Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B056605.433ON1611617321e-100
CAGL0A02794g5.433ON2161654858e-62
NCAS0F033705.433ON2111614813e-61
KAFR0E039305.433ON2111624388e-55
Suva_2.5395.433ON2271754311e-53
YDR367W (KEI1)5.433ON2211694251e-52
Smik_4.6335.433ON2211704214e-52
KNAG0C049205.433ON2171654153e-51
Skud_4.6365.433ON2341784061e-49
TDEL0E019205.433ON2201673991e-48
Kpol_1062.305.433ON2141603781e-45
TPHA0E017705.433ON2171623702e-44
SAKL0G02508g5.433ON2281763572e-42
Kwal_55.214325.433ON2071753474e-41
TBLA0A065205.433ON2061603171e-36
TBLA0G020105.433ON2131452972e-33
ZYRO0F10010g5.433ON2081612858e-32
KLLA0E21099g5.433ON2241762842e-31
KLTH0F16082g5.433ON2061742613e-28
AER256C5.433ON2391682478e-26
Ecym_47625.433ON2211752442e-25
NCAS0A14100singletonON65146691.2
Kwal_33.15638singletonON53559645.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05660
         (161 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   286   e-100
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   191   8e-62
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   189   3e-61
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   173   8e-55
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   170   1e-53
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   168   1e-52
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   166   4e-52
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   164   3e-51
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   160   1e-49
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   158   1e-48
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   150   1e-45
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   147   2e-44
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   142   2e-42
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   138   4e-41
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   126   1e-36
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   119   2e-33
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   114   8e-32
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   114   2e-31
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   105   3e-28
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   100   8e-26
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...    99   2e-25
NCAS0A14100 Chr1 (2772160..2774115) [1956 bp, 651 aa] {ON}             31   1.2  
Kwal_33.15638 s33 complement(1203012..1204619) [1608 bp, 535 aa]...    29   5.3  

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  286 bits (732), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 142/161 (88%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGS 60
           MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQI                   AQWFQGS
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGS 60

Query: 61  EGESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELLS 120
           EGESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELLS
Sbjct: 61  EGESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELLS 120

Query: 121 NPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
           NPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS
Sbjct: 121 NPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  191 bits (485), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 95/165 (57%), Positives = 114/165 (69%), Gaps = 6/165 (3%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGS 60
           MQW++YLWS+F LI+F+QGL+ IHKP L+ FSQI                   AQWFQ S
Sbjct: 52  MQWISYLWSVFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQ-S 110

Query: 61  EGESAVQTSTGVQ-----KRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFV 115
             E   +TS  V      +R T LASQGA+  YEY VTML T +TL FR YFN ILASFV
Sbjct: 111 ANEEKHETSAPVGVSQNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFV 170

Query: 116 QELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160
           QELL +PK+M+DQDDVEQDLKNKS +KRWWIK++KFCY+LC+  L
Sbjct: 171 QELLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  189 bits (481), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 114/161 (70%), Gaps = 4/161 (2%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGS 60
           +QWV YLWSIF LIIFAQGLY+IHKPTLLTFSQI                   +QWFQ  
Sbjct: 55  VQWVFYLWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQ-- 112

Query: 61  EGESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELLS 120
                  T   +Q+R+ SL SQGAT  YEY +T+ IT +TLTFR YFNC+LA+FVQELL 
Sbjct: 113 --TEPTGTEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLH 170

Query: 121 NPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
           +PK+++DQDDVEQDLKNK + KRWWIKN+K+ Y++C  +L+
Sbjct: 171 HPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLLA 211

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  173 bits (438), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 87/162 (53%), Positives = 112/162 (69%), Gaps = 3/162 (1%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQ-G 59
           MQWV YLWS   L +FAQGL++IHKP +LTFSQI                     WF   
Sbjct: 52  MQWVFYLWSTVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVE 111

Query: 60  SEGESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELL 119
           S+ E+AV ++  + KR   ++SQGA+ GYEY +T+ IT  +L FRFYFN ILASFVQELL
Sbjct: 112 SQTEAAVGST--ITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELL 169

Query: 120 SNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
            +PK+M DQDD+EQDLKNKS+ KRWW+K +K CY+LCK++L+
Sbjct: 170 RHPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLLA 211

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  170 bits (431), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 89/175 (50%), Positives = 111/175 (63%), Gaps = 15/175 (8%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWF--Q 58
           MQWVAYLWS+F LI+FAQGLY IHKP LL FSQI                    QWF  +
Sbjct: 52  MQWVAYLWSVFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLE 111

Query: 59  GSEGESAVQTSTGVQ-------------KRDTSLASQGATAGYEYFVTMLITFITLTFRF 105
           G+    A  +ST  Q              R T  + QGA+  YEY +T+LIT ++L FRF
Sbjct: 112 GNASIVADASSTATQTINYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRF 171

Query: 106 YFNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160
           YFN ILASFVQELL +PK+++D+DDVEQDLKNK + KR W K++K CY+LCK++L
Sbjct: 172 YFNFILASFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  168 bits (425), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 86/169 (50%), Positives = 114/169 (67%), Gaps = 9/169 (5%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWF--- 57
           MQW+AYLWS+F LI+F+QGLY IHKP LL FSQI                    QWF   
Sbjct: 52  MQWIAYLWSVFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLE 111

Query: 58  --QGSEGESAVQT---STG-VQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCIL 111
                +G +A+Q+   STG + +R   ++ Q AT  YEY +T+LIT ++L FRFYFN IL
Sbjct: 112 DTANIDGNNALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFIL 171

Query: 112 ASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160
           ASFVQELL +PK+++D+DDVEQ+LKNK + KR W K++K CY+LCK++L
Sbjct: 172 ASFVQELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  166 bits (421), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 113/170 (66%), Gaps = 9/170 (5%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWF--Q 58
           MQWVAYLWS+F LIIF+QGLY IHKP LL FSQI                    QWF  +
Sbjct: 52  MQWVAYLWSVFTLIIFSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLE 111

Query: 59  GSEGESAVQTSTG-------VQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCIL 111
            + G  A Q++         +  R+T ++ Q AT  YEY +T+LIT ++L FRFYFN IL
Sbjct: 112 DTAGGVASQSNNSNLISTERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLIL 171

Query: 112 ASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
           ASFVQELL +PK+++D+DDVEQ+LKNK + KR + K++K CY+LCK++L+
Sbjct: 172 ASFVQELLHHPKYLVDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLLN 221

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  164 bits (415), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 109/165 (66%), Gaps = 5/165 (3%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWF-QG 59
           MQW +YLWS+F L+++AQGLYQIHKP LLTFSQI                     WF + 
Sbjct: 52  MQWASYLWSVFTLVVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEE 111

Query: 60  SEGESAVQTSTG----VQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFV 115
           S  ++A+ T+      + KR   + +QGAT  YEY  T++IT ++L FR YFN +LASFV
Sbjct: 112 SNTDAAMGTAASAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFV 171

Query: 116 QELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160
           QELL +P++++DQDD+EQDLKNK  ++RWW+ ++K  Y +C+ VL
Sbjct: 172 QELLRHPQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  160 bits (406), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 107/178 (60%), Gaps = 18/178 (10%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWF--- 57
           MQWVAYLWS+F LI+F+QGLY IHKP LL FSQI                    QWF   
Sbjct: 56  MQWVAYLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLE 115

Query: 58  --------QGSEGESAVQT-------STGVQKRDTSLASQGATAGYEYFVTMLITFITLT 102
                     S  ++A++T       +  +  R    + Q AT  YEY +T+ IT  +L 
Sbjct: 116 NPTDFGSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLI 175

Query: 103 FRFYFNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160
           FRFYFN IL SFVQELL +PK+++D+DDVEQDLKNK + KR W K++K CYRLCK++L
Sbjct: 176 FRFYFNLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  158 bits (399), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 83/167 (49%), Positives = 106/167 (63%), Gaps = 7/167 (4%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGS 60
           MQWV Y+WSIF LII  QGLYQIHKP +LTFS I                   AQW+   
Sbjct: 55  MQWVLYIWSIFTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYN-L 113

Query: 61  EGESAVQTSTGVQKRD------TSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASF 114
           EG S     T     D      + +A QGA+ G+EY VTM IT ++L  + YF  I+ASF
Sbjct: 114 EGNSNNVKDTKSSYSDAPVDYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASF 173

Query: 115 VQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
           VQELL +P++M+DQDDVEQDLK++S  KRWWIK++K CY++ KS+L+
Sbjct: 174 VQELLLHPRYMLDQDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLLA 220

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  150 bits (378), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 75/160 (46%), Positives = 103/160 (64%), Gaps = 7/160 (4%)

Query: 2   QWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGSE 61
           QWV+YLWS+F LII++QGL+Q+H P+LLT+SQI                   +QWF  +E
Sbjct: 62  QWVSYLWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWF--TE 119

Query: 62  GESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELLSN 121
             S +   +GV +       QGA+  YEY  T+LIT + L  R YFN ILA+F QEL  +
Sbjct: 120 TGSGMSDGSGVDEY-----GQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLH 174

Query: 122 PKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
           PK+M+D DDVEQDLKNK+ + +WWIK++K CY L + +L+
Sbjct: 175 PKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHILT 214

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  147 bits (370), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 77/162 (47%), Positives = 101/162 (62%), Gaps = 6/162 (3%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWF-QG 59
           +QWV+YLWS F L+I+AQGL+Q+H P LLT+ QI                   + WF + 
Sbjct: 61  IQWVSYLWSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEE 120

Query: 60  SEGESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELL 119
           S     + +ST V K +     QGA+   E+F TM +T I L  RFYFN ILASF Q+L 
Sbjct: 121 SNAGDNINSSTTVDKYN-----QGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLF 175

Query: 120 SNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
            +PK+MIDQDDVEQDLKNKS++ +WWIK++K CY   K  L+
Sbjct: 176 LHPKYMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFLA 217

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  142 bits (357), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 107/176 (60%), Gaps = 15/176 (8%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWF--- 57
           MQW  Y  S+  L+++  GL+QI KP  LT+S +                   AQWF   
Sbjct: 53  MQWCFYSLSVLTLLVYLSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIE 112

Query: 58  -----QGSEGESAVQTS-------TGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRF 105
                +G+ G S +Q++         + +R+ SLASQ A+ GYEY +TML T +TL  RF
Sbjct: 113 ENDDNKGAVGTSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRF 172

Query: 106 YFNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
           YFN ILA+FVQ++L +PK+++D+DDVEQDLKNKS+ +R  IK+EK+CY  C+  L+
Sbjct: 173 YFNFILAAFVQQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  138 bits (347), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 102/175 (58%), Gaps = 14/175 (8%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGS 60
           MQWV YL SI  +I+++ GL  I+KP++L++S I                    QWF   
Sbjct: 33  MQWVLYLTSIITVIVYSVGLSSIYKPSVLSYSLILLTFTTDTLVTCFFTLWFSGQWFSAK 92

Query: 61  EGE------SAVQTSTG--------VQKRDTSLASQGATAGYEYFVTMLITFITLTFRFY 106
             E      + +Q+S G        + KR  +L+SQ A+ G EYF T+L+T   L  RFY
Sbjct: 93  NSELTDPNSTTLQSSAGNNSPSGNLISKRGDTLSSQSASQGTEYFFTILVTIFALATRFY 152

Query: 107 FNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
           FN I+ +FVQ LL +PK+++DQDDVEQDLK++  ++RWWI+ E   Y++C+  L+
Sbjct: 153 FNFIIMAFVQRLLRHPKYVVDQDDVEQDLKHRGFLRRWWIRAETHSYKICRRYLA 207

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  126 bits (317), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 93/160 (58%), Gaps = 13/160 (8%)

Query: 2   QWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGSE 61
           QWV Y WSI CL I+AQGL ++H+PTL TFSQ+                    +WF    
Sbjct: 60  QWVLYTWSIVCLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWF---- 115

Query: 62  GESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELLSN 121
              A  T+T         A+QGA+  YEY V++L+T  +L  R YFN I+ SF+QEL   
Sbjct: 116 ---AANTTT------RPPAAQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFR 166

Query: 122 PKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
           P + +D D+VE +L++ S+++R W++N+ +CY L + +LS
Sbjct: 167 PAYTLDTDEVETELRHSSLLRRLWLQNQHYCYILSRRILS 206

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  119 bits (297), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 83/145 (57%), Gaps = 1/145 (0%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGS 60
           +QW+ Y+WSIF L+I+ QG++ I KP +  FSQI                     WF   
Sbjct: 57  VQWLTYIWSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSD 116

Query: 61  EGESAVQTSTGVQKRDTSLA-SQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELL 119
                 + S    ++D  L+  QGA++ YE F+ +++T  TL  R Y+N +LASF+ +L 
Sbjct: 117 HSNKQSENSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLF 176

Query: 120 SNPKFMIDQDDVEQDLKNKSMVKRW 144
            NPKF+IDQDDVE DLKNKS  K++
Sbjct: 177 INPKFIIDQDDVETDLKNKSFFKKF 201

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  114 bits (285), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 88/161 (54%), Gaps = 3/161 (1%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGS 60
           +QWV YLWSIF  +++AQGL+   KP+LL FSQI                    QW+   
Sbjct: 51  LQWVLYLWSIFSFVVYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWY--- 107

Query: 61  EGESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELLS 120
             E    T   +        +QGA+  +E+ +T+ IT  +L  R YFN +LASFVQ LL 
Sbjct: 108 TLEDNTPTQKSIAAAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQ 167

Query: 121 NPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
           +P++M+D  DVEQ+L+ + + KR W + +  C R  K +L+
Sbjct: 168 HPRYMVDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLLT 208

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  114 bits (284), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 96/176 (54%), Gaps = 20/176 (11%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGS 60
           +QW  Y+WSIFCL++F  G+ Q++KP +L  S +                   A WF   
Sbjct: 53  VQWTFYIWSIFCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFS-Q 111

Query: 61  EGESAVQ----------------TSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFR 104
           EG + V                 TST   K DTS   + A++GYE+F+ +L+T + L  R
Sbjct: 112 EGSTDVTDLKSAGTALGPAHEGTTSTISTKVDTS---KSASSGYEFFLIILLTLVPLAVR 168

Query: 105 FYFNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160
           FYFN I+ +F Q+LL + KF  DQ+D+E +L N++++ +W  K EK+C+ LCK  L
Sbjct: 169 FYFNFIIIAFQQQLLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  105 bits (261), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 99/174 (56%), Gaps = 13/174 (7%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGS 60
           MQWV YL S+F L++++ GL  ++KP L T++ +                     WF   
Sbjct: 33  MQWVLYLTSVFTLVVYSLGLTTVYKPKLQTYAFVLLTFTADTLITCFFTLWFSGMWFAAK 92

Query: 61  EGE-----SAVQTSTG--------VQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYF 107
           E E     SA Q ++G        +  R  +L+SQ A+   EYF T+L++ I L  RFYF
Sbjct: 93  ESELSDPSSATQQTSGGISSGSKLLTARGETLSSQSASQATEYFFTILVSLIALVSRFYF 152

Query: 108 NCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161
           N I+ +FVQ L  +PK+++DQDDV+QDLK+K + +RWWI+ E + YR+C   L+
Sbjct: 153 NFIILAFVQRLFRHPKYLVDQDDVDQDLKHKKLWQRWWIRAENWSYRVCHHYLA 206

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score = 99.8 bits (247), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 57/168 (33%), Positives = 83/168 (49%), Gaps = 8/168 (4%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWF-QG 59
           +QW+ YLWS   L+++  GL QI++P L  +  +                     WF  G
Sbjct: 72  LQWLFYLWSFVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDG 131

Query: 60  SEG-------ESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILA 112
             G       + A  T   V   +  ++ Q A+  YEY  TM  T   L+ RFY N ++A
Sbjct: 132 DVGVTATAKEDDADATQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIA 191

Query: 113 SFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160
           SFVQ +  + KF    DDVEQDLK+KS+  R + K +++CY LC+  L
Sbjct: 192 SFVQRMFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score = 98.6 bits (244), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 85/175 (48%), Gaps = 15/175 (8%)

Query: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQIXXXXXXXXXXXXXXXXXXXAQWFQGS 60
           +QW  Y+WS   L++F +GL Q++KP L+T+  +                     WF   
Sbjct: 47  IQWGFYVWSFAALLVFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKE 106

Query: 61  EGESAVQTSTG-------VQK--------RDTSLASQGATAGYEYFVTMLITFITLTFRF 105
           +  S     +G       V K        R T   +Q A+  YEY  T+L+T I    RF
Sbjct: 107 DTSSGSNPVSGKGIGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRF 166

Query: 106 YFNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160
           Y N I+ASFV+ ++   +++ + DDVE DLKN S+  R ++  +++CY  C+  L
Sbjct: 167 YSNFIIASFVRRMMKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>NCAS0A14100 Chr1 (2772160..2774115) [1956 bp, 651 aa] {ON} 
          Length = 651

 Score = 31.2 bits (69), Expect = 1.2,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 106 YFNCILASFVQELLSNPKF------MIDQDDVEQDLKNKSMVKRWW 145
           Y    L    +EL++NPKF      M   +D E+DL +  +V+++W
Sbjct: 156 YLPLDLVRVRKELMTNPKFEFLRKQMHANNDAEKDLSDLEIVQKYW 201

>Kwal_33.15638 s33 complement(1203012..1204619) [1608 bp, 535 aa]
           {ON} YML123C (PHO84) - inorganic phosphate transporter,
           transmembrane protein [contig 290] FULL
          Length = 535

 Score = 29.3 bits (64), Expect = 5.3,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 11/59 (18%)

Query: 76  DTSLASQGATAGYEYFVTML--ITFITLTFRFYFNCILASFVQELLSNPKFMIDQDDVE 132
           DT +  +G   G+ YF+  +   TF+    RF FN         +  +P+F I + D E
Sbjct: 224 DTDVIRKGCNWGWRYFLFAMGGFTFLLFVIRFAFN---------VFESPRFHISRGDNE 273

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.136    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,281,469
Number of extensions: 460995
Number of successful extensions: 1860
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1851
Number of HSP's successfully gapped: 23
Length of query: 161
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 60
Effective length of database: 41,900,133
Effective search space: 2514007980
Effective search space used: 2514007980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)