186 AASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSIN------------AP 233
             +  K  P A Q+ELHP L+Q  L+ Y + K+I V AYS FG ++             P
Sbjct: 184 RGARIK--PVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDVTP 241

Query: 234 ILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIAN---RKVVTLPDED 290
           +L+ E +  IAKK D+   QV++ W  QR G  V+PKS  +ER++ N    K +TL D +
Sbjct: 242 LLEHEIVLNIAKKHDVTPSQVILRWATQR-GIAVIPKSSKKERLLNNLNSDKALTLSDSE 300

Query: 291 FQAINNLVKEKGELRVVDP-DWSPFPLF 317
              I +L K    LR +DP DW+  P F
Sbjct: 301 MSDIFSLNK---NLRFLDPWDWARLPGF 325

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  183 bits (464), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 115/322 (35%), Positives = 179/322 (55%), Gaps = 19/322 (5%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWR-SVGTNDAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P+ +E    L+ G  IP +GLGT        +   +V AA+K GYRHIDTA  Y  E
Sbjct: 15  MLHPKTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTE 74

Query: 60  AQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
             VG+AI++      + R ++F+T+K+W     +   +LN++LK LGLDY+DL L HWP+
Sbjct: 75  PFVGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPL 134

Query: 116 TFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHL---PESGKTKAVG 172
            F    +KD  G     +  P D +G   V     ++++T++ ++ +       + +A+G
Sbjct: 135 CF--EKVKDPKGIS-GLVKTPVDDSGKT-VYASNGDWLETYKQLEKIYLDSNDHRVRAIG 190

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINA 232
           VSNFSI  L  L+     KV P  NQ+E HP L Q EL ++C   +IL+ AYSP GS  A
Sbjct: 191 VSNFSIEYLERLI--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGA 248

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQ 292
           P LK   +  + +K ++    +++S+HI R G +V+P+S++  RI +N + V L  ++ Q
Sbjct: 249 PNLKIPLVKKLCEKYNVTGNDLLISYHI-RQGTIVIPRSLNPVRISSNIEFVCLTKDELQ 307

Query: 293 AINNLVKEKGELRVVDPDWSPF 314
            +N    EK  +R +D    PF
Sbjct: 308 ELNEF-GEKYPVRFID---EPF 325

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  182 bits (462), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 110/316 (34%), Positives = 178/316 (56%), Gaps = 16/316 (5%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWR-SVGTNDAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P+ +E    L+ G  IP +GLGT        +   +V AA+K GYRHIDTA  Y  E
Sbjct: 15  MLHPKTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 60  AQVGKAIR----DSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
             VG+AI+    D  + R ++F+T+K+W     +   +LN++LK LGLDY+DL+L HWP+
Sbjct: 75  PFVGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPL 134

Query: 116 TFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHL---PESGKTKAVG 172
            F    +KD  G     +  P D +G   +     ++++T++ ++ +   P   + +A+G
Sbjct: 135 CF--EKVKDPKGLS-GLVKTPVDDSGKT-MYASNGDWLETYKQLEKIYLDPNDHRIRAIG 190

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINA 232
           VSNFSI  L  L+     +V P  NQ+E HP L Q  + ++C   +IL+ AYSP GS  A
Sbjct: 191 VSNFSIEYLERLIKEC--RVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGA 248

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQ 292
           P LK   +  + +K ++    V++S+HI R G +V+P+S++  RI ++ +   L  ++ Q
Sbjct: 249 PNLKIPLVKKLTEKYNLTGNDVLISYHI-RQGTIVIPRSLNPVRISSSIEFSCLTKDELQ 307

Query: 293 AINNLVKEKGELRVVD 308
            +N+   EK  +R +D
Sbjct: 308 ELNDF-GEKYPVRFID 322

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  181 bits (458), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 177/326 (54%), Gaps = 15/326 (4%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTW-RSVGTNDAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P  +E     + G  +P  GLGT  +     +   +V AA+K GYRHIDTA  YG E
Sbjct: 1   MLHPLSTEIYFTFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVE 60

Query: 60  AQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
             VG+A+++      V R ++ +TSK+W    +D   +LN++L RL +DY+DL+L HWP+
Sbjct: 61  EYVGEALQELFEERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWPL 120

Query: 116 TFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHL---PESGKTKAVG 172
               + + D  G  D     P D  GN  +  +  ++I+T++ ++ +       + +A+G
Sbjct: 121 C--TQKVPDPHGV-DKIAKEPVDDQGN-PLYDEKGDWIETYKQIEKIYLDKNDKRVRAIG 176

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINA 232
           VSNF I  L  +L    T  VPA NQ+ELHP L Q EL ++C E  ILV AYSP G   A
Sbjct: 177 VSNFPIEYLKRVLKECRT--VPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGA 234

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQ 292
           P+L+   +  + +K +     ++ S+H+ R G +V+P+S++  RI +N + V L +ED  
Sbjct: 235 PLLELPILKGLCEKYNASPNDILTSYHL-RQGTIVIPRSLNSTRIASNLEFVPLSEEDVN 293

Query: 293 AINNLVKEKGELRVVDPDWSPFPLFK 318
            +N   ++  +  +     S  P FK
Sbjct: 294 KLNEFGQKNKKRYINGAVSSVIPGFK 319

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  179 bits (453), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 115/318 (36%), Positives = 168/318 (52%), Gaps = 20/318 (6%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAY----HSVIAALKNGYRHIDTAAIY 56
           M  P+ +E    L+ G  IP +GLGT       D +     +V AA+K G+R IDTA  Y
Sbjct: 1   MSHPKATEIYFNLNNGTRIPAVGLGT---ANPKDKWPQTKEAVKAAVKAGFRQIDTAWAY 57

Query: 57  GNEAQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMH 112
           G E  +G+A+++      V R ++F+T+K+W       + +LN++LKRL LDY+DL L H
Sbjct: 58  GTEEYIGEALQELFAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQH 117

Query: 113 WPVTFNPRSIKDEDGSGDAFMTIPTDSNGN--VDVEMDTWNFIKTWELMQHLPESGKTKA 170
           WP  F  +  +D +GSG   +  P   +G+   D   D     K  E +       + +A
Sbjct: 118 WPFCFVKK--QDPEGSGQ-LVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRA 174

Query: 171 VGVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSI 230
           +GVSN+ I  L  L      K VPA NQ+ELHP L Q EL  YC +  IL+ +YSP GS 
Sbjct: 175 IGVSNYPIEYLERLF--KECKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSN 232

Query: 231 NAPILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDED 290
            AP L+   +  +A K +     V++S+HI R G +V+P+S++ ERI      V L  E+
Sbjct: 233 GAPNLRIPLVQELASKYNANGNDVLVSYHI-RQGTIVIPRSLNLERISKGLGFVPLTKEE 291

Query: 291 FQAINNLVKEKGELRVVD 308
              +N    E  E R +D
Sbjct: 292 LDKLNQYGVEH-EYRYID 308

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  179 bits (454), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 110/326 (33%), Positives = 184/326 (56%), Gaps = 17/326 (5%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWR-SVGTNDAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P+ +E    L+ G  +P +GLGT        +   +V AA+K GYRHIDTA  Y  E
Sbjct: 15  MLHPKTTEIYFTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 60  AQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
             VG+AI++      + R ++F+T+K+W     + + +L+++LK +GLDY+DL+L HWP+
Sbjct: 75  PFVGEAIKELLEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPL 134

Query: 116 TFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHL---PESGKTKAVG 172
            F    +KD  G     +  P   +G   +  +  ++++T++ ++ +   P   + +A+G
Sbjct: 135 CF--EKVKDPKGIS-GLVKTPVHKSGEAMLASNG-DWMETYKQLEKIYLDPNDHRVRAIG 190

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINA 232
           VSNFSI  L  L+     +V P  NQ+E HP L Q EL ++C   +IL+ AYSP GS  A
Sbjct: 191 VSNFSIEYLERLV--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGA 248

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQ 292
           P LK   +  + +K ++    V++S+HI R G +V+P+S++  RI ++ +   L  ++ Q
Sbjct: 249 PNLKIPLVKKLVEKYNVTGNDVLISYHI-RQGTIVIPRSLNPVRISSSIEFACLTKDELQ 307

Query: 293 AINNLVKEKGELRVVD-PDWSPFPLF 317
            +N+   EK  +R +D P  +  P F
Sbjct: 308 ELNDF-GEKYPVRFIDEPFAASLPEF 332

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  177 bits (448), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 106/295 (35%), Positives = 171/295 (57%), Gaps = 17/295 (5%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGT-NDAYHSVIAALKNGYRHIDTAAIYGNE 59
           M  P+ +E    L+ G  +P IGLGT        +   +V AA+K GYR+IDTA  YG+E
Sbjct: 1   MLHPKSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSE 60

Query: 60  AQVGKAIRD----SGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPV 115
             VG+AI++      + R ++F+TSK+W     D + +L ++LK LG+DYIDL+L HWP+
Sbjct: 61  PFVGEAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPL 120

Query: 116 TFNPRSIKDEDGSG-DAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHL---PESGKTKAV 171
            +N R    ED  G +     P  ++G+ D   +  +++ T++ M+ +   P+  + +A+
Sbjct: 121 CYNRR----EDPHGINGLARNPEKADGSPDFN-EKADWLDTYKQMERIYSNPKDNRVRAI 175

Query: 172 GVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSIN 231
           GVSNF +  L  +L     K  P  NQ+E+HP L Q EL ++C + +I + AYSP GS  
Sbjct: 176 GVSNFPVEYLKRVLKECPVK--PVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHG 233

Query: 232 APILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTL 286
           AP++K   I  +++K       ++ S+HI++G  VV P+S++  RI +N + V L
Sbjct: 234 APMVKHPLIKEMSQKYKASENDILTSFHIRQGNTVV-PRSINSVRIASNIEFVPL 287

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  176 bits (447), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 122/337 (36%), Positives = 187/337 (55%), Gaps = 37/337 (10%)

Query: 6   VSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKA 65
           VSE + KL+ G  +P +GLG W+ +        V  A+K GYR  D A  YGNE +VG+ 
Sbjct: 4   VSETV-KLNNGLEMPLVGLGCWK-IPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQG 61

Query: 66  IR---DSG-VPRNEIFVTSKLWCAQTHDPK---LALNQTLKRLGLDYIDLYLMHWPVTFN 118
           IR   D G V R ++FV SKLW +  HDPK    AL +TL+ LGL+Y+DL+ +H+P+ F 
Sbjct: 62  IRKAIDEGIVKREDLFVVSKLWNS-YHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAF- 119

Query: 119 PRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSI 178
            + +  E+     F T   D    V + ++    + T+  ++   + G  KA+GVSNF  
Sbjct: 120 -KFVPFEERYPPGFYTGAEDEKKGV-ISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRG 177

Query: 179 NNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG---------- 228
             L+DLLA +  K+ PA  QIE HP L Q +L++YCK++ I V AYS FG          
Sbjct: 178 ILLHDLLAGA--KIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQ 235

Query: 229 -SINAPIL-KDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV--- 283
            + + P L + + +  +A    +   +V++ W  QR    ++PKS  +ER++ N ++   
Sbjct: 236 LAKSTPTLFEHDVVKKVANNHGVSTSEVLLRWATQR-RVAIIPKSSKKERLLNNLQINEK 294

Query: 284 VTLPDEDFQAINNLVKEKGELRVVDP-DW--SPFPLF 317
           +TL DE+ Q I++L K   ++R  DP +W    FP+F
Sbjct: 295 LTLSDEELQEISSLNK---DIRFNDPFNWLDMKFPVF 328

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  176 bits (446), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/333 (35%), Positives = 178/333 (53%), Gaps = 36/333 (10%)

Query: 10  ILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIR-- 67
           +L L+ G  +PQ+GLG W+ +  +     V  A+K GYR  D A  Y NE +VGK ++  
Sbjct: 4   LLTLNNGMKMPQVGLGCWK-IPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRA 62

Query: 68  --DSGVPRNEIFVTSKLWCAQTHDP---KLALNQTLKRLGLDYIDLYLMHWPVTFNPRSI 122
             D  V R ++FV SKLW    H P   KL L + LK LGLDY+DLY +H+P+ F  + +
Sbjct: 63  MDDGIVKRQDLFVVSKLW-NNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAF--KFV 119

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
             E+       T   D    +  E +    + T+  ++     G  K++G+SNF+   + 
Sbjct: 120 PMEERYPPQMYTGKADEAKGILTEENV-PLLDTYRALEECQREGLIKSIGISNFNGGLVA 178

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG-----------SIN 231
           D+L   + K  P A QIE HP L Q +LL+YCK  ++ V  YS FG           + N
Sbjct: 179 DILRGCSIK--PVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKN 236

Query: 232 APILKDE-TINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTLP 287
            P L D   I  IA+K ++   +V++ W  QR G  ++PKS H++R+++N  +   VTL 
Sbjct: 237 TPPLFDHPVIKKIAEKHNVSTAEVLLRWATQR-GVAIIPKSSHKKRLLSNLNIDDNVTLT 295

Query: 288 DEDFQAINNLVKEKGELRVVDP-DW--SPFPLF 317
           +ED ++I+ L +    LR  DP DW  S FP+F
Sbjct: 296 EEDLKSISGLNQ---NLRFNDPWDWNNSKFPIF 325

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  176 bits (446), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 120/333 (36%), Positives = 179/333 (53%), Gaps = 34/333 (10%)

Query: 9   NILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIR- 67
           +++ L+ G  +P +GLG W+ +  +     V  A+K GYR  D A  YGNE +VG+ IR 
Sbjct: 3   SVVTLNNGLKMPLVGLGCWK-IPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 68  --DSGV-PRNEIFVTSKLWCAQTH--DPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSI 122
             D GV  R ++FV SKLW +  H    K+AL +TL  +GLDY+DL+ +H+P+ F  + +
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAF--KYV 119

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
             E+     F T   D       E      I T+  ++   E G  K++G+SNFS + + 
Sbjct: 120 PFEEKYPPGFYTGKEDEKNGHITEAHV-PIIDTYRALEQCVEEGLIKSIGISNFSGSLVQ 178

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG-----SINAPILKD 237
           DLL     K+ P A Q+E HP L Q  L++YCK+  I V AYS FG      +N P+ K+
Sbjct: 179 DLL--RQCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKN 236

Query: 238 -------ETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTLP 287
                  +TI  IA   ++   QV++ W  QR G  ++PKS  +ER+  N  +   +TL 
Sbjct: 237 TPNLFHHDTIKQIANNHNVATSQVLLRWATQR-GIAIIPKSSKKERLQDNLMIDEKLTLT 295

Query: 288 DEDFQAINNLVKEKGELRVVDP-DW--SPFPLF 317
            ++ +AI+ L K    LR+ DP DW    FP+F
Sbjct: 296 HKELEAISKLNK---NLRLNDPWDWLDGKFPIF 325

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  174 bits (440), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/330 (36%), Positives = 172/330 (52%), Gaps = 36/330 (10%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIR---DS 69
           L+ G ++P +GLG W+ +  +     V  A+K GYR  D A  YGNE QVG  IR   D 
Sbjct: 7   LNNGLTMPLVGLGCWK-ISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRRAIDE 65

Query: 70  G-VPRNEIFVTSKLWCAQTHDPK---LALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDE 125
           G V R ++FV SKLW    HDPK   LAL +TL  + L+Y+DLY +H+P+ F  + +  E
Sbjct: 66  GIVKREDLFVVSKLW-NTYHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAF--KFVPFE 122

Query: 126 DGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLL 185
           +     F T   D+   +  E +    I T+  M+ L + G TK++G+SN++   + D L
Sbjct: 123 ERYPPGFYTGAEDAKKGILTE-EKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDTL 181

Query: 186 AASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG------------SINAP 233
                K  P   QIE HP L Q +L++YCK   I V AYS FG                P
Sbjct: 182 RGCRIK--PVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTPP 239

Query: 234 ILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTLPDED 290
           +     I  IA++  +   QV++ W  QR G  V+PKS H+ R++ N ++   VTL  +D
Sbjct: 240 LFDHPVIKKIAQEHKVTTSQVILRWATQR-GIAVIPKSAHKGRLLGNLQIDQAVTLTPKD 298

Query: 291 FQAINNLVKEKGELRVVDP-DW--SPFPLF 317
            + I++L K    LR  D  DW  S FP F
Sbjct: 299 LEEISSLNK---NLRFNDTWDWTISKFPSF 325

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  173 bits (438), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 117/333 (35%), Positives = 181/333 (54%), Gaps = 36/333 (10%)

Query: 10  ILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVG----KA 65
           ++ L+ G  +P +GLG W+ +  +     V  A+K GYR  D A  YGNE +VG    +A
Sbjct: 4   LITLNNGLKMPIVGLGCWK-IPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQA 62

Query: 66  IRDSGVPRNEIFVTSKLWCAQTHDPK---LALNQTLKRLGLDYIDLYLMHWPVTFNPRSI 122
           I +  V R E+FV SKLW +  HDPK   +AL +TL  + LDY+DLY +H+P+ F  + +
Sbjct: 63  ISEGIVKREELFVISKLWNS-YHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAF--KFV 119

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
             E+     F T   D+   + +  +    I T+  M+ L   G  K++G+SNF+   + 
Sbjct: 120 PFEEKYPAGFYTGKEDAEKGI-ISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQ 178

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG-----------SIN 231
           DLL   + K+ P   QIE HP L Q  L++YCK  +I V AYS FG           +++
Sbjct: 179 DLL--RSCKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALD 236

Query: 232 APIL-KDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTLP 287
           A +L + E I +IA    ++  QV++ W  QR G  ++PKS  +ER++ N  +   +TL 
Sbjct: 237 AKVLFEHEVIKSIATNHSVEPSQVLLRWATQR-GIAIIPKSSKKERLLENLLIDEKLTLS 295

Query: 288 DEDFQAINNLVKEKGELRVVDP-DWS--PFPLF 317
           +++   I++L      LR  DP DW+   FP+F
Sbjct: 296 EQELSTISDL---NIGLRFNDPWDWNNMKFPIF 325

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  172 bits (435), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 122/335 (36%), Positives = 179/335 (53%), Gaps = 37/335 (11%)

Query: 10  ILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIR-- 67
           ++ L+ G  +P +GLG W+ + T+     +  A+K GYR  D A  YGNE +VG+ I+  
Sbjct: 4   LVTLNNGLKMPLVGLGCWK-IPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKRA 62

Query: 68  -DSG-VPRNEIFVTSKLWCAQTHDP---KLALNQTLKRLGLDYIDLYLMHWPVTFNPRSI 122
            D G V R ++F+ SKLW    H P   KL L + LK LGLDY+DLY +H+P+ F  + +
Sbjct: 63  IDEGLVKREDLFIVSKLW-NNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAF--KFV 119

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
             ++       T   D    +  E +    I T+  M+ L + G  K++G+SN++   + 
Sbjct: 120 SPDERYPPGMYTGKEDEAKGILTEENV-PLIDTYRAMEKLVDEGLIKSIGISNYNGGLVA 178

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG-----------SIN 231
           D L     K  P A QIE HP L Q +LL+YCK  ++ V AYS FG           + N
Sbjct: 179 DTLRGCRIK--PVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKN 236

Query: 232 APILKDE-TINAIAKKLD-IQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTL 286
            P L D  TI  IA K + +   QV++ W  QR G  ++PKS  +ER++ N  +   VTL
Sbjct: 237 TPPLFDHPTIKKIADKYEAVTTSQVLLRWATQR-GVAIIPKSSKKERLLENLTIDQKVTL 295

Query: 287 PDEDFQAINNLVKEKGELRVVDP-DW--SPFPLFK 318
            +ED + I+ L +    LR  DP DW  S FP+F+
Sbjct: 296 AEEDLREISALNQ---NLRFNDPWDWNNSKFPIFQ 327

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  172 bits (435), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 118/329 (35%), Positives = 174/329 (52%), Gaps = 34/329 (10%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVG----KAIRD 68
           L+ G  +P IGLG W+ +  +     V  A+K GYR  D A  YGNE +VG    KAI +
Sbjct: 10  LNNGLEMPLIGLGCWK-IPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKKAIAE 68

Query: 69  SGVPRNEIFVTSKLWCAQTH--DPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
             V R ++FV SKLW +  H  + KLAL +TL  +GLDY+DL+ +H+P+ F  + +  E+
Sbjct: 69  GIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAF--KFVPFEE 126

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
                F T   D    V  + D    I T+  ++   + G  K++G+SNF+ + + DLL 
Sbjct: 127 KYPPGFYTGAEDEKNGVISQEDV-PLIDTYRALEKCVDEGLIKSIGISNFNGSLVQDLLR 185

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG------------SINAPI 234
            +  K  P A QIE HP L Q  L++YCK   I V AYS FG                 +
Sbjct: 186 GARIK--PVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAKTTPTL 243

Query: 235 LKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTLPDEDF 291
            +++T+  IA    +   QV++ W  QR G  V+PKS  +ER++ N  +   +TL D++ 
Sbjct: 244 FRNDTVKLIANNHKVSTSQVLLRWATQR-GVAVIPKSSKKERLLENLTINDSLTLSDKEL 302

Query: 292 QAINNLVKEKGELRVVDP-DW--SPFPLF 317
           +AI+ L K   ++R  DP  W  S FP F
Sbjct: 303 KAISALNK---DIRFNDPWTWLNSEFPTF 328

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  171 bits (434), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 117/334 (35%), Positives = 177/334 (52%), Gaps = 35/334 (10%)

Query: 9   NILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVG----K 64
           +++ L+ G  +P +GLG W+ +        +  A+  GYR  D A  YGNE +VG    +
Sbjct: 3   SVVALNNGNKMPLVGLGCWK-IPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 65  AIRDSGVPRNEIFVTSKLWCAQTH--DPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSI 122
           AI+D  V R E+FV SKLW +  H  + KLAL +TL  +GLDY+DL+ +H+P+   P S 
Sbjct: 62  AIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSF 121

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
           +++   G    T   D+   V  E +    + T+  ++   E G  K++GVSNFS + + 
Sbjct: 122 EEKYPPG--LYTGEADAKAGVLSE-EPVPILDTYRALEECVEEGLIKSIGVSNFSGSIML 178

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG------------SI 230
           DLL  +  ++ PAA QIELHP L Q   +++ + K I V AYS FG              
Sbjct: 179 DLLRGA--RIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKA 236

Query: 231 NAPILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTLP 287
             P+ + + +  IA K ++   QV++ W  Q+    V+PKS  +ER+  N  V   VTL 
Sbjct: 237 TPPLFEHDVVKKIAAKHNVSTSQVLLRWATQQ-KVAVIPKSSKKERLRQNLLVDQEVTLT 295

Query: 288 DEDFQAINNLVKEKGELRVVDP-DWS---PFPLF 317
            ++ + I+ L K    LR  DP  WS   PFP+F
Sbjct: 296 GDEIKEISGLNK---NLRFNDPFTWSEKTPFPIF 326

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  169 bits (427), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 117/332 (35%), Positives = 176/332 (53%), Gaps = 36/332 (10%)

Query: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIR--- 67
           +KL+ GA +P +GLG W+ +    A   V  A+K GYR +D A  Y NE +VG+ IR   
Sbjct: 33  IKLNNGADMPLVGLGCWK-IPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAI 91

Query: 68  DSG-VPRNEIFVTSKLWCAQTHDPK---LALNQTLKRLGLDYIDLYLMHWPVTFNPRSIK 123
           D G V R E+FV SKLW    H P+    AL +TL  LGLDY+DL+ +H+P+ F    ++
Sbjct: 92  DEGLVRREELFVVSKLW-NNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFVPLE 150

Query: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183
           +   +G    T   D      +  +    I+T+  ++ L + G+ +A+G+SNF    + D
Sbjct: 151 ERYPAG--LYTGAADEQAG-RLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQD 207

Query: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSIN------------ 231
           LL     ++ PAA QIE HP L Q  L+QY K + + V  YS  G  +            
Sbjct: 208 LLRG--CRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNA 265

Query: 232 APILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTLPD 288
           AP+L+ E +  IA++      +V++ W  QR    V+PKS  +ER+  N +V   +TL D
Sbjct: 266 APLLQHEVVCRIAERHTATPAEVLLRWATQR-DIAVIPKSSRKERLATNLRVDEALTLAD 324

Query: 289 EDFQAINNLVKEKGELRVVDP-DWS--PFPLF 317
           ++ + +++L      LR  DP DWS  P P F
Sbjct: 325 DELRELSSL---NCGLRFNDPWDWSAQPLPTF 353

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  164 bits (415), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 110/306 (35%), Positives = 164/306 (53%), Gaps = 28/306 (9%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIR----D 68
           L+ G  +P +GLG W+   T  A   V  A+K GYR  D A  YGNE +VG+ IR    +
Sbjct: 7   LNNGLKMPMVGLGCWKIPNTVCA-EQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRRAIDE 65

Query: 69  SGVPRNEIFVTSKLWCAQTH--DPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
             V R+++F+ SKLW    H    KLA+ +TL  LGLDY+DLY +H+P+ F    I+++ 
Sbjct: 66  KIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPIEEKY 125

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
             G  F T   D+     + +    ++ T+  M+ L E G  K++GVSN     L D+L 
Sbjct: 126 PPG--FYTGKEDA-AQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQDVLM 182

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSIN----APILKDET--- 239
               K+ P   QIE HP L Q+ L+ YCK + I+V AYS FG  +       LK++T   
Sbjct: 183 G--CKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDTPNL 240

Query: 240 -----INAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTLPDEDF 291
                I  IA K ++   +V++ W  Q  G  V+PKS  +ER++ N  +   +TL +E+ 
Sbjct: 241 FDHPVIKRIASKYNVTTSEVLLRWANQ-NGVAVIPKSSKKERLLMNLNIESTLTLSNEEL 299

Query: 292 QAINNL 297
             I+N+
Sbjct: 300 VEISNI 305

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  163 bits (412), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 115/332 (34%), Positives = 178/332 (53%), Gaps = 36/332 (10%)

Query: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVG----KAI 66
           +KL+ G  +P +GLG W+ +        V  A+K GYR  D A  YGNE +VG    KAI
Sbjct: 8   VKLNNGLQMPLVGLGCWK-IPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIHKAI 66

Query: 67  RDSGVPRNEIFVTSKLWCAQTHDPK---LALNQTLKRLGLDYIDLYLMHWPVTFNPRSIK 123
            +  V R ++FV SKLW +  HDPK    AL +TL+ + L+Y+DL+ +H+P+ F  + + 
Sbjct: 67  DEGIVKREDLFVVSKLWNS-YHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAF--KYVP 123

Query: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183
            E+     F T   D+   V + ++    I T+  ++   + G  K++G+SNF    ++D
Sbjct: 124 FEEKYPPGFYTGAEDAKKGV-ISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGILIHD 182

Query: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG-----------SINA 232
           LLA +T K  P   QIE HP L Q +L++YC ++ I V AYS FG           + + 
Sbjct: 183 LLAGATIK--PVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAKST 240

Query: 233 PIL-KDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTLPD 288
           P L + E I  IA    +   QV++ W  QR    ++PKS  +ER++ N ++   +TL +
Sbjct: 241 PTLFEHEGIQKIATNHGVSSSQVLLRWATQR-RIAIIPKSSKKERLLDNLQINEKLTLTE 299

Query: 289 EDFQAINNLVKEKGELRVVDP-DW--SPFPLF 317
            + Q I+ L K   ++R  DP  W    FP+F
Sbjct: 300 AELQEISALNK---DIRFNDPFTWLGMKFPVF 328

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  163 bits (412), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 119/334 (35%), Positives = 177/334 (52%), Gaps = 35/334 (10%)

Query: 9   NILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVG----K 64
           +++ L+ G  +P +GLG W+ +  +     V  A+K GYR  D A  YGNE +VG    K
Sbjct: 3   SLVTLNNGQKMPLVGLGCWK-ISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKK 61

Query: 65  AIRDSGVPRNEIFVTSKLWCAQTH--DPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSI 122
           AI +  V R+++FV SKLW +  H    KLAL + L+ LGLDYIDLY +H+P+ F  + +
Sbjct: 62  AIDEGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAF--KFV 119

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
             E+     F T   D+   +  E      + T+  ++   ++G  K++G+SNF+   + 
Sbjct: 120 PFEEKYPPGFYTGVDDAREGILSEAKV-PILDTYRALEECVDNGLIKSIGISNFNGVLVQ 178

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG-----------SIN 231
           DLL     K  P A QIE HP L Q +L++YCK K I V AYS FG           + +
Sbjct: 179 DLLNGCRIK--PVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKS 236

Query: 232 AP-ILKDETINAIAKKLDIQV-GQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTL 286
            P +L+   I  IA         +V++ W  QR G  V+PKS  +ER++ N  V   +TL
Sbjct: 237 TPSLLEHPIIKKIAAAHRSSTPSEVLLRWATQR-GIAVIPKSTKKERLLQNLNVEDSITL 295

Query: 287 PDEDFQAINNLVKEKGELRVVDP-DW--SPFPLF 317
            +E+   I++L K    +R  DP +W  S FP F
Sbjct: 296 TEEELNEISSLNK---NIRFNDPWEWLNSKFPTF 326

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  162 bits (411), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 119/339 (35%), Positives = 173/339 (51%), Gaps = 45/339 (13%)

Query: 9   NILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVG----K 64
           +++ L+ G  +P +GLG W+ +      + +  A+K GYR  D A  YGNE +VG    K
Sbjct: 3   SLVTLNNGCKMPLVGLGCWK-IDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGVPRNEIFVTSKLWCAQTHDP---KLALNQTLKRLGLDYIDLYLMHWPVTFNPRS 121
           AI +  V R +IFVTSKLW    H P   KLAL +TL  +GLDY+DLY +H+P+ F  + 
Sbjct: 62  AISEGLVTRKDIFVTSKLW-NNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAF--KY 118

Query: 122 IKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNL 181
           +  E+     F T   D       E      I T+  ++   + G  K++G+SNF  + +
Sbjct: 119 VPFEEKYPPGFYTGAEDDKRGHITEAHV-PIIDTYRALEACVDEGLIKSIGISNFQGSLV 177

Query: 182 NDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG-----------SI 230
            DLL     K  P A QIE HP L Q  L+ YCK  +I V AYS FG           + 
Sbjct: 178 QDLLRGCRIK--PVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAK 235

Query: 231 NAPILKDETINAIAKKLD-----IQVGQVVMSWHIQRGGYVVLPKSVHEERIIAN---RK 282
           + P L +   N + KK+          QV++ W  QR G  V+PKS  +ER++ N    K
Sbjct: 236 STPTLFE---NDVVKKVSENHPGSTTSQVLLRWATQR-GIAVIPKSSKKERLLGNLEIEK 291

Query: 283 VVTLPDEDFQAINNLVKEKGELRVVDPDWS----PFPLF 317
            +TL D++ + I++L      +R  DP W+     FP+F
Sbjct: 292 KLTLTDQELKEISSL---NANIRFNDP-WTWLDGKFPIF 326

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  162 bits (409), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 109/313 (34%), Positives = 167/313 (53%), Gaps = 30/313 (9%)

Query: 10  ILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVG----KA 65
           ++ L+ G  +P +GLG W+ +  +     V  A+K GYR  D AA YGNE +VG    KA
Sbjct: 4   MITLNNGLKMPLVGLGCWK-IPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINKA 62

Query: 66  IRDSGVPRNEIFVTSKLWCAQTH--DPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIK 123
           + +  V R+++F+ SKLW    H    KLAL +TL  LGLDY+DLY +H+P+ F  + + 
Sbjct: 63  LSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAF--KYVP 120

Query: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183
            E+     F T   D+     + +    ++ T+  M+ L + G TK++GVSN   + L D
Sbjct: 121 FEEKYPPCFYTGAEDAKIG-KISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQD 179

Query: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG-----------SINA 232
           +L     ++ PAA QIE HP L Q  L+Q+CK +NI V +YS FG           + + 
Sbjct: 180 VLMG--CRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDT 237

Query: 233 PILKDETI---NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTL 286
           P L D  +    A A   D+   +V++ W  QR    ++PKS  +ER++ N  V   +TL
Sbjct: 238 PALFDHPVIKKIAAAHGKDVTTSEVLLRWATQR-DIAIIPKSSRKERLLLNLNVNEKLTL 296

Query: 287 PDEDFQAINNLVK 299
            + +   I+ L K
Sbjct: 297 TEAELLEISALNK 309

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  160 bits (406), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 174/329 (52%), Gaps = 34/329 (10%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVG----KAIRD 68
           L+ G  +P +GLG W+ +  +     +  A+K GYR  D A  Y NE +VG    +AI++
Sbjct: 10  LNNGEKMPLVGLGCWK-MPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAIKE 68

Query: 69  SGVPRNEIFVTSKLWCAQTHDPKL--ALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126
             V R ++ V SKLW +  H   +  AL +TL  L LDY+D++ +H+P+ F P    ++ 
Sbjct: 69  GLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPFDEKY 128

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
             G  F T   D      +E +    + TW  ++ L + GK K++G+SNFS   + DLL 
Sbjct: 129 PPG--FYTGKEDE-AKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLLR 185

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG-----------SINAPIL 235
            +  K  P A QIE HP L Q  L++Y K   I V AYS FG           ++N P L
Sbjct: 186 GARIK--PVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPTL 243

Query: 236 -KDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV---VTLPDEDF 291
            + +TI +IA K  +   QV++ W  Q  G  ++PKS  +ER++ N ++   +TL D++ 
Sbjct: 244 FEHDTIKSIASKHKVTPQQVLLRWATQ-NGIAIIPKSSKKERLLDNLRINDALTLTDDEL 302

Query: 292 QAINNLVKEKGELRVVDP-DW--SPFPLF 317
           + I+ L +    +R  DP +W  + FP F
Sbjct: 303 KQISGLNQ---NIRFNDPWEWLDNEFPTF 328

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  157 bits (397), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 112/336 (33%), Positives = 169/336 (50%), Gaps = 39/336 (11%)

Query: 9   NILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVG----K 64
           +++ L+ G  +P +GLG W+ +  N   + +  A+K GYR  D A  YGNE +VG    K
Sbjct: 3   SLVTLNNGLKMPLVGLGCWK-IDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGVPRNEIFVTSKLWCAQTHDP---KLALNQTLKRLGLDYIDLYLMHWPVTFNPRS 121
           AI +  V R ++FV SKLW    H P   KLAL +TL  +GLDY+DLY +H+P+ F  + 
Sbjct: 62  AIYEGLVTRKDVFVVSKLW-NNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAF--KY 118

Query: 122 IKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNL 181
           I  E+     F T   D       E      I T+  ++   + G  K++G+SNF  + +
Sbjct: 119 IPFEEKYPPGFYTGTEDEEKGHITEAHV-PIIDTYRALEKCVDEGLIKSIGISNFQGSLV 177

Query: 182 NDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG------------S 229
            DLL     K  P A QIE HP L Q  L+++CK  +I V AYS FG             
Sbjct: 178 QDLLRGCRIK--PVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAK 235

Query: 230 INAPILKDETINAIAK-KLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIAN---RKVVT 285
               + +++ I  +++        QV++ W  QR G  V+PKS  +ER++ N    K  +
Sbjct: 236 ATQTLFENDVIKKVSENHTGSTTSQVLLRWATQR-GIAVIPKSSKKERLLGNLEIEKKFS 294

Query: 286 LPDEDFQAINNLVKEKGELRVVDPDWS----PFPLF 317
           L +++ + I+ L      +R  DP W+     FP F
Sbjct: 295 LTEQELKKISAL---NANIRFNDP-WTWLDGKFPTF 326

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  156 bits (394), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 113/336 (33%), Positives = 168/336 (50%), Gaps = 39/336 (11%)

Query: 9   NILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVG----K 64
           +++ L+ G  +P +GLG W+ +      + +  A+K GYR  D A  YGNE +VG    K
Sbjct: 3   SLVTLNNGLKMPLVGLGCWK-IDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIRDSGVPRNEIFVTSKLWCAQTHDP---KLALNQTLKRLGLDYIDLYLMHWPVTFNPRS 121
           AI +  V R +IFV SKLW    H P   KLAL +TL  +GLDY+DLY +H+P+ F  + 
Sbjct: 62  AISEGLVSRKDIFVVSKLW-NNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAF--KY 118

Query: 122 IKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNL 181
           +  E+     F T   D       E      I T+  ++   + G  K++GVSNF  + +
Sbjct: 119 VPFEEKYPPGFYTGADDEKKGHITEAHV-PIIDTYRALEECVDEGLIKSIGVSNFQGSLI 177

Query: 182 NDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG------------S 229
            DLL     K  P A QIE HP L Q  L+++CK  +I V AYS FG             
Sbjct: 178 QDLLRGCRIK--PVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAK 235

Query: 230 INAPILKDETINAIAKKL-DIQVGQVVMSWHIQRGGYVVLPKSVHEERIIAN---RKVVT 285
               + +++ I  +++        QV++ W  QR G  V+PKS  +ER++ N    K  T
Sbjct: 236 TTPTLFENDVIKKVSQNHPGSTTSQVLLRWATQR-GIAVIPKSSKKERLLGNLEIEKKFT 294

Query: 286 LPDEDFQAINNLVKEKGELRVVDPDWS----PFPLF 317
           L +++ + I+ L      +R  DP W+     FP F
Sbjct: 295 LTEQELKDISAL---NANIRFNDP-WTWLDGKFPTF 326

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  155 bits (393), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 113/339 (33%), Positives = 170/339 (50%), Gaps = 45/339 (13%)

Query: 9   NILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIR- 67
           +++ L+ G  +P +GLG W+ +      + +  A+K GYR  D A  YGNE +VG+ IR 
Sbjct: 3   SLVTLNNGLKMPLVGLGCWK-IDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 68  ---DSGVPRNEIFVTSKLWCAQTHDP---KLALNQTLKRLGLDYIDLYLMHWPVTFNPRS 121
              +  V R ++FV SKLW    H P   KLAL +TL  +GLDY+DLY +H+P+ F  + 
Sbjct: 62  AISEGLVARKDVFVVSKLW-NNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAF--KY 118

Query: 122 IKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNL 181
           +  E+     F T   D       E      + T+  ++   + G  K++G+SNF  + +
Sbjct: 119 VPFEEKYPPGFYTGVDDEKKGHITEAHV-PILDTYRALEECVDEGLIKSIGISNFQGSLV 177

Query: 182 NDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG-----------SI 230
            DLL     K  P A QIE HP L Q  L+++C+  NI V AYS FG           + 
Sbjct: 178 QDLLRGCRIK--PVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAK 235

Query: 231 NAPILKDETINAIAKKLDIQ-----VGQVVMSWHIQRGGYVVLPKSVHEERIIAN---RK 282
             P L +   N + KK+ +        QV++ W  QR G  V+PKS  +ER++ N    K
Sbjct: 236 TTPTLFE---NDVIKKISLNHPGSTTSQVLLRWATQR-GIAVIPKSSKKERLLGNLEIEK 291

Query: 283 VVTLPDEDFQAINNLVKEKGELRVVDPDWS----PFPLF 317
             TL +++ + I+ L      +R  DP W+     FP F
Sbjct: 292 KFTLTEQELKEISAL---NANIRFNDP-WTWLDGKFPTF 326

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  154 bits (390), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 118/338 (34%), Positives = 170/338 (50%), Gaps = 43/338 (12%)

Query: 10  ILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIR-- 67
           ++ L+ G  +P +GLG W+ +        V  A+K GYR  D A  YGNE +VG+ IR  
Sbjct: 4   VVTLNNGMKMPLVGLGCWK-IPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRKA 62

Query: 68  -DSG-VPRNEIFVTSKLWCAQTHDPK---LALNQTLKRLGLDYIDLYLMHWPVTFNPRSI 122
            D G V R E+FV SKLW +  HDPK    AL +TL  + LDY+DL+ +H+P+       
Sbjct: 63  IDEGIVKREELFVVSKLWNS-FHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPF 121

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWN--FIKTWELMQHLPESGKTKAVGVSNFSINN 180
           K++   G     + T S       M   N   I T+  ++ L + G  K++G+SNFS + 
Sbjct: 122 KEKYPPG-----LYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSI 176

Query: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG------------ 228
           + DLL     K  P A QIE HP L Q  L+ Y K + + V AYS FG            
Sbjct: 177 IMDLLRGCRIK--PVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLA 234

Query: 229 SINAPILKDETINAIAKK--LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV--- 283
               P+ ++  I  IAK    +I   QV++ W  Q     V+PKS  +ER+  N  +   
Sbjct: 235 KTTPPLFENPKIIEIAKNHGKEISPSQVLLRWATQ-NNVAVIPKSSKKERLHDNLHIDDK 293

Query: 284 VTLPDEDFQAINNLVKEKGELRVVDP----DWSPFPLF 317
           +TL D++ + I+ L K    +R  DP    D +PFP+F
Sbjct: 294 LTLTDQELKEISALNK---NIRFNDPYTWNDKNPFPIF 328

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  149 bits (377), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 148/284 (52%), Gaps = 44/284 (15%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD--- 68
           KLS+G +IP +GLGT+       AY  V  AL+ GYRH DTA +YGNE +VG+ I+    
Sbjct: 10  KLSSGYTIPSVGLGTYELPPNKTAY-LVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWLN 68

Query: 69  ---SGVPRNEIFVTSKLWCAQ--THDPKLALNQTLKRL-GLDYIDLYLMHWPVTFNPRSI 122
              +   R ++F T+KLW +Q      K A++  L+ +  L YIDL L+H P+       
Sbjct: 69  ENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPL------- 121

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
                             G   + ++      T+E MQ   ++GK +++GVSN+   ++ 
Sbjct: 122 ------------------GGKKLRLE------TYEAMQEAVDAGKVRSIGVSNYGFQHIE 157

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINA 242
           +LL     K  P  NQIE+ P   + EL  +CK+K ILVEAY+P    +   LKD  +  
Sbjct: 158 ELLNWEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVK 215

Query: 243 IAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTL 286
           +A ++   VGQ ++ W +Q+ GY+ LPK+    R+ +N  V + 
Sbjct: 216 VANEVGCDVGQALIRWSLQK-GYIPLPKTQSVSRLASNLDVFSF 258

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  147 bits (371), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/281 (34%), Positives = 141/281 (50%), Gaps = 44/281 (15%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD--- 68
           KLS G SIP +GLGT+  +  N   + V  ALK GYRH DTA +YGNE +VG+ I     
Sbjct: 10  KLSNGYSIPSVGLGTY-DIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLL 68

Query: 69  ---SGVPRNEIFVTSKLWCAQTHDPKL--ALNQTLKRL-GLDYIDLYLMHWPVTFNPRSI 122
                  R  +F T+KLW +Q    K   A+   L ++  L+YIDL L+H P+       
Sbjct: 69  EDPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPL------- 121

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
                             G   + ++      TW+ MQ   + G  K++GVSN+ +++++
Sbjct: 122 ------------------GGTKLRLE------TWKAMQEAVDHGMVKSIGVSNYGMHHID 157

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINA 242
           +LL     K  P  NQIE+ P L + EL  YCK  +I VE YSP    +   L D+ +  
Sbjct: 158 ELLTWQYLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKK 215

Query: 243 IAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV 283
           +A +    VGQV++ W +Q  GY+ LPK+    R+  N  V
Sbjct: 216 VANETGKNVGQVLIRWSLQH-GYIPLPKTRTINRLKTNLDV 255

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  146 bits (369), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 153/287 (53%), Gaps = 50/287 (17%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI----- 66
           KLS+G ++P IGLGT+  + +N     V  ALK GYRH+DTA +YGNE +VG+ I     
Sbjct: 11  KLSSGYTLPSIGLGTY-DLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLK 69

Query: 67  -RDSGVPRNEIFVTSKLWCAQT--HDPKLALNQTLKRL-GLDYIDLYLMHWPVTFNPRSI 122
              S   R ++F  +KLW +Q   ++ K A+ +  +++ GL YIDL L+H P++ + + +
Sbjct: 70  ENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRL 129

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
           +                               T++ MQ   + G  +++GVSN+ +++++
Sbjct: 130 E-------------------------------TYKAMQEAVDKGIVRSIGVSNYGVHHID 158

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG---SINAPILKDET 239
           +LL  +  K  P  NQIE+ P L + EL  YCK + ++VEAY+P      IN P      
Sbjct: 159 ELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPLTHGYKINHP-----N 213

Query: 240 INAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTL 286
           +  +AK+     GQV++ W +Q  GYV LPK+   +R+ +N  V  +
Sbjct: 214 VLRVAKEAGCNSGQVLIRWSLQH-GYVPLPKTKSVKRLPSNLDVYNI 259

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  146 bits (368), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 104/291 (35%), Positives = 147/291 (50%), Gaps = 47/291 (16%)

Query: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60
           MP P+      KL++G +IP IGLGT+    +N     V AAL+ GYRH+DTA +YGNEA
Sbjct: 1   MPVPKS----YKLASGFNIPTIGLGTYDLPPSNTT-AIVEAALEVGYRHLDTAVLYGNEA 55

Query: 61  QVGKAI-----RDSGVPRNEIFVTSKLWCAQ--THDPKLALNQTLKRL-GLDYIDLYLMH 112
           +V +       R   V R +IF T+KLW +Q      K A+ + ++ + GL YIDL LMH
Sbjct: 56  EVAQGAMNFLGRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMH 115

Query: 113 WPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVG 172
            P+                         G   V         TW+ MQ   + G  +++G
Sbjct: 116 SPI-------------------------GGKQVRRG------TWKAMQEAVDDGLVRSIG 144

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINA 232
           VS++   +L DL   S  K  PA NQIE+ P + + +L  YCK K I+VEAYSP    + 
Sbjct: 145 VSSYGQRHLEDLFEWSELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THG 202

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV 283
             L D  +  +A++     GQV++ W +Q  GYV LPK+    R+  N  V
Sbjct: 203 YKLDDPDLLKVAEETGKNPGQVLLRWSLQH-GYVPLPKTKTVSRLQLNLDV 252

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  144 bits (362), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 147/281 (52%), Gaps = 44/281 (15%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD--- 68
           KLS+G  +P IGLGT+  +   +    V  ALK+GYRH+DTA +YGNE +VG+ I+    
Sbjct: 18  KLSSGYILPSIGLGTY-DIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLE 76

Query: 69  ---SGVPRNEIFVTSKLWCAQT--HDPKLALNQTLKRLG-LDYIDLYLMHWPVTFNPRSI 122
                  R ++F T+KLW +Q    + K A+ + ++++  L YIDL L+H P++   R +
Sbjct: 77  EDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRRL 136

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
           +                               T++ MQ   + G  +++GVSN+  ++++
Sbjct: 137 E-------------------------------TYKAMQEAVDEGIVRSIGVSNYGKHHID 165

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINA 242
           +LL     K  P  NQIE+ P + + +L  YCK K ++VEA+SP    +   LK   +  
Sbjct: 166 ELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLL 223

Query: 243 IAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV 283
           +AK+     G+V++ W +Q  GYV LPKS   ER+  N K 
Sbjct: 224 VAKETGTDAGRVLIRWSLQH-GYVPLPKSRSVERLKGNVKA 263

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  142 bits (358), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 149/281 (53%), Gaps = 44/281 (15%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD--- 68
           KLS+G  +P +GLGT+  +   +    V  ALK GYRH+DTA +YGNE +VG+ +     
Sbjct: 11  KLSSGYVLPSLGLGTY-DIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLK 69

Query: 69  ---SGVPRNEIFVTSKLWCAQT--HDPKLALNQTLKRLG-LDYIDLYLMHWPVTFNPRSI 122
                  R+++F T+KLW +Q    + K A+ + L ++  L YID+ L+H P++   R +
Sbjct: 70  EDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLSGTRRRL 129

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
           +                               T++ MQ   ++G  +++GVSN+  ++++
Sbjct: 130 E-------------------------------TYKAMQEAVDAGIVRSIGVSNYGKHHID 158

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINA 242
           +LLA    K  P  NQIE+ P + + +L  YCK K ++VEA+SP    +   +K   +  
Sbjct: 159 ELLAWEELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVR 216

Query: 243 IAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV 283
           +A+++    GQV++ W +Q  GYV LPKS   ER+  N +V
Sbjct: 217 VAEEVGRNTGQVLIRWSLQH-GYVPLPKSRSVERLKGNLEV 256

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  141 bits (356), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 92/280 (32%), Positives = 141/280 (50%), Gaps = 44/280 (15%)

Query: 10  ILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD- 68
             K S G  +P I LGT+  +  +     V   +K GYRH DTA +YGNE +VG  I   
Sbjct: 5   FYKFSNGYKVPSIALGTY-DIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKW 63

Query: 69  -----SGVPRNEIFVTSKLWCAQT--HDPKLALNQTLKRL-GLDYIDLYLMHWPVTFNPR 120
                    R ++F T+KLW +Q      K+A+ Q L  + GL YIDL L+H P+     
Sbjct: 64  LHEDPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL----- 118

Query: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN 180
                +GS                        ++TW+ MQ   + G  K++GVSN+   +
Sbjct: 119 -----EGSKLR---------------------LETWQAMQEAVDEGMVKSIGVSNYGKKH 152

Query: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETI 240
           +++LL  S  K  P  NQIE+ P + + EL  YCK KN++VEA++P    +   + D  +
Sbjct: 153 VDELLNWSQLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL--CHGYKMTDPDL 210

Query: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIAN 280
             + K++D   GQV++ W +Q  GY+ LPK+   +R+ +N
Sbjct: 211 LKVCKEVDRNPGQVLIRWSLQH-GYLPLPKTKTVKRLESN 249

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  140 bits (353), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 95/296 (32%), Positives = 148/296 (50%), Gaps = 46/296 (15%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD--- 68
           KLS G  IP I LGT+  +  +     V   +K GYRH DTA +YGNE +VG  I     
Sbjct: 7   KLSNGIKIPSIALGTY-EIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLN 65

Query: 69  ---SGVPRNEIFVTSKLWCAQT--HDPKLALNQTLKRL-GLDYIDLYLMHWPVTFNPRSI 122
                  R +IF T+KLW +Q      K A+ Q L  + GL+YIDL L+H P+       
Sbjct: 66  EDPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL------- 118

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
              +GS                        ++TW  MQ   ++G  K++GVSN+   +++
Sbjct: 119 ---EGSKLR---------------------LETWRAMQEAVDAGVVKSIGVSNYGRKHID 154

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINA 242
           +LL  S  +  P  NQIE+ P + + EL  YCK K ++VEA++P    +   + +  +  
Sbjct: 155 ELLNWSELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLI 212

Query: 243 IAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVT--LPDEDFQAINN 296
           + K++D   GQV++ W +Q  GY+ LPK+   +R+  N    +  L DE  + +++
Sbjct: 213 VCKEVDRNPGQVLIRWSLQH-GYLPLPKTRTVKRLEGNLAAYSFELSDEQMKTLDH 267

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  139 bits (351), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 145/281 (51%), Gaps = 44/281 (15%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD--- 68
           +L  G  IP + LGT+  +  +     V  ALK GYRH DTA +YGNE +VG+ I +   
Sbjct: 12  ELQDGRKIPSLALGTY-DIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWIN 70

Query: 69  ---SGVPRNEIFVTSKLWCAQT--HDPKLALNQTLKRL-GLDYIDLYLMHWPVTFNPRSI 122
              +   R ++F T+KLW +Q   ++ K A+ + ++++ GL YID+ L+H P++   R  
Sbjct: 71  EDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLSGQRRR- 129

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
                                         ++TW+ MQ   + G  K++GVSN+  +++ 
Sbjct: 130 ------------------------------LETWKAMQEAVDEGIVKSIGVSNYGKHHIE 159

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINA 242
           +LL     K  P  NQIE+ P + + EL  YCK  N++VEAY+P    +   + D  +  
Sbjct: 160 ELLGWDELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMA--HGYKMNDPGLRE 217

Query: 243 IAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV 283
           I+K+  +  GQ+++ W +Q  GY+ LPK+    R+ +N  V
Sbjct: 218 ISKETGMNPGQLLIRWSLQH-GYLPLPKTKTVARLASNLDV 257

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  137 bits (346), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 147/302 (48%), Gaps = 54/302 (17%)

Query: 10  ILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI--- 66
             KLS G  IP I LGT+  +  +     V   +K GYRH DTA +YGNE +VG  I   
Sbjct: 5   FYKLSNGFKIPSIALGTY-DIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKW 63

Query: 67  --RDSG-VPRNEIFVTSKLWCAQT--HDPKLALNQTLKRL-GLDYIDLYLMHWPVTFNPR 120
              D G   R EIF T+KLW +Q      K A+ Q L  + GL YIDL L+H P+     
Sbjct: 64  LNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL----- 118

Query: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN 180
                +GS                        ++TW  MQ   + G  K++GVSN+   +
Sbjct: 119 -----EGSKLR---------------------LETWRAMQEAVDEGLVKSIGVSNYGKKH 152

Query: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSP----FGSINAPILK 236
           +++LL     K  P  NQIE+ P + + EL  YCK K ++VEA++P    +   N  +LK
Sbjct: 153 IDELLNWPELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPLCHGYKMTNPDLLK 212

Query: 237 DETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV--VTLPDEDFQAI 294
                 + K++D   GQV++ W +Q  GY+ LPK+   +R+  N       L DE  + +
Sbjct: 213 ------VCKEVDRNPGQVLIRWSLQH-GYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFL 265

Query: 295 NN 296
           ++
Sbjct: 266 DH 267

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  137 bits (346), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 106/327 (32%), Positives = 167/327 (51%), Gaps = 62/327 (18%)

Query: 7   SENILKLSTGASIPQI---GLGT-WRSVGTNDAYHS--VIAALKN------GYRHIDTAA 54
           ++    LS G  IP +   G GT W      DA  S  ++  +K       G  HID A 
Sbjct: 3   TQKFFTLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAE 62

Query: 55  IYGNEAQVGKAIRDSGVPRNEIFVTSKLWCAQ--THDPKLALNQTLKRLGLDYIDLYLMH 112
           IY    ++G A++D+  PR+EIF+T K    +  + +PK+AL  +LK+LG+DY+DLYL+H
Sbjct: 63  IYRTYPELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLH 122

Query: 113 WPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVG 172
            P+      IK+                  +DVE +       W+ ++ L +SGK K +G
Sbjct: 123 SPI------IKE----------------SKLDVEAN-------WKYLEELYKSGKAKNIG 153

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFGS 229
           VSNF++ +L  LLA +  K  P  NQIE  P L QN+   ++++ ++  IL+EAYSP G 
Sbjct: 154 VSNFAVKDLEKLLAVAEVK--PQVNQIEFSPFL-QNQTPGIVEFSQKNGILLEAYSPLGP 210

Query: 230 IN-APILKD-----ETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHE--ERIIANR 281
           +   P   D     + I  ++KK +    Q+++SW  +RG   +LP +     ERI   +
Sbjct: 211 LQRRPEDADKLPFYQYIAELSKKYNKSEAQILLSWVYERG---ILPVTTSSKIERIQQAQ 267

Query: 282 KV--VTLPDEDFQAINNLVKEKGELRV 306
            +   +L +E+ Q I  L  +   LR+
Sbjct: 268 DIFSFSLANEEVQKITQLGLQHPALRL 294

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  136 bits (342), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/277 (31%), Positives = 141/277 (50%), Gaps = 44/277 (15%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD---- 68
           L+ G  +P +GLG + S+  N     V  ALK GYRH DTA  YGNE +VG+ I      
Sbjct: 8   LTNGCLMPSLGLGCY-SIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWLAE 66

Query: 69  --SGVPRNEIFVTSKLWCAQT--HDPKLALNQTLKRLG-LDYIDLYLMHWPVTFNPRSIK 123
             S   R ++F  +KLW +Q    + K A+ Q L+++  L YIDL L+H P   + + + 
Sbjct: 67  DPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAKRLA 126

Query: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183
                                          T+E MQ   ++G  K++GVSN+  ++L +
Sbjct: 127 -------------------------------TYEAMQESVDAGIVKSIGVSNYERHHLQE 155

Query: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAI 243
           L A    K  P  NQIE+ P L +N+L+ YCK   + ++AYSP G  +   + D  I ++
Sbjct: 156 LYAMPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASL 213

Query: 244 AKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIAN 280
           A + +    Q++++W + + GY  LPK+ + +R+ +N
Sbjct: 214 ATQKNCTPAQILIAWSLAK-GYAPLPKTQNIQRLQSN 249

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  134 bits (338), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 145/300 (48%), Gaps = 57/300 (19%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI------ 66
           LS G  IP I LGT+  +  +     V   +K GYRH DTA +YGNE +VG  I      
Sbjct: 8   LSNGYRIPSIALGTY-DIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 67  RDSGVPRNEIFVTSKLWCAQT--HDPKLALNQTLKRL-GLDYIDLYLMHWPVTFNPRSIK 123
                 R +IF T+KLW +Q      K A+ Q L  + GL YIDL L+H P+        
Sbjct: 67  NPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL-------- 118

Query: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183
             +GS                        ++TW+ MQ   + G  K++GVSN+   ++++
Sbjct: 119 --EGSKLR---------------------LETWQAMQEAVDEGVVKSIGVSNYGKKHIDE 155

Query: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSP----FGSINAPILKDET 239
           LL        P  NQIE+ P + + EL  YCK K ++VEA++P    +   N  +LK   
Sbjct: 156 LLTWPDLTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPLCHGYKMTNPDLLK--- 212

Query: 240 INAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVK 299
              + K++D   GQV++ W +Q  GY+ LPK+   +R+  N     L   DF+ ++  +K
Sbjct: 213 ---VCKEVDRNPGQVLIRWSLQH-GYLPLPKTKTVKRLEGN-----LAAYDFELLDKQMK 263

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  134 bits (336), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/298 (30%), Positives = 148/298 (49%), Gaps = 51/298 (17%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI-----R 67
           L+ G  IP + LG + +    +  H+V  ALK+GYRH+D A +YGNE +VG  I      
Sbjct: 11  LTNGVKIPVLALGVYEA-PKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKE 69

Query: 68  DSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRL----GLDYIDLYLMHWPVTFNPRSIK 123
              V R+EIF T+K+     H  + A    +K L     ++YIDL L+H P+        
Sbjct: 70  TPNVSRSEIFYTTKV-SGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA------- 121

Query: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183
                                    T   + TW+ +Q     GK +A+GVSN+SI +L +
Sbjct: 122 ------------------------ATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEE 157

Query: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG---SINAPILKDETI 240
           L      KV P  NQ EL+P L + EL +YC++K +++EA+SP       + P L++   
Sbjct: 158 LYNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIK 217

Query: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVV--TLPDEDFQAINN 296
            +   +      Q+++ W +Q  G++ LPKS + +R I+N + +   + D+D +A+ +
Sbjct: 218 TSYPNQTP---AQILIRWSLQM-GFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  133 bits (335), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 155/309 (50%), Gaps = 50/309 (16%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD---- 68
           LS G  IP + LGT+    +  A + V  ALK GYRH DTA +Y NE +VG+ I      
Sbjct: 9   LSNGVKIPSLALGTYDLPKSTTA-NIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQE 67

Query: 69  --SGVPRNEIFVTSKLWCAQT-HDP-KLALNQTLKRL-GLDYIDLYLMHWPVTFNPRSIK 123
                 R ++F T+KLW +Q  + P K A+ + L+++  L YIDL L+H P++ + + ++
Sbjct: 68  DPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLSGSRKRLE 127

Query: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183
                                          T++ MQ   + G  K++GVSN+  ++L +
Sbjct: 128 -------------------------------TYKAMQEAVDEGIVKSIGVSNYGQHHLEE 156

Query: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAI 243
           LL+    K  P  NQIE+ P   + EL Q+C+ + I+VE Y+P    +   LKD  +  +
Sbjct: 157 LLSWEGLKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKV 214

Query: 244 AKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGE 303
           A+++    GQV++ W +Q  GY+ LPK+ + +R+  N  V      DF+   + +K    
Sbjct: 215 AEEVGKNTGQVLIRWSLQH-GYLPLPKTSNVDRLPGNLDVY-----DFKLTESQIKAFEH 268

Query: 304 LRVVDP-DW 311
               +P DW
Sbjct: 269 PEAHEPTDW 277

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  133 bits (335), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 95/306 (31%), Positives = 153/306 (50%), Gaps = 50/306 (16%)

Query: 16  GASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD------S 69
           G  IP + LG +  +  +   + V  ALK GYRH DTA +YGNE +VG+ I        +
Sbjct: 12  GIKIPSLALGCY-DIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKEDPA 70

Query: 70  GVPRNEIFVTSKLWCAQT-HDP-KLALNQTLKRLG-LDYIDLYLMHWPVTFNPRSIKDED 126
              R ++F T+KLW +Q  + P K  +++ + ++  L YIDL L+H P++  PR      
Sbjct: 71  NNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSPLS-GPR------ 123

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186
                                     ++T++ MQ   + G  K++GVSN+   ++ +L  
Sbjct: 124 ------------------------RRLETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYK 159

Query: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246
               K  P ANQIE+ P   + +L  +C+ K ++VEA+SP    +   LK+  + ++AKK
Sbjct: 160 WDKLKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSLAKK 217

Query: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306
           L    GQV++ W +QR G + LPK+ +  R+ +N +V      DF+     VKE      
Sbjct: 218 LGRDTGQVLIRWSLQR-GLLPLPKTQNPARLSSNLEVY-----DFELTPEDVKELDHPEA 271

Query: 307 VDP-DW 311
            +P DW
Sbjct: 272 YEPTDW 277

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  133 bits (335), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 93/314 (29%), Positives = 158/314 (50%), Gaps = 53/314 (16%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQ----VGKAIRD 68
           L+ G  IP +G GT+ +     A   V AA K GYRH+DTA +Y NE +    V K +++
Sbjct: 11  LTNGVKIPVLGFGTYET-PKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAKFLKE 69

Query: 69  S-GVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLG----LDYIDLYLMHWPVTFNPRSIK 123
           S  V R+++F T+K+     H  + A    ++ L     L+Y+DL+L+H P         
Sbjct: 70  SPKVSRDQVFYTTKV-AGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA------- 121

Query: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183
                                   +T   + T++ +Q   ++GK KA+GVS++SI +L +
Sbjct: 122 ------------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157

Query: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAI 243
           L +    +V P  NQ EL+P L + +L++YCKE+++++EA+SP     +    D  +  +
Sbjct: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKL 215

Query: 244 AKKL--DIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVV--TLPDEDFQAINNLVK 299
            K+        Q+++ W +Q  G+V LPKSVHE+R  +N   +   +  ED + + +   
Sbjct: 216 LKESYPGRTPAQLLIRWSLQM-GFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH--- 271

Query: 300 EKGELRVVDPDWSP 313
             GE  +  P + P
Sbjct: 272 -DGEHFLAQPGFDP 284

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  133 bits (335), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 105/327 (32%), Positives = 160/327 (48%), Gaps = 61/327 (18%)

Query: 7   SENILKLSTGASIPQI---GLGT-WRSVGTNDAYHS------VIAALK-NGYRHIDTAAI 55
           ++  + L+ G  IP I   G GT W      DA  S      ++ ALK  G  HID A I
Sbjct: 4   NQQFITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEI 63

Query: 56  YGNEAQVGKAIRDSGVPRNEIFVTSKLWCAQ---THDPKLALNQTLKRLGLDYIDLYLMH 112
           Y    +VGKA+  +  PRNEIF+T K +  Q   +  P + L+  LK++G DY+DLYL+H
Sbjct: 64  YRTYPEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLH 122

Query: 113 WPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVG 172
            P                    +  ++NG        +   + W+ M+ L  SGK K +G
Sbjct: 123 SPF-------------------VSKETNG--------FTLEEAWKDMEQLYRSGKAKNIG 155

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFGS 229
           VSNF++ +L  +L  +  ++ P  NQIE  P L QN+   + ++C+E +IL+EAYSP G 
Sbjct: 156 VSNFAMKDLERILKVA--EIRPQVNQIEFSPFL-QNQTPGIYKFCQENDILLEAYSPLGP 212

Query: 230 INAPILKDET------INAIAKKLDIQVGQVVMSWHIQRGGYVVLP--KSVHEERIIANR 281
           +     KDE+      +  +++K      Q+ + W  +RG   VLP   S   +RI   +
Sbjct: 213 LQKRTTKDESLPFFEYVKELSEKYIKSEAQITLRWVTRRG---VLPVTTSSKPQRISDAQ 269

Query: 282 KVVT--LPDEDFQAINNLVKEKGELRV 306
            + +  L DE+   I  L  E   LR+
Sbjct: 270 NLFSFDLTDEEVNQITELGLEHEPLRL 296

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  132 bits (333), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 87/278 (31%), Positives = 138/278 (49%), Gaps = 45/278 (16%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI----- 66
           +LS G  IP +GLG ++ V        V  AL+ GYR  D+A  Y NE  V + I     
Sbjct: 14  RLSDGTQIPSVGLGVYQ-VSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLK 72

Query: 67  RDSGVPRNEIFVTSKLWCAQTHD---PKLALNQTLKRLG-LDYIDLYLMHWPVTFNPRSI 122
              G  R +++ T+K+   Q H     K +L ++L   G L YIDL L+H P++   R  
Sbjct: 73  HAPGRRREDVYFTTKI-NTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRR- 130

Query: 123 KDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLN 182
                                         + TW+ ++     G+ +++GVSN+   +L+
Sbjct: 131 ------------------------------LGTWQALEEAVVEGQVRSIGVSNYGQQHLS 160

Query: 183 DLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINA 242
           +LL     K+ P  NQ+E++P L + EL+QYC+E NI V+A+SP   +    L D  +  
Sbjct: 161 ELLGWEGLKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQK 218

Query: 243 IAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIAN 280
           +A + D  V Q+++ W IQ  G++VLPK+  +ER+  N
Sbjct: 219 VAHQYDKGVAQILVRWSIQM-GFIVLPKAAKKERLAPN 255

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  132 bits (331), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/295 (32%), Positives = 146/295 (49%), Gaps = 50/295 (16%)

Query: 8   ENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIR 67
           E   KL+ G  IP IG G +  +   D    V +ALK+GYRHIDTA +Y N+ +  + +R
Sbjct: 10  ETRYKLNNGQQIPVIGFGVY-EIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVR 68

Query: 68  ----DSGVPRNEIFVTSKLWCAQ--THDPKLALNQTLKRLG--LDYIDLYLMHWPVTFNP 119
               ++G  R  I+ T+KLW +Q    + + AL +    +   + Y+DL L+H P     
Sbjct: 69  KYLDETGEARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSP----- 123

Query: 120 RSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESG----KTKAVGVSN 175
                                G     ++TW       L Q + E G    + K++GVSN
Sbjct: 124 --------------------RGGAKRRLETWAI-----LEQAVQEPGSKALEIKSIGVSN 158

Query: 176 FSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPIL 235
           F +++L +LL  +  KV P  +Q+ELHP L + EL +Y KEK+I  EAYSP        L
Sbjct: 159 FGVDHLEELLKVA--KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL--TQGYRL 214

Query: 236 KDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDED 290
           +D  + A+  K  I    +++ W   + G+VVL KS + ERI  N  +  LP E+
Sbjct: 215 QDPELLALEAKTGINKAVILLRWSFLQ-GFVVLVKSSNPERIRQN--LAVLPSEN 266

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  131 bits (329), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 91/295 (30%), Positives = 143/295 (48%), Gaps = 46/295 (15%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRD---- 68
            + G  IP I LGT+  +  +     V  ALK GYRH DTA +YGNE QVG+ I      
Sbjct: 10  FNNGNQIPSIALGTY-DIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQE 68

Query: 69  --SGVPRNEIFVTSKLWCAQT--HDPKLALNQTLKRL-GLDYIDLYLMHWPVTFNPRSIK 123
                 R+++F T+KLW +Q   H  + A+ + L ++ GL YID+ L+H P+    +   
Sbjct: 69  DPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKR-- 126

Query: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183
                                        ++TW  MQ   ESG  K +GVSN+   ++ +
Sbjct: 127 -----------------------------LETWRAMQEAVESGLVKNIGVSNYGRQHVEE 157

Query: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAI 243
           LL      + P  NQIE+ P + ++EL  YCK   ++VEA++P    +   L D  +  +
Sbjct: 158 LLQWERLTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRV 215

Query: 244 AKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV--VTLPDEDFQAINN 296
           +K++     QV++ W +Q  GY+ LPK+   +R+  N +     L  E  Q I++
Sbjct: 216 SKEVGRSTVQVLIRWSLQH-GYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  130 bits (328), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 103/315 (32%), Positives = 152/315 (48%), Gaps = 57/315 (18%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKA-----I 66
           KLS+   IP + LGT+  + +++    V  AL  GYRH DTA +Y NE +V +      I
Sbjct: 10  KLSSNYYIPTVALGTY-DLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWLI 68

Query: 67  RDSGVPRNEIFVTSKLWCAQ--THDPKLALNQTLKRL-GLDYIDLYLMHWPVTFNPRSIK 123
           R     R+EIF T+KLW +Q    + K A+ + + ++  L YIDL LMH P+   P+ I+
Sbjct: 69  RHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPIG-GPQ-IR 126

Query: 124 DEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLND 183
           +E                             TW  MQ   + G  K++GVSNF I +L +
Sbjct: 127 EE-----------------------------TWRAMQEAVDEGIVKSIGVSNFGIKHLKE 157

Query: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFG---SINAPILKDETI 240
           L      K  P  NQIE+ P L + EL  +CK + ++VEAY+P      IN P L     
Sbjct: 158 LFQWDGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPLTHGYKINHPDLI---- 213

Query: 241 NAIAKKLD--IQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLV 298
             I+ +L+     GQ+++ W +Q  GYV LPK+    R+ +N  V      DF+   + +
Sbjct: 214 -KISNELNNTKNTGQILIRWSLQH-GYVPLPKTKTIGRLESNLDVY-----DFELTEDQM 266

Query: 299 KEKGELRVVDP-DWS 312
           K        +P DW 
Sbjct: 267 KFLDHPEAYEPTDWE 281

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  131 bits (329), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 101/325 (31%), Positives = 155/325 (47%), Gaps = 55/325 (16%)

Query: 6   VSENILKLSTGASIPQI---GLGT-WRSVGTNDAYHS--VIAALKN-----GYRHIDTAA 54
           V +   KL+ G  +P +   G GT W  V   D   S  ++  LK      G  H+D A 
Sbjct: 2   VKQEFFKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAE 61

Query: 55  IYGNEAQVGKAIRDSGVPRNEIFVTSKLWCAQ--THDPKLALNQTLKRLGLDYIDLYLMH 112
            Y    +VG+A+ ++  PR+EIF+T K W     T +P + L   LKRLGL+Y+DLYL+H
Sbjct: 62  FYMTYREVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLH 121

Query: 113 WPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVG 172
            P                    I  ++NG        ++  + W +M+ L  SGK K +G
Sbjct: 122 SPF-------------------ISKETNG--------FSLEEAWGMMEELYHSGKAKNIG 154

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFGS 229
           VSNF+  +L  +L     KV P  NQIE +  L QN+   +  +CK+ +I + AYSP G 
Sbjct: 155 VSNFAKEDLERVL--KVCKVKPQVNQIEFNAFL-QNQTPGIYNFCKQNDIQLAAYSPLGP 211

Query: 230 INAPILKDET------INAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV 283
           +        +      IN +A+  +   GQV++ W  +R G V +  S  +ERI   +++
Sbjct: 212 LQKKPADGNSQPFYSYINKLAQHYNKTPGQVLLRWVTKR-GVVAVTTSEKKERIKQAQEI 270

Query: 284 VT--LPDEDFQAINNLVKEKGELRV 306
               L D++   I  L  +   LR+
Sbjct: 271 FEFDLKDDEVTEITKLGLDHEPLRL 295

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  130 bits (328), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 106/336 (31%), Positives = 169/336 (50%), Gaps = 63/336 (18%)

Query: 6   VSENILKLSTGASIPQI---GLGT--WRSVGTNDAYH-SVIAALKN-----GYRHIDTAA 54
           +++    L+ G  IP I   G GT  ++  G+   +   ++  +K      G  HID A 
Sbjct: 3   LTQKFFDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAE 62

Query: 55  IYGNEAQVGKAIRDSGVPRNEIFVTSKLWCAQ---THDPKLALNQTLKRLGLDYIDLYLM 111
            YG   ++ KA+++S  PR+EIF+T K +  Q   T+DP   LN  LK LGLDY+DLYL+
Sbjct: 63  CYGTYPELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLI 121

Query: 112 HWPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAV 171
           H P  F+P                  +  G++ +E       K W+ M+ L + GK K++
Sbjct: 122 HSPF-FDP------------------EFKGSLTLE-------KVWKDMETLYKEGKAKSI 155

Query: 172 GVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFG 228
           GVSNFS+ N+ ++L  +  K  P  NQIE +  L QN+   ++ YC++ NI +EAYSP G
Sbjct: 156 GVSNFSVKNIEEILKIAGIK--PQVNQIEFNAFL-QNQTPGIVNYCQKNNIQLEAYSPLG 212

Query: 229 SINA-PILKDE-----TINAIAKKLDIQVGQVVMSWHIQRGGYVVLP--KSVHEERIIAN 280
            +   P   +E      I+ +A K      Q++++W   RG   +LP   S   +RII  
Sbjct: 213 PLQKRPENSNELPFYNYIDELASKYGKTDSQILLNWVYNRG---ILPITTSSKTQRIIDA 269

Query: 281 RKVVT--LPDEDFQAINNLVKEKGELRVVDPDWSPF 314
           + + +  L  ++   +  L  E+  LR+    W+ F
Sbjct: 270 QNIFSFNLTKDEVDTLTKLGLEQPALRIY---WTNF 302

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  129 bits (325), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 140/283 (49%), Gaps = 44/283 (15%)

Query: 12  KLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI----R 67
           KL+ G  +P IG G +  +   +    V  AL+ GYRHIDTA +Y N+ Q  + +     
Sbjct: 14  KLNNGTEVPVIGFGVY-DIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGVHRFLE 72

Query: 68  DSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLD------YIDLYLMHWPVTFNPRS 121
           ++G PR E++ T+KLW   T   + A  + L+ +  D      Y+DL L+H P+T   R 
Sbjct: 73  ETGTPREEVWFTTKLW--NTQQGRDATPRALEEIAADVKEFIGYVDLLLLHSPLTDAQR- 129

Query: 122 IKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNL 181
                                    ++TW  ++   + +    + + +A+GVSNF + +L
Sbjct: 130 ------------------------RLETWAVLER-AVQEPASSALEIRAIGVSNFGVRHL 164

Query: 182 NDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETIN 241
            +LL  +T K  P  +Q+ELHP L + EL  + +E  IL EAYSP        L+D  + 
Sbjct: 165 QELLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRLQDPELL 220

Query: 242 AIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVV 284
           A+  K  +  G++++ W   + G+ VL KS + +RI  N  V+
Sbjct: 221 ALEAKSGLSKGEILLRWSFLQ-GFAVLVKSNNPQRIRDNLAVL 262

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  129 bits (323), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/316 (30%), Positives = 157/316 (49%), Gaps = 57/316 (18%)

Query: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQ----VGKAIRD 68
           L  G  +P +GLG +++    +  + V  ALK GYR +D+A +YGNE +    + K + +
Sbjct: 11  LKNGVKMPCLGLGLYQT-PKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEE 69

Query: 69  S-GVPRNEIFVTSKLWCAQTHD-----PKLALNQTLKRLG-LDYIDLYLMHWPVTFNPRS 121
           S  V R++IF T+K+   +T D      K ++ ++L R+  LDYIDL+L+H P+T   + 
Sbjct: 70  SPKVSRSDIFFTTKI---KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126

Query: 122 IKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNL 181
                                          + TW+  Q   E+GK KA+GVSN+ I +L
Sbjct: 127 -------------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHL 155

Query: 182 NDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKD-ETI 240
            ++      K+ P  NQ EL+P L + EL  YC +K ++++AYSP     A  L+D E +
Sbjct: 156 EEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELV 213

Query: 241 NAIAKKLDIQV-GQVVMSWHIQRGGYVVLPKSVHEERIIANRKVV--TLPDEDFQAINNL 297
             +      Q   Q++++W +Q  G+V L K+VHE+R+  N K     L   D + + + 
Sbjct: 214 KLVEDSYPEQTSAQILVNWSLQM-GFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH- 271

Query: 298 VKEKGELRVVDPDWSP 313
                +  +  P W P
Sbjct: 272 ---DDQYYLSQPKWDP 284

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  126 bits (317), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 103/325 (31%), Positives = 152/325 (46%), Gaps = 59/325 (18%)

Query: 8   ENILKLSTGASIPQI---GLGT-WRSVGTNDAYHS------VIAALK-NGYRHIDTAAIY 56
           +    L+ G  IP I   G GT W      DA  S      ++ ALK  G  HID A IY
Sbjct: 5   QQFFTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIY 64

Query: 57  GNEAQVGKAIRDSGVPRNEIFVTSKL--WCAQTHDPKLALNQTLKRLGLDYIDLYLMHWP 114
               +VGKA+  +  PRN IF+T K       +  P   L+  LK++G DY+DLYL+H P
Sbjct: 65  RTYPEVGKALSLTEKPRNAIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSP 124

Query: 115 VTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVS 174
                                       V  E++  +  + W+ M+ L +SGK K +GVS
Sbjct: 125 F---------------------------VSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVS 157

Query: 175 NFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFGSIN 231
           NF++ +L  +L  +  K  P  NQIE  P L QN+   + ++C+E +ILVEAYSP G + 
Sbjct: 158 NFAVEDLQRILKVAEVK--PQVNQIEFSPFL-QNQTPGIYKFCQEHDILVEAYSPLGPLQ 214

Query: 232 APILKD------ETINAIAKKLDIQVGQVVMSWHIQRGGYVVLP--KSVHEERIIANRKV 283
               +D      E +  +++K      Q+++ W  +RG   VLP   S   +RI   + +
Sbjct: 215 KKTAQDDSQPFFEYVKELSEKYIKSEAQIILRWVTKRG---VLPVTTSSKPQRISDAQNL 271

Query: 284 VT--LPDEDFQAINNLVKEKGELRV 306
            +  L  E+   I  L  E   LR+
Sbjct: 272 FSFDLTAEEVDKITELGLEHEPLRL 296

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  125 bits (315), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 138/285 (48%), Gaps = 60/285 (21%)

Query: 8   ENILKLSTGASIPQI---GLGT-WRSVGTNDAYHSV-------IAALKNGYRHIDTAAIY 56
           +    L+ G  IP I   G GT W      DA  S        +A    G  HID A IY
Sbjct: 5   QEFFTLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIY 64

Query: 57  GNEAQVGKAIRDSGVPRNEIFVTSKLWCAQ---THDPKLALNQTLKRLGLDYIDLYLMHW 113
               +V  A+R+S  PR+EIF+T K +  Q   + DP   LN +LK LGLDY+DLYL+H 
Sbjct: 65  RTYPEVAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHS 123

Query: 114 PVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGV 173
           P   N  ++++                               W+ M+ L +SGK K +GV
Sbjct: 124 PFIKNGSTLEE------------------------------CWKQMEKLYKSGKAKNIGV 153

Query: 174 SNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFGSI 230
           SNF + +L  +L  +T K  P  NQIE +  L QN+   ++++CKE NI +EAY+P G  
Sbjct: 154 SNFRVEDLEKILKIATIK--PQINQIEFNAAL-QNQSPGIVKFCKENNIQLEAYTPLGPF 210

Query: 231 ----NAPILKD--ETINAIAKKLDIQVGQVVMSWHIQRGGYVVLP 269
               + P  K   + I  ++KK +    Q+++ W  +RG   +LP
Sbjct: 211 QRIQDTPEAKPFYDYIAELSKKYNKTEAQILLRWVTKRG---ILP 252

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  123 bits (309), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/315 (30%), Positives = 148/315 (46%), Gaps = 55/315 (17%)

Query: 7   SENILKLSTGASIPQ---IGLGT-WRSVGTNDA--YHSVIAALK-----NGYRHIDTAAI 55
           ++  + L+ G  +P    IG GT W      D    H +I  L+      G  HID A +
Sbjct: 4   NQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAAEM 63

Query: 56  YGNEAQVGKAIRDSGVPRNEIFVTSK--LWCAQTHDPKLALNQTLKRLGLDYIDLYLMHW 113
           YG   ++  A+R +  PR+EIF+T K  L  A + DP   L  +LK   LDY+DLYL+H 
Sbjct: 64  YGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYLLHS 123

Query: 114 PVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGV 173
           P     +     +G+                           W  M+ L + GK K +GV
Sbjct: 124 PFVAKEKPGLTLEGA---------------------------WRQMEQLYKDGKAKNIGV 156

Query: 174 SNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFGSI 230
           SNFS+ +L  +L  S  ++ P  NQIE HP L QN+   +L++C+++NI +EA++P G +
Sbjct: 157 SNFSVEDLKRVL--SVAEIKPQVNQIEFHPFL-QNQTPGILKFCQDENIELEAFTPLGPL 213

Query: 231 NAPILKDET------INAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVV 284
                +DE       I++++ K      Q+++ W  +RG   V     H +RI   + + 
Sbjct: 214 QVKTQEDENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRH-DRIADAQNLF 272

Query: 285 T--LPDEDFQAINNL 297
              L DE+   I  L
Sbjct: 273 EFDLEDEEVTKITRL 287

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  122 bits (307), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 156/317 (49%), Gaps = 61/317 (19%)

Query: 8   ENILKLSTGASIPQI---GLGT--WRSVGTNDAY-----HSVIAALK-NGYRHIDTAAIY 56
           +  + L+ G  IP I   G GT  +++V T+  +       ++ AL+  G  HID A IY
Sbjct: 5   QKFIVLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIY 64

Query: 57  GNEAQVGKAIRDSGVPRNEIFVTSKLWCAQ---THDPKLALNQTLKRLGLDYIDLYLMHW 113
               +VGKA+  +  PR+EIF+T K +  Q   +  P   L  +LK++G DY+DLYL+H 
Sbjct: 65  RTYPEVGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHS 123

Query: 114 PVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGV 173
           P                    +  ++NG        +   + W+ M+ L ++GK K +GV
Sbjct: 124 PF-------------------VSKEANG--------FTLEEAWKDMEQLYKAGKAKNIGV 156

Query: 174 SNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFGSI 230
           SNF++ +L  +L  +  K  P  NQIE  P L QN+   + ++C++ NIL+EAYSP   +
Sbjct: 157 SNFAVKDLEKILKIAEVK--PQVNQIEFSPFL-QNQTPGIYKFCQDNNILLEAYSPLAPL 213

Query: 231 NAPILKD------ETINAIAKKLDIQVGQVVMSWHIQRGGYVVLP--KSVHEERIIANRK 282
                +D      E +  +++K      Q+++ W  +RG   VLP   S   +RI   + 
Sbjct: 214 QKKTAQDDSKPFFEYVKELSEKYFKSEAQIILRWVSKRG---VLPVTTSSKPQRISDAQN 270

Query: 283 VVT--LPDEDFQAINNL 297
           + +  L DE+   I  L
Sbjct: 271 LFSFDLTDEEVDEITEL 287

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  122 bits (305), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 95/316 (30%), Positives = 146/316 (46%), Gaps = 63/316 (19%)

Query: 14  STGASIPQIGLGT---WRSVG---------TNDAYHSVIAALKNGYRHIDTAAIYGNEAQ 61
            T   IP +G GT   WR             +     ++ A+  G+ HIDTA  Y    +
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 62  VGKAIRDSGVPRNEIFVTSKL----WCA-QTHDPKLALNQTLKRLGLDYIDLYLMHWPVT 116
           VG+A+R S +PR+++F+T K     W       P  A  + L+ LG+ Y DLY++H P  
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYMLHRPDI 132

Query: 117 FNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNF 176
                               T  N  +D++       + W  ++ L E+G  KA+GVSNF
Sbjct: 133 --------------------TKENAGIDLQ-------EAWRQVEELYEAGIAKAIGVSNF 165

Query: 177 SINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFGSINAP 233
            +  L  +   S  + +P  +Q+E HP L QN+   ++++C+ K+I+VEAYSP     AP
Sbjct: 166 PLETLKQM--ESYCRYLPMVHQVEFHPYL-QNQSPGVVEWCQNKHIVVEAYSPL----AP 218

Query: 234 ILK------DETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERI--IANRKVVT 285
           + +      D+ +  + KK      Q+V+ W I R G V L  S  EERI  I       
Sbjct: 219 LFRARPGPLDDILPNLMKKYGKSETQIVLRWVIDR-GIVALTTSSKEERIHEILGTLDFE 277

Query: 286 LPDEDFQAINNLVKEK 301
           L   D + IN +  +K
Sbjct: 278 LEKSDVELINEVGSKK 293

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  120 bits (302), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 98/324 (30%), Positives = 152/324 (46%), Gaps = 70/324 (21%)

Query: 6   VSENILKLSTGASIPQIGLGTWRSVGTNDAYH-----------SVIAALKN-----GYRH 49
            S+    L+ G  IP I +     +GT   +H            ++  L+      G  H
Sbjct: 3   FSQEFFTLNNGNKIPAISI-----IGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIH 57

Query: 50  IDTAAIYGNEAQVGKAIRDSGVPRNEIFVTSKLWCAQ---THDPKLALNQTLKRLGLDYI 106
           ID A +Y    +V KA++ +   R+EIF+T K +      T +P   L ++LK L LDY+
Sbjct: 58  IDAAEMYNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYV 117

Query: 107 DLYLMHWPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESG 166
           DLYL+H P                    I  +S G        +   + W+ M+ L + G
Sbjct: 118 DLYLLHSPF-------------------ITKESCG--------YTMEEAWKQMEKLYKDG 150

Query: 167 KTKAVGVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEA 223
           K K +GVSNFS+++L  +L     K  P  NQIE +  L QN+   ++++C++ +ILVEA
Sbjct: 151 KAKNIGVSNFSVDDLKRILKICEIK--PQINQIEFNAFL-QNQTPGIVKFCQDHDILVEA 207

Query: 224 YSPFGSI-NAPILKD-----ETINAIAKKLDIQVGQVVMSWHIQRGGYVVLP--KSVHEE 275
           YSP G +   P  +D     + I  +AKK     GQV++ W  +R    +LP   S  EE
Sbjct: 208 YSPLGPLRKKPTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRK---ILPITTSGKEE 264

Query: 276 RIIANRKVVT--LPDEDFQAINNL 297
           RI   + + +  L  E+ + I  L
Sbjct: 265 RIKDAQDLFSFDLTSEEVEKITKL 288

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  120 bits (301), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 89/311 (28%), Positives = 152/311 (48%), Gaps = 55/311 (17%)

Query: 15  TGASIPQIGLGT---WR----SVGTNDAY-----HSVIAALKNGYRHIDTAAIYGNEAQV 62
           +G  IP IG G+   WR    S    D +       V +A+  G+ HID A  Y    +V
Sbjct: 13  SGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAYKTHPEV 72

Query: 63  GKAIRDSGVPRNEIFVTSKL------WCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVT 116
           G+ +++SGVPR+++++T K       W   T  P  +L+ +L+++ + Y+DLYL+H P  
Sbjct: 73  GRGVKNSGVPRDKLWITDKYTPWSWDWRKGT-GPLESLSLSLEKMQMSYVDLYLLHVP-- 129

Query: 117 FNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNF 176
                          F+T+ T     +D++       + W  M+ + + G  K +GVSNF
Sbjct: 130 ---------------FITVQT---AGIDLK-------EAWRQMEEIYDRGLAKNIGVSNF 164

Query: 177 SINNLNDLLAASTTKVVPAANQIELHPLLAQNE--LLQYCKEKNILVEAYSPFGSINA-- 232
            + +L  +      K +P  NQIE +  L Q    ++ YCK+ +I+VE YSP   +    
Sbjct: 165 DVESLEYI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTKGR 222

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV--VTLPDED 290
           P   D+ + A+A+K      Q+++ W + + G VV+  S  + R+  +  +    L  ED
Sbjct: 223 PGPLDKLLPALAEKYHKSELQILLRW-VTQNGVVVITTSAQQARVKESVNIFDFELTAED 281

Query: 291 FQAINNLVKEK 301
           F +I  + +EK
Sbjct: 282 FDSITKIGREK 292

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  119 bits (297), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 93/304 (30%), Positives = 150/304 (49%), Gaps = 56/304 (18%)

Query: 18  SIPQIGLGT--WRSVGTNDAY-HSVIAALKN-----GYRHIDTAAIYGNEAQVGKAIRDS 69
           SI  IG GT  +++  T + +   ++  +K      G  HID A +Y    +VGKA+R+S
Sbjct: 19  SIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYPEVGKALRES 78

Query: 70  G--VPRNEIFVTSKLWCAQ---THDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKD 124
               PR+EIF+T K +  Q   + +P + L   LK+LGLDY+DLYL+H P          
Sbjct: 79  HNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSPF--------- 128

Query: 125 EDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDL 184
                     I  + NG        +   + W+ M+ L ++GK K +GVSNFS+ +L  +
Sbjct: 129 ----------ISKEKNG--------FTMEEAWKYMEDLYKAGKVKNIGVSNFSMADLQRI 170

Query: 185 LAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFGSINAPILKDET-- 239
           L +   K  P  NQIE +  L QN+   ++ +C+E +I V AY+P G +       E   
Sbjct: 171 LKSCEVK--PQVNQIEFNAFL-QNQTPGIVNFCRENDIQVVAYTPLGPLQRKSKNFEQEN 227

Query: 240 ----INAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVT--LPDEDFQA 293
               +  +A+K D    Q+++ W + + G + +  S  E+RI   + + T  L D + + 
Sbjct: 228 FHKFVKQLAEKYDKSEAQILLRW-VSKRGIIPVTTSSKEKRIKDAQYLFTFDLTDSEVEK 286

Query: 294 INNL 297
           I  L
Sbjct: 287 ITQL 290

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  115 bits (287), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 135/288 (46%), Gaps = 59/288 (20%)

Query: 6   VSENILKLSTGASIPQ---IGLGT-WRSVGTNDAYHS------VIAALK-NGYRHIDTAA 54
           + +    L+ G  IP    IG GT W     N +  S      V  AL   G  HID A 
Sbjct: 3   IKQEFFTLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAE 62

Query: 55  IYGNEAQVGKAIRDSGVPRNEIFVTSKLWCA--QTHDPKLALNQTLKRLGLDYIDLYLMH 112
           IY    ++GKA+R++  PRNEI++T K   +   + +P +     LK LG+DYIDLYL+H
Sbjct: 63  IYRTYPELGKALRETKKPRNEIWITDKYSTSLKLSDNPIVGFENGLKELGVDYIDLYLLH 122

Query: 113 WPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVG 172
            P                    I    NG        +   + W+ ++ L +SGK K +G
Sbjct: 123 SPF-------------------ITEGRNG--------FTLEQAWKYLEELYKSGKAKNIG 155

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFGS 229
           VSNF+  +L  +L  +  K  P  NQIE    L QN+   +  + KE +IL+EAYSP G 
Sbjct: 156 VSNFAKEDLERILKIAEIK--PQVNQIEYSAFL-QNQTPGIYNFAKENDILLEAYSPLGP 212

Query: 230 I--------NAPILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLP 269
           +        + P  K   IN +A+K      QV++ W  +RG   VLP
Sbjct: 213 LQRRPEEADSLPFYK--YINELAEKYGKSEAQVLLRWVSKRG---VLP 255

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  114 bits (286), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 81/272 (29%), Positives = 133/272 (48%), Gaps = 48/272 (17%)

Query: 9   NILKLSTGASIPQI---GLGT-WRSVGTNDAYH-SVIAALKN-----GYRHIDTAAIYGN 58
           +++ L+ G  IP I   G GT W      D Y  +++  ++N     G  HID A +Y  
Sbjct: 6   SLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQT 65

Query: 59  EAQVGKAIRDSGVPRNEIFVTSKLWCAQ--THDPKLALNQTLKRLGLDYIDLYLMHWPVT 116
            A+VG+A+R+S  PR+EIF+T K    +  + +PK  L   L+++GL+Y+DLYL+H+P+ 
Sbjct: 66  HAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFPI- 124

Query: 117 FNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNF 176
                                     +D ++  +   + W++M+ L   G  K +GVSNF
Sbjct: 125 --------------------------IDPKLYDFTLEEAWKMMEDLYNEGLAKNIGVSNF 158

Query: 177 SINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYS---PFGSI 230
            + +L  L  +   K  P  NQIE +  L QN+   +  YC + NI +EA+    P   +
Sbjct: 159 RVEDLEQLSKSWVIK--PQINQIEFNAYL-QNQTPGIYDYCIKNNIQLEAFCPLVPLREV 215

Query: 231 NAPILKDETINAIAKKLDIQVGQVVMSWHIQR 262
           N   L    +  +A+K      Q+++ W  QR
Sbjct: 216 NEKDLLPLYVKQLAQKYSKTENQIMLRWVSQR 247

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  114 bits (286), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 144/310 (46%), Gaps = 53/310 (17%)

Query: 15  TGASIPQIGLGT---WR----SVGTNDAYHSVIA-----ALKNGYRHIDTAAIYGNEAQV 62
           +G  +P IG G+   WR    S  T   Y   +A     A++ G+ HIDTA  Y    +V
Sbjct: 14  SGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYKTYKEV 73

Query: 63  GKAIRDSGVPRNEIFVTSKL--WC---AQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTF 117
           G  I ++ VPR  +++T K   W     +   P  +L  +LK + LDY+DLY++H P   
Sbjct: 74  GTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIHVP--- 130

Query: 118 NPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFS 177
                            I T + G +D++       + W  M+ +      + +GVSNF 
Sbjct: 131 ----------------NITTKTAG-IDLK-------EAWLQMEEIYTRKMARNIGVSNFD 166

Query: 178 INNLNDLLAASTTKVVPAANQIELHPLLAQNE--LLQYCKEKNILVEAYSPFGSIN--AP 233
           + +L  +   S  K  P  NQIE    + Q    +L+YC+E NI+VE YSP   +    P
Sbjct: 167 VESLEYI--KSFAKYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKGKP 224

Query: 234 ILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV--VTLPDEDF 291
              DE +  IA K      QV++ W + + G VV+  +  +ER+  +  +    L  EDF
Sbjct: 225 GPLDEILPGIAAKYGKSQLQVLLRW-VTQNGIVVITTTGKKERLNESLNIFDFELSKEDF 283

Query: 292 QAINNLVKEK 301
             I N+ +EK
Sbjct: 284 DQITNVGREK 293

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  112 bits (281), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 88/284 (30%), Positives = 137/284 (48%), Gaps = 53/284 (18%)

Query: 46  GYRHIDTAAIYGNEAQVGKAIRDSGVPRNEIFVTSKL--WCAQTHDPKLALNQTLKRLGL 103
           G  H+D A  Y    ++ KA+++S  PRNEIF+T K       T +P  ALN  L  LGL
Sbjct: 53  GIVHVDAAEYYRTYPELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGL 112

Query: 104 DYIDLYLMHWPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLP 163
           DY+DLY++H+P  F+P                        D+ ++T      W  M+ L 
Sbjct: 113 DYVDLYVLHFP-EFDPEY---------------------KDLSIET-----AW--MELLY 143

Query: 164 ESGKTKAVGVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNIL 220
           + GK K +GVSNFSI +L  ++  +  K  P  NQIE +  L QN+   +++YC++    
Sbjct: 144 KEGKAKNIGVSNFSIEHLERVMKIADVK--PQVNQIEFNAFL-QNQTPGIVKYCQQNGFQ 200

Query: 221 VEAYSPFGSINA--------PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSV 272
           +EAYSP   +          P  K   I+ ++ K      ++++ W  +RG   +   S 
Sbjct: 201 LEAYSPLAPLQRKPKNFNELPFYK--YIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSR 258

Query: 273 HEERIIANRKVVT--LPDEDFQAINNLVKEKGELRVVDPDWSPF 314
           H ERI+  + + +  L DE+   I  L  E+  LR+    W+ F
Sbjct: 259 H-ERIVNAQNLFSFDLTDEEVDKITKLGLEQPALRLY---WNEF 298

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  110 bits (276), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 140/287 (48%), Gaps = 61/287 (21%)

Query: 8   ENILKLSTGASIPQ---IGLGT-WRSVGTNDA--YHSVIAALKN-----GYRHIDTAAIY 56
           +    L+ G  IP    IG GT W      DA   H+++  ++      G  H+D A +Y
Sbjct: 5   QEFFTLNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVY 64

Query: 57  GNEAQVGKAIRDSGVPRNEIFVTSKLWCAQ--THDPKLALNQTLKRLGLDYIDLYLMHWP 114
               +  +A++++  PRNEIFVT K    +  T+DP+  L+  LKR GL+Y+DLYL+H  
Sbjct: 65  RTYPEFSEALKNTKKPRNEIFVTDKYSVQEKITNDPREGLDTGLKRTGLEYVDLYLLH-- 122

Query: 115 VTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVS 174
              +P + K+++G                      +   + W  ++ L   GK K +GVS
Sbjct: 123 ---SPFASKEKNG----------------------FTIEEAWAQLEELYHEGKAKNIGVS 157

Query: 175 NFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPFGSIN 231
           NF + +L  +L  +  KV P  NQIE    L QN+   ++++ ++ +I +EAY+P G ++
Sbjct: 158 NFRVEDLEKILKVA--KVKPQVNQIEFSAFL-QNQTPGVVKFSQDHDIQLEAYAPLGPLS 214

Query: 232 APILKDET---------INAIAKKLDIQVGQVVMSWHIQRGGYVVLP 269
               +DE+         I  + +K      Q+++ W  +RG   +LP
Sbjct: 215 K---RDESEQAKPFYDYIKKLTEKYSKTEAQILLRWVSKRG---ILP 255

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  108 bits (269), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 86/311 (27%), Positives = 140/311 (45%), Gaps = 53/311 (17%)

Query: 14  STGASIPQIGLGT---WRSVGT----NDAYHSVIA-----ALKNGYRHIDTAAIYGNEAQ 61
            +G  +P IG G+   WR         D +   +A     A+K G+ HID A  Y    +
Sbjct: 12  GSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPE 71

Query: 62  VGKAIRDSGVPRNEIFVTSKL--WC---AQTHDPKLALNQTLKRLGLDYIDLYLMHWPVT 116
           VG  I +SGVPR +++VT K   W     +   P  +L  +L ++ + Y+DLYL+H P  
Sbjct: 72  VGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVHVPF- 130

Query: 117 FNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNF 176
            NP +                     +D++       + W  M+ + + G  K +GVSNF
Sbjct: 131 INPET-------------------AGIDLK-------EAWRQMEEIYDRGWAKNIGVSNF 164

Query: 177 SINNLNDLLAASTTKVVPAANQIELHPLLAQNE--LLQYCKEKNILVEAYSPFGSI--NA 232
            + +L  +   +  K  P  NQIE    + Q    ++ YCK+  I +E YSP   +    
Sbjct: 165 DVESLEYI--RTIGKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGK 222

Query: 233 PILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKV--VTLPDED 290
           P   D+ +  +AKK      Q+++ W +Q  G + +  S  ++RI  +  +    L  ED
Sbjct: 223 PGPLDDILPLMAKKYGKSELQILLRWVVQN-GVIAITTSAQQKRIDESLDIFDFELSSED 281

Query: 291 FQAINNLVKEK 301
           F +I  + K K
Sbjct: 282 FTSITEVGKTK 292

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  108 bits (269), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 86/278 (30%), Positives = 140/278 (50%), Gaps = 54/278 (19%)

Query: 46  GYRHIDTAAIYGNEAQVGKAIRDSGVPRNEIFVTSKLW-CAQTHDPKLA-LNQTLKRLGL 103
           G  H+D A  Y    ++G+A+R+S  PR+EIF+T K     + H   L      +K++G+
Sbjct: 73  GIVHLDAAECYNTYQELGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGV 132

Query: 104 DYIDLYLMHWPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLP 163
           DY+DLYL+H P+                   I  + NG V +E       + W+ ++ L 
Sbjct: 133 DYVDLYLIHSPL-------------------IEKEKNG-VTLE-------EVWKDLEKLY 165

Query: 164 ESGKTKAVGVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNIL 220
           E+GK K +GVSNF + +L  +L  +  KV P  NQIE H  L QN+   ++++ ++ NI 
Sbjct: 166 EAGKAKNIGVSNFRVEDLQRILKVA--KVKPQVNQIEFHVFL-QNQTPGIVKFSQDNNIQ 222

Query: 221 VEAYSPFGSINAPILKDET--------INAIAKKLDIQVGQVVMSWHIQRGGYVVLP--K 270
           +EAY+P G    P+ + ++        +  +AKK      QV++ W  +R    VLP   
Sbjct: 223 LEAYTPLG----PLQRKQSDAGDFYNYVEELAKKYGKTEAQVLLRWVTRRH---VLPITT 275

Query: 271 SVHEERIIANRKVVT--LPDEDFQAINNLVKEKGELRV 306
           S   +RI A + + +  L DE+ + I  L  +   LR+
Sbjct: 276 SSKPQRIQAAQDLFSFDLTDEEVKKITELGLKHKPLRL 313

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  103 bits (257), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 92/301 (30%), Positives = 143/301 (47%), Gaps = 68/301 (22%)

Query: 7   SENILKLSTGASIPQI---GLGT-WRSV-GTNDAYHSVIAALKN-----GYRHIDTAAIY 56
           ++    L+ G SIP I   G+G  W  + G  D   +++  LK      G+ HI TA  Y
Sbjct: 5   TKRFFTLNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFY 64

Query: 57  GNEAQVGKAIRDSGVPRNEIFVTSKLWCAQ---THDPKLALNQTLKRLGLDYIDLYLMHW 113
            N   +  A++ S  PR+EI++T K +C+Q   +  P  AL ++L RLG DY+DLYL+H 
Sbjct: 65  PNNGLLSAALKASQKPRHEIWITDK-YCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHN 123

Query: 114 PVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGV 173
           P                    + +  NG + +E       K W+ M+ L ++GK K +GV
Sbjct: 124 PC-------------------LDSSPNG-ISLE-------KAWKQMELLYKTGKVKNIGV 156

Query: 174 SNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE---LLQYCKEKNILVEAYSPF--- 227
           SNF I +L  L  A   ++ P  N+IE H  L QN+   + +Y K  ++L+  YSP    
Sbjct: 157 SNFRIEDLERLKDA---EIKPQVNEIEFHAFL-QNQTPNIYEYAKTHDLLLCGYSPLFPL 212

Query: 228 -----GSINAPILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRK 282
                  ++ P  +   I  +A+K +    Q+++ W    G   VLP       +I N K
Sbjct: 213 ETKTEDFMDFPFYR--YIIGLAEKYNKTEAQILLHWMNCLG---VLP-------VITNTK 260

Query: 283 V 283
           V
Sbjct: 261 V 261

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W -
           Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 53/95 (55%), Gaps = 7/95 (7%)

Query: 8   ENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIR 67
           E   KL+ G  IP IG G +  +   D    V +ALK+GYRHIDTA +Y N+ +  + +R
Sbjct: 10  ETRYKLNNGQQIPVIGFGVY-EIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGVR 68

Query: 68  ----DSGVPRNEIFVTSKLWCAQ--THDPKLALNQ 96
               ++G  R  I+ T+KLW +Q    + K AL +
Sbjct: 69  KYLDETGEARENIWFTTKLWDSQFGREETKKALQE 103

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 77/183 (42%), Gaps = 37/183 (20%)

Query: 50  IDTAA--IYGNE-AQVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLAL--NQTLKRLGLD 104
           ID AA  IY     +VG+A+  +  P+ EIF+T K          LA+  +  LK++ ++
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKISVE 66

Query: 105 YIDLYLMHWPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPE 164
           Y+D++ +H P  F   ++ +     DA  T                          HL  
Sbjct: 67  YVDMHFLHSPFVFKQANVLN---LKDAMHT-------------------------DHLRR 98

Query: 165 SGKTKAVGVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNE--LLQYCKEKNILVE 222
           S K    G S+ ++  L  +L   T    P  NQI+L   L      + + C+E +IL+ 
Sbjct: 99  SNKANNRGASSVNVEELRRVL--KTEDEEPQVNQIKLRSSLRNQTPGISKLCQENDILMA 156

Query: 223 AYS 225
            YS
Sbjct: 157 VYS 159

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 101/245 (41%), Gaps = 45/245 (18%)

Query: 25  GTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSGVP-RNEIFVTSKLW 83
           G   S+ +N   + ++  LK G + IDTA IY +     KAI +  +P R  I   +  +
Sbjct: 7   GYTFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNE---KAIGELQLPDRFTIHTKASGF 63

Query: 84  ---CAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDAFMTIPTDSN 140
              C    +   ++ ++L  LG+  ++ +L+H P   +P               IP +  
Sbjct: 64  SGGCLTRDNINKSIEESLSLLGVPSVETFLLHSP---DPE--------------IPLE-- 104

Query: 141 GNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDL--LAASTTKVVPAANQ 198
                        +T + +  L E GK +  G+SNFS  ++  +   A S   V+P   Q
Sbjct: 105 -------------ETLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQ 151

Query: 199 IELHPLLAQ--NELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLD--IQVGQV 254
              + L     N+L    KE +I + AYSP          +E +   + + D    +GQ+
Sbjct: 152 GNYNALSRAIVNDLFPLLKELHISLYAYSPIARGFLAETPEEILGEKSGRFDNSTMIGQM 211

Query: 255 VMSWH 259
            +  +
Sbjct: 212 YLKLY 216

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 78/186 (41%), Gaps = 56/186 (30%)

Query: 42  ALKNGYRHIDTAAIYG-NEAQVGKAIRD--SGVPRNEIFVTSKL-------WCAQTHDPK 91
           A+  G   IDT+  YG +E   GKA+++     PR E F+ +K+       +     + +
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 92  LALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWN 151
            ++ ++ +RL  DY+DL  +H                               D+E   ++
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH-------------------------------DIEYVEYD 138

Query: 152 FIKTWELMQH---LPESGKTKAVGVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQN 208
             K WE ++    L + G  + +G+S + ++ L  L  + T   VP     E+ PL A  
Sbjct: 139 --KIWEALRELRKLKDEGVIRHIGISGYPVDLL--LYVSKTCCGVP-----EIGPLDA-- 187

Query: 209 ELLQYC 214
            +L YC
Sbjct: 188 -VLSYC 192

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 42  ALKNGYRHIDTAAIYGN-EAQVGKAIRDSG--VPRNEIFVTSKL-------WCAQTHDPK 91
           A +NG   IDT+  YGN E  +GKA+ + G   PR+   + +K+       +     + +
Sbjct: 33  AFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNVR 92

Query: 92  LALNQTLKRLGLDYIDLYLMH 112
            ++ ++ KRL  DY+DL  +H
Sbjct: 93  RSVVRSCKRLNSDYLDLVYLH 113

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/229 (19%), Positives = 92/229 (40%), Gaps = 59/229 (25%)

Query: 44  KNGYRHIDTAAIYGN-EAQVGKAIRDSGVPRNEIFVTSKL-------WCAQTHDPKLALN 95
           +  +  +DT+  YG+ E  VG+A+R+  +PR EI+V +K+       +     + ++++ 
Sbjct: 38  RRCFNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVGRVGVSEFDYSRENVRMSVM 97

Query: 96  QTLKRLGLD--YIDLYLMHWPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFI 153
           ++++RL  +  Y+D+  +H  V F P+                                +
Sbjct: 98  RSVERLVGEGGYLDVVYLH-DVEFQPQEA-----------------------------CL 127

Query: 154 KTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQY 213
              + +Q L  +G  + VGVS + ++ L  L++       P             + +L Y
Sbjct: 128 AALDELQKLKRAGIVRNVGVSGYPLSKLYSLVSLCYDAGTPL------------DCVLSY 175

Query: 214 CK---EKNILVEAYSPFGSINAPILKDETINAIAKKLDIQVGQVVMSWH 259
           C    +  +L E Y+ F S          +NA    + +   Q  + +H
Sbjct: 176 CHMNLQNVMLEEYYAKFKSKGV----QHVVNASVLSMSLLRSQKTLEFH 220

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 69/358 (19%), Positives = 130/358 (36%), Gaps = 78/358 (21%)

Query: 14  STGASIPQIGLGT----------WRSVGTNDAYHSVIAALKNGYRHIDTAAIYGN---EA 60
           +TG  I     GT          W      DAY  +  A   G R  DTA  Y N   E 
Sbjct: 11  NTGLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSET 70

Query: 61  QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR 120
            +G  ++   +PR  + + +K++     D  + LN T         DL L       N R
Sbjct: 71  ILGSFLKHYNIPRETVVIMTKVFYRV--DDTIELNPT---------DL-LFGNNEELNLR 118

Query: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWN---------FIKTWELMQHLPESGKTKAV 171
            +  +  S    +    +S   +   +D +          F +T   +  + E G  + +
Sbjct: 119 LVNQKGLSRKHILEAAKNSVRRLGTYIDVYQIHRCDHETPFEETMRALNDVVEQGYARYI 178

Query: 172 GVSNFSINNLNDLLAASTT----KVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPF 227
           G S+       +    +      K V       L     + E+L +CK+ N+ +  +SP 
Sbjct: 179 GASSMLGTEFAEYQFIAEKHGWHKFVNMQTCYNLLYREDEREMLPFCKKNNVAITPWSPL 238

Query: 228 --GSINAPILKD--------------------------ETINAIAKKLDIQVGQVVMSWH 259
             G +  PI +                           + +N +A K ++++  V ++W 
Sbjct: 239 QMGFLARPITEKSVRQTTDLVIKAMSLDKFSEADKEIIDRVNKLANKKNLKMATVTLAWL 298

Query: 260 IQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPDWSPFPLF 317
            ++  + ++  +  E RI          D+  +A+   + E+ E++ ++  + P PLF
Sbjct: 299 FKKNAFPIVGLN-KESRI----------DDALEALKVELTEE-EVKYLEEPYKPKPLF 344

>TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.604
           YMR041C
          Length = 340

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 92/216 (42%), Gaps = 43/216 (19%)

Query: 42  ALKNGYRHIDTAAIYGN-EAQVGKAIRDSGV--PRNEIFVTSKLWCAQTHDPKLALN--- 95
           A +NG   IDT+  YG+ E   GKA++   +  PR+  F+ +K+    +++   + N   
Sbjct: 50  AFRNGITAIDTSPYYGDSEIIYGKALKSIKIEFPRDTYFICTKVGRIGSNEFDYSANNVR 109

Query: 96  ----QTLKRLGLDYIDLYLMHWPVTFNP-----------RSIKDE------DGSG----- 129
               ++ KRL  +Y+D+  +H  V F P           + +KDE        SG     
Sbjct: 110 KSILRSCKRLNTNYLDVVYLH-DVEFTPLEDSIEALTELKKLKDEGIIKNFGLSGYPLDY 168

Query: 130 -----DAFMTIPTDSNGNVDVEMDTWNF-IKTWELMQHLPESGKTKAVGVSNFSINNLND 183
                D      +DS G++D+ +   N  ++   L+Q      K     + N SI +++ 
Sbjct: 169 ITKLLDYVHDTCSDSIGDLDLILSYCNMNLQNTRLLQFEDALRKNNIKTICNASILSMSL 228

Query: 184 LLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNI 219
           L +  T    P + +++   + +     +YC  K +
Sbjct: 229 LNSFETKPFHPCSEELKQCSIQSA----KYCASKQV 260

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 17/96 (17%)

Query: 39  VIAALKNGYRH----IDTAAIYG-NEAQVGKA---IRDSGVPRNEIFVTSKLWCAQTHD- 89
           ++  LK+G+ H    IDT+  YG +E   G+A   IRD   PRN  ++ +K+   Q  + 
Sbjct: 42  LVDMLKHGFNHGIRAIDTSPYYGPSEILYGQALEHIRDE-FPRNSYYICTKVGRIQLDEF 100

Query: 90  ------PKLALNQTLKRLGLDYIDLYLMHWPVTFNP 119
                  + ++ ++ +RL  DY+DL  +H  V F P
Sbjct: 101 DYSREHVRFSVLRSCQRLKTDYLDLVYLH-DVEFVP 135

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 36.2 bits (82), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 109/262 (41%), Gaps = 54/262 (20%)

Query: 45  NGYRHIDTAAIYGN---EAQVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRL 101
           NG R  DTA +Y N   E  +G+ ++   + R  + + SK++     D  L L+Q  K +
Sbjct: 52  NGLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSKIFFPV--DESLDLHQGSK-V 108

Query: 102 GLDYIDLYLMHWPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDV----EMDTWNFIKTWE 157
             +YIDL L  +    N + I    G  ++   + T     +D+     +D    ++  E
Sbjct: 109 DQEYIDLQL-SFQQGLNRKHIM--AGVANSVERLGT----YIDILQIHRLDKEASME--E 159

Query: 158 LMQHLPE---SGKTKAVGVSNFSINNLNDL-LAASTTKVVPAANQIELHPLL---AQNEL 210
           +M+ L +   SG+ + +G S+       +L   A         N    + +L    +NEL
Sbjct: 160 IMRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSYYNVLNREDENEL 219

Query: 211 LQYCKEKNILVEAYSP--FGSINAP-------ILKDET-------------------INA 242
           + +CK+  + +  +SP   G +  P       +L D T                   + A
Sbjct: 220 IPFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLDESDKEIIGVVEA 279

Query: 243 IAKKLDIQVGQVVMSWHIQRGG 264
           IAKK  I +  V M+W + +G 
Sbjct: 280 IAKKKGISMAMVSMAWILNKGA 301

>Suva_13.210 Chr13 complement(341369..342400) [1032 bp, 344 aa] {ON}
           YMR041C (REAL)
          Length = 344

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 42  ALKNGYRHIDTAAIYG-NEAQVGKAIRD--SGVPRNEIFVTSKLWCAQTHD-------PK 91
           A  +G   IDT+  YG +E   GKA+ +     PRN  F+ +K+      D        +
Sbjct: 57  AFTHGINAIDTSPYYGPSEILYGKALNNLKDDFPRNTYFICTKVGRIAEDDFDYSREFVR 116

Query: 92  LALNQTLKRLGLDYIDLYLMH 112
            +++++ KRL   Y+DL  +H
Sbjct: 117 FSVHRSCKRLNTTYLDLVYLH 137

>Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C -
           Hypothetical ORF [contig 59] FULL
          Length = 338

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 42  ALKNGYRHIDTAAIYGN-EAQVGKAIRD--SGVPRNEIFVTSKL-------WCAQTHDPK 91
           A+++G R IDT+  YG+ E   GKA+      +PR   F+ +K+       +       +
Sbjct: 52  AVQHGIRAIDTSPYYGDSEKLFGKALESLKDEIPRENYFICTKVGRIRLDEFDYSREHVR 111

Query: 92  LALNQTLKRLGLDYIDLYLMH 112
            ++ ++ +RL  DY+D+  +H
Sbjct: 112 SSVLRSCERLRTDYLDVVFLH 132

>NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 98/236 (41%), Gaps = 44/236 (18%)

Query: 46  GYRHIDTAAIYGN---EAQVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLG 102
           G+R  DTA +Y N   E  +G+ +R   + R  + + +K +          +++TL    
Sbjct: 54  GFRTFDTADVYSNGKSERLLGEFLRKFEIRRETVVILTKTY--------FRVDETL---- 101

Query: 103 LDYIDLYLMHWPVTFNP-RSIKDEDG-SGDAFMTIPTDSNGNVDVEMDTWNFIK------ 154
               DL L  +P + N    + ++ G S    +    +S G +   +D     +      
Sbjct: 102 ----DLPLGEFPHSENDVLDLVNQQGLSRKHILDSVKNSVGRLGTYIDVLQIHRFDPTTP 157

Query: 155 ---TWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT----KVVPAANQIELHPLLAQ 207
              T + +  + E+G  + +G S+       ++ A +      + V   +Q  L     +
Sbjct: 158 IKETMKALNDVVENGDVRYIGASSMLPTEFVEMQAIADKYDWFQFVNVQSQYNLLYREDE 217

Query: 208 NELLQYCKEKNILVEAYSP--FGSINAPILKDETINAIAKKLDIQVGQVVMSWHIQ 261
            +L++YCK+ NI +  +SP   G +  P+  + T +   K +D        +WH++
Sbjct: 218 RDLMKYCKKHNIALTPWSPNYQGLLTRPVGVESTRSKTDKVID--------AWHLK 265

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 46/111 (41%), Gaps = 32/111 (28%)

Query: 33  NDAYHSVIAALKNGYRHIDTAAIYGN---EAQVGKAIRDSGVPRNEIFVTSKLWC----- 84
           N+ +  +  A  +G R  DTA  Y N   E  +G+ +++  +PR  + + +K+W      
Sbjct: 40  NEVFKILKTAYDSGLRTFDTADGYSNGQSEILLGEFLKEYEIPRETVIIMTKVWAPVDSS 99

Query: 85  --------AQTHDPKL---------------ALNQTLKRLGLDYIDLYLMH 112
                       D K+               A   +++RLG  YID+Y +H
Sbjct: 100 LEGFQRTGPMNEDQKVHFANQQGLSRKHIIEACKNSVRRLG-TYIDVYQIH 149

>Kpol_2000.109 s2000 complement(243219..244247) [1029 bp, 342 aa]
           {ON} complement(243219..244247) [1029 nt, 343 aa]
          Length = 342

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 92/231 (39%), Gaps = 28/231 (12%)

Query: 21  QIGLGTWRSVGTNDAYHSVIAALKNGY----RHIDTAAIYGN---EAQVGKAIRDSGVPR 73
           Q G   W S    D    +   LK+ Y    R  DTA +Y N   E  +G+ ++   +PR
Sbjct: 25  QYGSKEW-SEWVEDDKTKIFGILKHCYDRGMRTFDTANVYSNGLSETLLGEFLKHYNIPR 83

Query: 74  NEIFVTSKLWCAQTHDPKLALNQTLK----RLGLDYIDLYLMHWPVTFNPRSIKDEDGSG 129
             + + SKL  A   D K++  +TLK     L L ++++  +         S K+     
Sbjct: 84  ETVVIMSKLNFAT--DDKVSF-ETLKERSEELNLHFVNMSGLSRKNIMA--SAKESVRRL 138

Query: 130 DAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDL-LAAS 188
             ++ +      + D   +     +T   +  L ESG T+ +G S+       ++   A 
Sbjct: 139 GTYIDVLQIHRADRDTPYE-----ETMRALNDLVESGITRYIGASSMLATEFAEMQFTAE 193

Query: 189 TTKVVPAANQIELHPLLA---QNELLQYCKEKNILVEAYSPF--GSINAPI 234
                   N    + LL    + EL+ + K  NI +  +SP   G +  P+
Sbjct: 194 KYGWFKFINSQSCYNLLYREDERELMPFAKRHNIALTPWSPLQRGLLTRPV 244

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 64/163 (39%), Gaps = 48/163 (29%)

Query: 15  TGASIPQIGLGTWRSVGTNDAY-------HSVIAALKNGY----RHIDTAAIYGN---EA 60
           TG  +  I +G   S GT + +         +   LK+ Y    R  DTA +Y N   E 
Sbjct: 12  TGLKVSPIIIGCM-SYGTKNFFDWVLDDKEEIFGILKHAYDRGLRTYDTADVYSNGMSET 70

Query: 61  QVGKAIRDSGVPRNEIFVTSKLWC------------AQTHDPKL---------------A 93
            +G+ +R   +PR  + + +K++              +T +  L               A
Sbjct: 71  ILGEFLRTYNIPRETVVIMTKVFFPVDDKMDISSNRTKTEEENLQLINQQHLSRKHILNA 130

Query: 94  LNQTLKRLGLDYIDLYLMHW-----PVTFNPRSIKDEDGSGDA 131
           +  ++KRLG  YID+Y +H      P     R++ D    GD 
Sbjct: 131 VKNSVKRLG-TYIDVYQIHRCDHETPFEETMRALNDVVEQGDV 172

>ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No
           homolog in Saccharomyces cerevisiae
          Length = 185

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 9/58 (15%)

Query: 257 SWHIQRGGYVVLPKSV-------HEERIIANRKVVTLPDEDFQAI--NNLVKEKGELR 305
           SWH  RG   V  K+        HE+ I   RK +T+PD  F+      L KE    R
Sbjct: 46  SWHAHRGCVFVKAKASAGMLPLSHEQAIAMERKAITIPDVRFEQTFRAALAKESARQR 103

>TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.429
           YDR364C
          Length = 441

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 63/148 (42%), Gaps = 10/148 (6%)

Query: 113 WPVTFNPRSIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVG 172
           W    + R I+D  G   A  ++  ++NG V         +K W+      E+GK KA  
Sbjct: 176 WDFYHDRRCIRDYKGHKKAVRSVDFNNNGTVFFSSSYDQTVKIWDT-----ETGKVKAKV 230

Query: 173 VSNFSINNLNDLLAASTTKVVPAANQIELH---PLLAQNELLQYC--KEKNILVEAYSPF 227
             N   N++     + +  +V  +N    H    + ++N L+Q     + +IL   Y P 
Sbjct: 231 KCNSIPNDVKPRPLSDSEYIVGLSNSKINHYDQRVSSKNGLVQTYDHHQGSILCLKYFPD 290

Query: 228 GSINAPILKDETINAIAKKLDIQVGQVV 255
           GS      +D+T+     K++I + Q+ 
Sbjct: 291 GSKFISSSEDKTVRIWENKINIPIKQIA 318

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 21/118 (17%)

Query: 16  GASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNE---AQVGKAIRDSGVP 72
           G SI     G   ++    A+  + A  + G   IDTA  Y NE   A +G+ +    + 
Sbjct: 36  GMSIGDAWSGYMGTMDKERAFKLLDAFYEAGGNFIDTANTYQNEQSEAWIGEWMESRKL- 94

Query: 73  RNEIFVTSKL----------------WCAQT-HDPKLALNQTLKRLGLDYIDLYLMHW 113
           R++I + +K                 +C  + H   +++  +L++L  D+ID+  +HW
Sbjct: 95  RDQIVIATKFSTDYKWYDVGKNRSANFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 53/277 (19%), Positives = 105/277 (37%), Gaps = 42/277 (15%)

Query: 27  WRSVGTNDAYHSVIAALKNGYRHIDTAAIYGN---EAQVGKAIRDSGVPRNEIFVTSKLW 83
           W      +A+  +  A   G R  DTA +Y N   E  +G+ +R   +PR  + + +KL 
Sbjct: 34  WVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEIILGEFLRKYNIPRETVVIMTKLR 93

Query: 84  CAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGDAFMTIPTDSNGNV 143
                +  +        + L+ +++  +     F+  S +        ++ I     G+ 
Sbjct: 94  FPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFS--SSRASVKRLGTYIDILQIHRGDP 151

Query: 144 DVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT----KVVPAANQI 199
           D       F +T   +  +   G T+ VG S        ++   +      K V + +  
Sbjct: 152 DTP-----FEETMGALNDVVIEGLTRYVGASLMLATEFAEMQFVAEKHGWFKFVNSQSCY 206

Query: 200 ELHPLLAQNELLQYCKEKNILVEAYSPF--GSINAPI-----------------LKDET- 239
            L     + EL+ + K  NI +  +SP   G +  P+                 LK+ T 
Sbjct: 207 HLMYREDERELIPFAKRHNIALTPFSPLNRGLLCRPLGTETTRSNSDSVIKTKNLKNYTD 266

Query: 240 -----INAIAK---KLDIQVGQVVMSWHIQRGGYVVL 268
                IN + K   K +I +  + ++W +Q+G + ++
Sbjct: 267 WEASIINRVEKLSIKKNIPMSAISLAWVLQKGCFPIV 303

>YBL037W Chr2 (147209..150286) [3078 bp, 1025 aa] {ON}
            APL3Alpha-adaptin, large subunit of the clathrin
            associated protein complex (AP-2); involved in vesicle
            mediated transport
          Length = 1025

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 59/144 (40%), Gaps = 14/144 (9%)

Query: 7    SENILKLSTGASIPQIGLGT-WRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKA 65
            S N + L T      IG+ T   S   N + H  +A   + ++ +  A   G E +  K 
Sbjct: 875  STNTINLKTA-----IGMTTTLISSDVNPSMHLNLAQFISRWKTLSDA--LGKEGEYQK- 926

Query: 66   IRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDE 125
               SG+  N+ F   K+      D  L L QT+KRLG D +D   +   +  +       
Sbjct: 927  ---SGIKLNKDF--RKVETISLEDGLLLLTQTVKRLGFDIVDQTSVRSTLFVSGIIHTKS 981

Query: 126  DGSGDAFMTIPTDSNGNVDVEMDT 149
            +G+    M I    NG V+V   T
Sbjct: 982  EGNFGCLMKIQYQVNGTVNVTCKT 1005

>Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 7/85 (8%)

Query: 234 ILKDETINAIAKKLDIQVGQV-VMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQ 292
           IL  +T+ ++A+KLD  VG++  + WH +    ++   S  E+ +I N + +   + D +
Sbjct: 201 ILNSQTLQSLAQKLDSHVGKIGAVQWHPESNNQII---SCAEDGLIKNFQYLN-EEGDLR 256

Query: 293 AINNLVKEKGELRVVDPDWSPFPLF 317
            + +LV    E RV D  + P   F
Sbjct: 257 LLGSLVGH--ERRVSDLKYHPSGKF 279

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 51/118 (43%), Gaps = 21/118 (17%)

Query: 16  GASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNE---AQVGKAIRDSGVP 72
           G SI     G   S+    A+  + A  + G   IDTA  Y NE   A +G+ +    + 
Sbjct: 36  GMSIGDAWSGFMGSMNKERAFELLDAFFEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL- 94

Query: 73  RNEIFVTSKL----------------WCA-QTHDPKLALNQTLKRLGLDYIDLYLMHW 113
           R++I + +K                 +C    H   +++  +L++L  D+ID+  +HW
Sbjct: 95  RDQIVIATKFTTDYKKYEVGKGRSANFCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 152

>Kwal_26.9129 s26 complement(1087291..1088907) [1617 bp, 538 aa]
           {ON} [contig 70] FULL
          Length = 538

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 5/61 (8%)

Query: 202 HPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDET----INAIAKKLDIQVGQVVMS 257
           H ++ ++E      EK  LV+ Y P      P    E     +NAI +++DI+ G+V+  
Sbjct: 140 HKIIDKHEF-HIINEKTGLVQIYQPITRDLTPYGASEEQQWIVNAIFQEIDIETGEVIFE 198

Query: 258 W 258
           W
Sbjct: 199 W 199

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 193 VPAANQIELHPLLAQNELLQYCKEKNILVEAYSPF----GSINAPILKDETINAIAKKLD 248
           +PA         LA  E +  C +K I + AYS      GS+ A ++ +   N +  + +
Sbjct: 774 IPAGGAYHYETALADKENVNSCIQKVIQLGAYSELLSAKGSLLAQMVNEPCFNTL--RTE 831

Query: 249 IQVGQVVMSWHIQRGGYVVLPKSVHEER 276
            Q+G VV S  +   G V L   V  ER
Sbjct: 832 EQLGYVVFSSKLNTHGTVNLRILVQSER 859

>SAKL0D11308g Chr4 (942247..945552) [3306 bp, 1101 aa] {ON}
           conserved hypothetical protein
          Length = 1101

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPES 165
           G+G +F  I T S G+V V    W  I T++++  LP S
Sbjct: 583 GTGGSFAFIITSSRGHVRVFDSNWEEICTFQVISRLPSS 621

>TDEL0A02150 Chr1 complement(384458..388207) [3750 bp, 1249 aa] {ON}
           Anc_2.440 YMR109W
          Length = 1249

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 40  IAALKNGYRHIDTAAIYGNEAQVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLK 99
           +A +K G R   TAA     AQ+ KA  DS   +NE+ V+         D   ++N+ LK
Sbjct: 1   MAIIKRGARSKATAAPAKRSAQIKKATYDSS-KKNEVGVSDLTLLTTISDQ--SINENLK 57

Query: 100 RLGLD-YIDLYLMHWPVTFNP 119
           +  L+  I  Y+ H  ++ NP
Sbjct: 58  KRFLNGSIYTYIGHVLISVNP 78

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 50/118 (42%), Gaps = 21/118 (17%)

Query: 16  GASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQ---VGKAIRDSGVP 72
           GASI     G   S+    A+  + A  + G   IDTA  Y NE     +G+ +    + 
Sbjct: 36  GASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMASRKL- 94

Query: 73  RNEIFVTSKL----------------WCA-QTHDPKLALNQTLKRLGLDYIDLYLMHW 113
           R++I + +K                 +C        +++  +L++L  D+ID+  +HW
Sbjct: 95  RDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>TPHA0I02270 Chr9 complement(505077..505781) [705 bp, 234 aa] {ON}
           Anc_7.146 YER002W
          Length = 234

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%)

Query: 58  NEAQVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGL 103
           N + +GKA R +   + +I + S    A+  D  L L Q  K+LGL
Sbjct: 10  NRSSIGKATRRTKDKKKQINIRSNAIIAENWDYSLTLAQNYKKLGL 55

>NCAS0B02060 Chr2 (338287..340074) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 172 GVSNFSINNLNDLLAASTTK-VVPA---ANQIELHPLLAQNELLQYCKEKNILVEAYSPF 227
           G +  S NN +D   ++  K ++P+    N  E+HP L++NE  Q  K+ +I V A  P 
Sbjct: 207 GYAKKSNNNNDDADFSNINKQIIPSDIGTNDNEVHPALSRNEEEQPLKQSSINVSASLPL 266

Query: 228 GSINAP 233
             I +P
Sbjct: 267 PEIESP 272

>KNAG0L02380 Chr12 (420356..425737) [5382 bp, 1793 aa] {ON} 
          Length = 1793

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 132 FMTIPTDSNGNVDVEMDTWNFIKTWELMQH--LPESGKTKAVGVSNFSINNLNDLLAAST 189
           F     D+N N+D  +   N  +T+E  +    P +G+   +G  N ++N L +  ++  
Sbjct: 715 FQRSSEDTNNNIDKSVTGMNKSRTFETSKQDEGPSNGEKHKIGFHNVTVNKLKEPNSSKK 774

Query: 190 TKVVPA 195
              +PA
Sbjct: 775 RASIPA 780

>TDEL0C03350 Chr3 complement(594741..595748) [1008 bp, 335 aa] {ON}
           Anc_7.472 YJR100C
          Length = 335

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 8/83 (9%)

Query: 213 YCKEKNIL---VEAYSPFGSINAPILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLP 269
           Y K+ + L   V + SPFG++  P   D++     +   I VG+ + +WH+ R  Y +  
Sbjct: 164 YVKQSSTLEKEVHSSSPFGNVPQPQYIDDS-----QGEGILVGESIQNWHLWRRRYELFQ 218

Query: 270 KSVHEERIIANRKVVTLPDEDFQ 292
           + +  E   +    +  P   F+
Sbjct: 219 RDLGSEGSFSEYGQIDAPFLSFE 241

>Ecym_4478 Chr4 complement(971356..973290) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii ADR006W
          Length = 644

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

Query: 3   SPQVSENILKLSTG-ASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQ 61
           S  VS  ILK   G     Q+  GTW + GTN+     ++ L N   HI  +A    E  
Sbjct: 210 SEDVSTIILKSVNGDVQTWQVFAGTWLNFGTNETRKRYLSQLVNLDDHI--SACNDCENS 267

Query: 62  VGKAIRDSGVPRN 74
           V   + D  +P+N
Sbjct: 268 VSNELTDPCLPKN 280

>Skud_13.220 Chr13 (372489..373994) [1506 bp, 501 aa] {ON} YMR064W
           (REAL)
          Length = 501

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 53/108 (49%), Gaps = 5/108 (4%)

Query: 158 LMQHLPESGKTKAVGV--SNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCK 215
           ++ H+    +T + G+  S   +  L DLLAA   +  P   +  LHP++ + +LL +  
Sbjct: 219 ILHHILHKMETNSGGLPYSADLVTALRDLLAAINNRFFPKRCEDSLHPIIIE-QLLSFYI 277

Query: 216 EKNILVEAYSPFGS-INAPILKDET-INAIAKKLDIQVGQVVMSWHIQ 261
           E   L E+    G  IN  +L D + IN   K +D+   + + ++ ++
Sbjct: 278 EIGNLNESKKFLGHLINKGVLPDPSIINRYLKGVDVHFDENIKNFDLK 325

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,290,556
Number of extensions: 1566075
Number of successful extensions: 4749
Number of sequences better than 10.0: 159
Number of HSP's gapped: 4422
Number of HSP's successfully gapped: 171
Length of query: 318
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 209
Effective length of database: 40,982,805
Effective search space: 8565406245
Effective search space used: 8565406245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)