Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B056505.432ON46237219980.0
NCAS0F033605.432ON50939216890.0
KAFR0E039205.432ON49738015280.0
CAGL0L11594g5.432ON50737715000.0
KNAG0C049305.432ON49637514970.0
TBLA0A037605.432ON50437414940.0
Skud_15.2825.432ON48537314870.0
YOR119C (RIO1)5.432ON48437314850.0
Kpol_1062.315.432ON51338614870.0
SAKL0G02486g5.432ON50036814820.0
Suva_8.1725.432ON48637314690.0
KLLA0E21121g5.432ON52638314660.0
Smik_15.2975.432ON48637314620.0
TPHA0E017805.432ON50837714490.0
AER257W5.432ON47737514440.0
Kwal_55.214335.432ON47636714330.0
TDEL0E019305.432ON50237214350.0
KLTH0F16104g5.432ON54037514280.0
Ecym_47635.432ON53837613410.0
ZYRO0F09988g5.432ON46037112841e-174
CAGL0H08019g2.44ON4251801186e-06
TPHA0H009202.44ON4292511098e-05
Suva_14.1362.44ON4261561098e-05
NCAS0G015802.44ON4242561081e-04
Smik_14.1252.44ON4201561081e-04
KNAG0F010602.44ON4281521062e-04
TDEL0A008602.44ON4191391044e-04
Skud_14.1292.44ON4251561000.001
ABL166W2.44ON4141481000.001
Kwal_23.45632.44ON425255990.001
NDAI0F036002.44ON421155980.002
KAFR0A077602.44ON425256970.003
YNL207W (RIO2)2.44ON425156950.004
Ecym_64492.44ON417138920.011
TBLA0G003702.44ON444128910.015
SAKL0E13552g2.44ON419178900.019
Kpol_400.72.44ON425144880.028
ZYRO0C10340g2.44ON416157870.037
KLLA0D19008g2.44ON422178870.043
KLTH0B07722g2.44ON428142870.044
KLLA0F15576g5.200ON51251780.47
Ecym_11191.104ON79149761.1
KLTH0B03432g5.200ON50977741.8
Kpol_2002.985.200ON56863723.1
KNAG0I028306.341ON1515115698.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05650
         (462 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   774   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   655   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   593   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   582   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   581   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   580   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   577   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   576   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   577   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   575   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   570   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   569   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   567   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   562   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   560   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   556   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   557   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   554   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   521   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   499   e-174
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    50   6e-06
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    47   8e-05
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    47   8e-05
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      46   1e-04
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    46   1e-04
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    45   2e-04
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    45   4e-04
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    43   0.001
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    43   0.001
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    43   0.001
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    42   0.002
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    42   0.003
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    41   0.004
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    40   0.011
TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44 ...    40   0.015
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    39   0.019
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    39   0.028
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    38   0.037
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    38   0.043
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    38   0.044
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    35   0.47 
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    34   1.1  
KLTH0B03432g Chr2 complement(277684..279213) [1530 bp, 509 aa] {...    33   1.8  
Kpol_2002.98 s2002 (234791..236497) [1707 bp, 568 aa] {ON} (2347...    32   3.1  
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    31   8.1  

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/372 (100%), Positives = 372/372 (100%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120
           DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR
Sbjct: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120

Query: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180
           ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF
Sbjct: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180

Query: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240
           LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM
Sbjct: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240

Query: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300
           YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY
Sbjct: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300

Query: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360
           NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL
Sbjct: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360

Query: 361 IAHDNEKNFSAA 372
           IAHDNEKNFSAA
Sbjct: 361 IAHDNEKNFSAA 372

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/392 (82%), Positives = 344/392 (87%), Gaps = 26/392 (6%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           MSFT+ KTNKDKANRATVENVLDPRTM+FLKALTSRGVISDFNGCLSTGKEANVYHAFAG
Sbjct: 38  MSFTRSKTNKDKANRATVENVLDPRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 97

Query: 61  DSKLHSDDTDE-------------------PHDDNNIDEEALKEKLETQINPEE-TRLQK 100
           DSKLH+D   E                   P D N      LKEKLET++ PE  T++ +
Sbjct: 98  DSKLHADVVLEAKEEEDEDEDENEEDEDDLPIDHN------LKEKLETELRPEMLTKVSQ 151

Query: 101 DKKEYAVKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQS 160
           DKKEYAVKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQS
Sbjct: 152 DKKEYAVKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQS 211

Query: 161 NVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQV 220
            VIPVPKPIEVKNNVL+MEFL RGDGFASPRL+D+PYKDREE+ HYYH  +AYMRLMYQ+
Sbjct: 212 GVIPVPKPIEVKNNVLVMEFLGRGDGFASPRLKDHPYKDREEIFHYYHTIVAYMRLMYQI 271

Query: 221 CRLVHADLSEYNILIHNNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFP 280
           CRLVHADLSEYNILIH + MYIIDVSQSVEPEHPMSLDFLRMDIKNIN YF++MGIDIFP
Sbjct: 272 CRLVHADLSEYNILIHKDKMYIIDVSQSVEPEHPMSLDFLRMDIKNINFYFEKMGIDIFP 331

Query: 281 ERVIFQFIISETLDKFTGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEG 340
           ERVIFQFIIS+TL+ F G+Y DYNDLRDYVA+ LPIKK+ QDEAEDEIFRSLYLVRNLEG
Sbjct: 332 ERVIFQFIISDTLENFNGDYRDYNDLRDYVAQNLPIKKSEQDEAEDEIFRSLYLVRNLEG 391

Query: 341 LEERDFDRYTDGKFDLLKSLIAHDNEKNFSAA 372
           LEERDFDRYTDGKFDLLKSLIAHDNEKNFSAA
Sbjct: 392 LEERDFDRYTDGKFDLLKSLIAHDNEKNFSAA 423

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/380 (73%), Positives = 321/380 (84%), Gaps = 19/380 (5%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
            S ++GKTNKDKANRATVENVLDPRTMKFL+AL SRGVIS F+GCLSTGKEANVYHAFAG
Sbjct: 39  FSLSRGKTNKDKANRATVENVLDPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAG 98

Query: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDK--------KEYAVKIFKT 112
                   T  P          ++E++   ++P E   Q+DK        +EYA+KI+KT
Sbjct: 99  --------TGRPAGQVPT---LVQEEMSVPVDPSELSAQEDKDENSTDRREEYAIKIYKT 147

Query: 113 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVK 172
           SILVFKDRERYVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNL+RIYQS VIP PKPIE+K
Sbjct: 148 SILVFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIK 207

Query: 173 NNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYN 232
           NNVL+MEFLNRGDGFASPRL+D+PYKDREE+ HYYH  +AY+RL+YQVC LVHADLSEYN
Sbjct: 208 NNVLVMEFLNRGDGFASPRLKDHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYN 267

Query: 233 ILIHNNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISET 292
            L+H   +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N YF++MGIDIFPER+IFQF+ISET
Sbjct: 268 TLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIKNVNFYFEKMGIDIFPERIIFQFVISET 327

Query: 293 LDKFTGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDG 352
           LDKF G+Y   +DLRDYV + LPIK T QDEAEDEIFRSLYLVRNL GLEERDFDRYT+G
Sbjct: 328 LDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAEDEIFRSLYLVRNLNGLEERDFDRYTEG 387

Query: 353 KFDLLKSLIAHDNEKNFSAA 372
           +FDLLKSL+AHDNEKNF+A+
Sbjct: 388 RFDLLKSLLAHDNEKNFAAS 407

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/377 (72%), Positives = 319/377 (84%), Gaps = 7/377 (1%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +S  K KTNKDKANRATVENVLDPRTM+FL AL +RGVI+  NGCLSTGKEANVYHAFAG
Sbjct: 35  LSINKAKTNKDKANRATVENVLDPRTMRFLNALVNRGVIAGLNGCLSTGKEANVYHAFAG 94

Query: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKD-----KKEYAVKIFKTSIL 115
                   +DEP +D  ID  A+  K    I+    +  +D     +KEYA+KI+KTSIL
Sbjct: 95  SKMATEQQSDEPKED--IDANAIPSKGNIDISENRAKTAEDLIREGRKEYAIKIYKTSIL 152

Query: 116 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNV 175
           +FKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQ  VIP P+PIEVKNNV
Sbjct: 153 IFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNV 212

Query: 176 LIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILI 235
           L+MEFLNRGDGFASP+LRDYPYKDREE+ +YYHI ++YMRL+YQVCRLVHADLSEYN ++
Sbjct: 213 LVMEFLNRGDGFASPKLRDYPYKDREEIYYYYHILVSYMRLLYQVCRLVHADLSEYNTIV 272

Query: 236 HNNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDK 295
           H   +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N+YF++MGI+IF E+ IFQF+I++TLDK
Sbjct: 273 HKEKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGIEIFQEKAIFQFVITDTLDK 332

Query: 296 FTGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFD 355
           F G+ N Y DLR YVA  +PIK+T +DEAEDE+FRSL+LVRNLEGLEERDFDR+TDGKFD
Sbjct: 333 FDGDMNSYEDLRKYVATNIPIKRTQEDEAEDEVFRSLHLVRNLEGLEERDFDRFTDGKFD 392

Query: 356 LLKSLIAHDNEKNFSAA 372
           LLKSL+A DN+KN+ AA
Sbjct: 393 LLKSLLAQDNKKNYIAA 409

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/375 (75%), Positives = 319/375 (85%), Gaps = 15/375 (4%)

Query: 2   SFTK-GKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           SF+K  KT KDKANRATVENVLDPRTM+FL+AL +RG+ISDFNGCLSTGKEANVYHAFAG
Sbjct: 39  SFSKVKKTTKDKANRATVENVLDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAG 98

Query: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKD---KKEYAVKIFKTSILVF 117
           D    +  T         DEE+L  +L TQ   EE  +Q     KKEYA+KIFKTSILVF
Sbjct: 99  DGVSRASGTLP-------DEESLLARL-TQ---EERAVQASVGGKKEYAIKIFKTSILVF 147

Query: 118 KDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLI 177
           KDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS  +PVPKP+EVKNNVL+
Sbjct: 148 KDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGAVPVPKPVEVKNNVLV 207

Query: 178 MEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHN 237
           MEFLNRGDGFASPRLRDYPYKD + +  YY   +AYMRLMYQVC LVHADLSEYN+L+HN
Sbjct: 208 MEFLNRGDGFASPRLRDYPYKDTDSIRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHN 267

Query: 238 NLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFT 297
           + +YIIDVSQSV+PEHPMSLDFLRMDIKN+N+YF +MGIDIFPER+IFQF+ISE+LDKF 
Sbjct: 268 DRLYIIDVSQSVQPEHPMSLDFLRMDIKNVNLYFGKMGIDIFPERIIFQFVISESLDKFE 327

Query: 298 GNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLL 357
           G+Y    DL +YV   LP+KKT QDE EDE+FRSLYLVRNLEGLEERDFDR+T+GKFDLL
Sbjct: 328 GDYKSSKDLTEYVESNLPVKKTEQDEMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLL 387

Query: 358 KSLIAHDNEKNFSAA 372
           KSL+AHD EKNF+AA
Sbjct: 388 KSLLAHDMEKNFTAA 402

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/374 (75%), Positives = 317/374 (84%), Gaps = 9/374 (2%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
            S ++GKTNKDKANRATVENVLDPRTM+FLKALTSRG+ISDFNGC+STGKEANVYHAFAG
Sbjct: 34  FSISRGKTNKDKANRATVENVLDPRTMRFLKALTSRGIISDFNGCISTGKEANVYHAFAG 93

Query: 61  DSKLHSDDTDEPHDDNNIDE-EALKEKLETQINPEET-RLQKDKKEYAVKIFKTSILVFK 118
           D       T  P +    D  E L    +   NP     + + +KEYA+KI+KTSILVFK
Sbjct: 94  D-------TISPFEPKTHDSFENLVNTYDPYSNPNNNDTILEPRKEYAIKIYKTSILVFK 146

Query: 119 DRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIM 178
           DRERYVDGE+RFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS VIPVPKPIEVKNNVL+M
Sbjct: 147 DRERYVDGEYRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSKVIPVPKPIEVKNNVLVM 206

Query: 179 EFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNN 238
           EFLNRGDGFASPRL+DYPYKD  +++HYYH  I Y+RL+YQVCRLVHADLSEYN L+H N
Sbjct: 207 EFLNRGDGFASPRLKDYPYKDHNDIVHYYHTMIVYIRLLYQVCRLVHADLSEYNTLVHKN 266

Query: 239 LMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTG 298
            +Y+IDVSQSVEPEHPMSLDFLRMDIKNIN YF+RMG+ IF ER+IFQF ISETLD F G
Sbjct: 267 KLYVIDVSQSVEPEHPMSLDFLRMDIKNINNYFERMGVAIFAERIIFQFTISETLDNFNG 326

Query: 299 NYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLK 358
           NY++ +DLR YV   LP+K   +D+AEDEIFRSL+LVRNL GLEERDFDRYTDGKFDLLK
Sbjct: 327 NYSNEDDLRMYVKNNLPLKVPGKDDAEDEIFRSLHLVRNLGGLEERDFDRYTDGKFDLLK 386

Query: 359 SLIAHDNEKNFSAA 372
           SLIAHDNEKNFSA+
Sbjct: 387 SLIAHDNEKNFSAS 400

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/373 (73%), Positives = 321/373 (86%), Gaps = 21/373 (5%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +SF+K KT+KDKANRATVENVLDPRTM+FLK++ +RGVI+D NGCLSTGKEANVYHAFAG
Sbjct: 37  LSFSKAKTSKDKANRATVENVLDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG 96

Query: 61  DSKLHSDDTDEPHDDNNIDEEALK-EKLETQINPEETRLQKDKKEYAVKIFKTSILVFKD 119
             K              IDEE  + E LET            +KEYA+KI+KTSILVFKD
Sbjct: 97  TGKAPV-----------IDEETGQYEVLETD---------GLRKEYAIKIYKTSILVFKD 136

Query: 120 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIME 179
           RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+QS VIP P+P+EVKNNVL+ME
Sbjct: 137 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVME 196

Query: 180 FLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNL 239
           FL+RG+GFASP+LRDYPY+DREE+ HYYH  +AYMRL+YQVCRLVHADLSEYN +IHN+ 
Sbjct: 197 FLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDK 256

Query: 240 MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGN 299
           +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N+YF++MG+ IFPERVIFQF+ISE+L+KF G+
Sbjct: 257 LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPERVIFQFVISESLEKFKGD 316

Query: 300 YNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKS 359
           Y++  DL  Y+AK LPIK T QDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKS
Sbjct: 317 YHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKS 376

Query: 360 LIAHDNEKNFSAA 372
           LIAHDNE+NF+A+
Sbjct: 377 LIAHDNERNFAAS 389

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/373 (73%), Positives = 319/373 (85%), Gaps = 21/373 (5%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +SF++ KT+KDKANRATVENVLDPRTM+FLK++ +RGVI+D NGCLSTGKEANVYHAFAG
Sbjct: 37  LSFSRAKTSKDKANRATVENVLDPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAG 96

Query: 61  DSKLHSDDTDEPHDDNNIDEEALK-EKLETQINPEETRLQKDKKEYAVKIFKTSILVFKD 119
             K              IDEE  + E LET            + EYA+KI+KTSILVFKD
Sbjct: 97  TGKAPV-----------IDEETGQYEVLETD---------GSRAEYAIKIYKTSILVFKD 136

Query: 120 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIME 179
           RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS VIP PKPIEVKNNVL+ME
Sbjct: 137 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVME 196

Query: 180 FLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNL 239
           FL+RG+GFASP+L+DYPYK+R+E+ HYYH  +AYMRL+YQVCRLVHADLSEYN ++H++ 
Sbjct: 197 FLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDK 256

Query: 240 MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGN 299
           +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N+YF++MGI IFPERVIFQF+ISETL+KF G+
Sbjct: 257 LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGD 316

Query: 300 YNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKS 359
           YN+ + L  Y+A  LPIK T QDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKS
Sbjct: 317 YNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKS 376

Query: 360 LIAHDNEKNFSAA 372
           LIAHDNE+NF+A+
Sbjct: 377 LIAHDNERNFAAS 389

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/386 (71%), Positives = 326/386 (84%), Gaps = 19/386 (4%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +SFTKGKTNKDKANRATVENVLDPRTM+FLKALT+RGVIS FNGCLSTGKEANVYHAFAG
Sbjct: 34  LSFTKGKTNKDKANRATVENVLDPRTMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAG 93

Query: 61  DS--------------KLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYA 106
           D               KL S + ++  +++N D   + +   ++  PE   L   +KEYA
Sbjct: 94  DGTSSRNTDVKVEDLVKLTSVEVNQDSEEDNGDNNNVADIDGSK--PEGVEL---RKEYA 148

Query: 107 VKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVP 166
           +KI+KTSILVFKDRERYVDGE+RFRNSRSQHNPRKMIKIWAEKEFRNLRRI+QS VIP P
Sbjct: 149 IKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHQSGVIPAP 208

Query: 167 KPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHA 226
           KP+EVK+NVL+MEFLNRG+GFASPRL+DYPYKDR+E+  YYHI +AYMRL+YQVCRLVHA
Sbjct: 209 KPVEVKSNVLVMEFLNRGNGFASPRLKDYPYKDRDEIFWYYHILVAYMRLLYQVCRLVHA 268

Query: 227 DLSEYNILIHNNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQ 286
           DLSEYN ++H   +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N YF++MGIDIFPER+IFQ
Sbjct: 269 DLSEYNTIVHQGKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQ 328

Query: 287 FIISETLDKFTGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDF 346
           F+ISE L+ F G+ N  +DLR++V   LPIK T +DEAEDE+FRSL+LVRNL GLEERDF
Sbjct: 329 FVISEKLETFKGDLNSADDLREFVKNNLPIKSTDEDEAEDEVFRSLHLVRNLGGLEERDF 388

Query: 347 DRYTDGKFDLLKSLIAHDNEKNFSAA 372
           DR+TDGKFDLLK+LIA DN+KNF+A+
Sbjct: 389 DRFTDGKFDLLKTLIASDNQKNFTAS 414

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/368 (74%), Positives = 318/368 (86%), Gaps = 23/368 (6%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +S T+GKTNKDKANRATVENVLDPRTM+FL+ L SRGV+SD NGCLSTGKEANVYHAFAG
Sbjct: 40  LSLTRGKTNKDKANRATVENVLDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAG 99

Query: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120
           ++             N   EEA K+  +  +          K+EYAVKI+KTSILVFKDR
Sbjct: 100 NA-------------NQPSEEAEKDSKDELV----------KREYAVKIYKTSILVFKDR 136

Query: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180
           ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RI+QS VIP P+PIEV++NVL+MEF
Sbjct: 137 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEF 196

Query: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240
           LNRG+GFASPRL+D+PYKDREE+ +YYH  +AYMRL+YQVC+LVHADLSEYN ++H++ +
Sbjct: 197 LNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRL 256

Query: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300
           Y+IDVSQSV+PEHPMSLDFLRMDIKNIN YF++ GIDIFPERVIFQFIISETLDKF G+Y
Sbjct: 257 YMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDY 316

Query: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360
           ++  DLRDYV+K LP+K TA+DEAEDE+FRSL+LVRNL GLEERDFDR+TDGKFDLLKSL
Sbjct: 317 HNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSL 376

Query: 361 IAHDNEKN 368
           IAHDN+KN
Sbjct: 377 IAHDNKKN 384

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/373 (72%), Positives = 319/373 (85%), Gaps = 21/373 (5%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +SF+K KT+KDK+NRATVENVLDPRTM+FLK++ +RGVI+D NGCLSTGKEANVYHAFAG
Sbjct: 37  LSFSKAKTSKDKSNRATVENVLDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG 96

Query: 61  DSKLHSDDTDEPHDDNNIDEEALK-EKLETQINPEETRLQKDKKEYAVKIFKTSILVFKD 119
             K              +DEE  K E LET            + EYA+KI+KTSILVFKD
Sbjct: 97  TGKAPV-----------VDEETGKYEVLETD---------GLRAEYAIKIYKTSILVFKD 136

Query: 120 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIME 179
           RE+YVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNL+RI+QS VIP PKP+EVKNNVL+ME
Sbjct: 137 REKYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPAPKPVEVKNNVLVME 196

Query: 180 FLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNL 239
           FL+RGDGFASP+L+DYPYKDREE+ HYY+  +AYMRL+YQVCRLVHADLSEYN +IH++ 
Sbjct: 197 FLSRGDGFASPKLKDYPYKDREEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDQ 256

Query: 240 MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGN 299
           +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N+YF++MGI+IFPERVIFQF+ISE L+KF G+
Sbjct: 257 LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGINIFPERVIFQFVISEVLEKFKGD 316

Query: 300 YNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKS 359
           Y +  DL  Y++K LPIK T QDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKS
Sbjct: 317 YKNVPDLIGYISKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKS 376

Query: 360 LIAHDNEKNFSAA 372
           LIAHDNE+NF+A+
Sbjct: 377 LIAHDNERNFAAS 389

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/383 (71%), Positives = 323/383 (84%), Gaps = 11/383 (2%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +S T+GKT+KDKANRATVENVLDPRTM+FLK++ +RG++S FNGCLSTGKEANVYHAFAG
Sbjct: 37  LSLTRGKTSKDKANRATVENVLDPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAG 96

Query: 61  DSK-------LHSDDTDEPHDDNNIDEEALKEKLETQINPE-ETRLQKDKKEYAVKIFKT 112
           + +        H D    P +  +  ++AL  + E   +    T   K+KKEYAVKI+KT
Sbjct: 97  NHEERHLLVEGHDDTIGAPQNIESTKQKALTAESEDATSTSTATDEPKNKKEYAVKIYKT 156

Query: 113 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVK 172
           SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS VIP PKPIEV+
Sbjct: 157 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVR 216

Query: 173 NNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYN 232
           +NVL+MEFLNRGDGFASPRL+D+PYKDREE+ HYY++ IAYMRL+YQVCRLVHADLSEYN
Sbjct: 217 SNVLVMEFLNRGDGFASPRLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYN 276

Query: 233 ILIHNNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISET 292
            ++H + +YIIDVSQSV+PEHPMSLDFLRMDIKN+N YF ++GIDIFPERVIFQFIISE 
Sbjct: 277 SIVHEDKLYIIDVSQSVQPEHPMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEV 336

Query: 293 LDKFTGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDG 352
           LDKF G+Y   +DL  YVA  LP+K T +DEAEDE+FRSL+L+RNL GLEERDFDR+TDG
Sbjct: 337 LDKFKGDYRSSDDLETYVADNLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDG 396

Query: 353 KFDLLKSLIAHDNEK---NFSAA 372
           KFDLLKSLIA++N K   NF+A+
Sbjct: 397 KFDLLKSLIANENRKYSENFTAS 419

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/373 (73%), Positives = 318/373 (85%), Gaps = 21/373 (5%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +SF + KT+KDKANRATVENVLDPRTM+FLK++ +RGVI+D NGCLSTGKEANVYHAFAG
Sbjct: 37  LSFNRAKTSKDKANRATVENVLDPRTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG 96

Query: 61  DSKLHSDDTDEPHDDNNIDEEALK-EKLETQINPEETRLQKDKKEYAVKIFKTSILVFKD 119
             K              IDEE  K E LET   P        + EYA+KI+KTSILVFKD
Sbjct: 97  TGKAPV-----------IDEETGKYEVLETD-GP--------RPEYAIKIYKTSILVFKD 136

Query: 120 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIME 179
           RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS VIP PKPIEVKNNVL+ME
Sbjct: 137 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVME 196

Query: 180 FLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNL 239
           FL+RG+GFASP+L+DYPY+DR E+ HYY+  +AYMRL+YQVCRLVHADLSEYN +IH++ 
Sbjct: 197 FLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDK 256

Query: 240 MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGN 299
           +++IDVSQSVEPEHPMSLDFLRMDIKN+N+YF++MGI IFPERVIFQF+ISE+L+KF  +
Sbjct: 257 LFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISESLEKFKDD 316

Query: 300 YNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKS 359
           Y++  DL  Y+AK LPIK T QDEAEDEIFRSL+LVR+L GLEERDFDRYTDGKFDLLKS
Sbjct: 317 YHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKS 376

Query: 360 LIAHDNEKNFSAA 372
           LIAHDNE+NF+A+
Sbjct: 377 LIAHDNERNFAAS 389

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/377 (71%), Positives = 323/377 (85%), Gaps = 5/377 (1%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +S TKGKTNKDKANRATVENVLDPRTMK LK L +RGVI +FNGCLSTGKEANVYHAFAG
Sbjct: 35  LSDTKGKTNKDKANRATVENVLDPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAG 94

Query: 61  DSKLHSDDTDEPHD---DNNIDEEALKEKLET-QINPEETRLQ-KDKKEYAVKIFKTSIL 115
           D K+  +    P     ++ +++E +  ++E   I  EE + Q K +KEYA+KI+KTSIL
Sbjct: 95  DGKVKGNAEVLPQISELEDVLNKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSIL 154

Query: 116 VFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNV 175
           VFKDRERYVDGEFRFRN+RSQHNPRKMIKIWAEKEFRNLRRI+QS +IP P+P+EVK N+
Sbjct: 155 VFKDRERYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNI 214

Query: 176 LIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILI 235
           L+MEFL RGDGFASPRLRD+ YK REE+I+YYH  +AY+RL+YQVCRLVHADLSEYN ++
Sbjct: 215 LVMEFLGRGDGFASPRLRDHQYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIV 274

Query: 236 HNNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDK 295
           H++ +Y+IDVSQSVEPEHPMSLDFLRMDIKN+N YF++MGIDIFPER+IFQF+IS  LDK
Sbjct: 275 HDDKLYVIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDK 334

Query: 296 FTGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFD 355
           FTG+     DLR+Y+A  LP+K T +DE +DEIFRSL+LVRNL+GLEERDFDR+TDGKFD
Sbjct: 335 FTGDPRSSVDLRNYIAHYLPVKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFD 394

Query: 356 LLKSLIAHDNEKNFSAA 372
           LLK+LIA DN+KNF+A+
Sbjct: 395 LLKTLIASDNQKNFTAS 411

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/375 (71%), Positives = 309/375 (82%), Gaps = 37/375 (9%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +S TKGKTNKDKANRATVENVLDPRTM+FL+AL +RGV+S+FNGCLSTGKEANVYHA +G
Sbjct: 36  LSLTKGKTNKDKANRATVENVLDPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSG 95

Query: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120
                                       T+  PE       K EYAVKI+KTSILVFKDR
Sbjct: 96  ---------------------------ATEGAPE-------KSEYAVKIYKTSILVFKDR 121

Query: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180
           ERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNL+RIYQS VIP P+P+E+K+NVL+MEF
Sbjct: 122 ERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEF 181

Query: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240
           LNRGDGFASPRL+DYP+KDR+E+ HYYH+ ++Y+RL+YQVC+LVHADLSEYN ++H + +
Sbjct: 182 LNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKL 241

Query: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300
           YIIDVSQSV+PEHPMSLDFLRMDIKNINMYF+RMGIDIFPERVIFQF+ISETLDKF G+ 
Sbjct: 242 YIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGDM 301

Query: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360
               DLR YVA  LP K+TAQDEAED++FRSL+LVRNL GLEERDFDR+TDGKFDLLKSL
Sbjct: 302 RSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSL 361

Query: 361 IAHDNEK---NFSAA 372
           IA DN K    F+A+
Sbjct: 362 IAQDNAKISNTFTAS 376

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/367 (71%), Positives = 307/367 (83%), Gaps = 23/367 (6%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +S ++GKT+KDKANRATVENVLDPRTM+FL+ALTSRGVIS FNGC+STGKEANVYHAFA 
Sbjct: 40  LSVSRGKTSKDKANRATVENVLDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFA- 98

Query: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120
                            I  +  +E  E   N EE R      E A+KIFKTSILVFKDR
Sbjct: 99  ----------------EIGAKNTEEAGEVLPNLEERR------ELAIKIFKTSILVFKDR 136

Query: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180
           ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS ++P P+P+EV++NVL+MEF
Sbjct: 137 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEF 196

Query: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240
           L+RG+GFASPRL+DYPYKDREE  HYY+  +AY+RL+YQ C+LVHADLSEYN ++HN  +
Sbjct: 197 LSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKEL 256

Query: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300
           YIIDVSQSV+PEHPMSLDFLRMDIKN+N YF+RM +D+FPERVIFQF+ISETLDKF+G+Y
Sbjct: 257 YIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDY 316

Query: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360
               DLRDYV+K LP+K   QDEAEDE+FRSL+LVRNL GLEERDFDR+T GKFDLLKSL
Sbjct: 317 TSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSL 376

Query: 361 IAHDNEK 367
           IAHDNE+
Sbjct: 377 IAHDNER 383

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/372 (71%), Positives = 310/372 (83%), Gaps = 27/372 (7%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +SFT+ K++KDKANRATVENVLDPRTM+FLK++ +RGVIS+FNGCLSTGKEANVYHAFAG
Sbjct: 36  LSFTRSKSSKDKANRATVENVLDPRTMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAG 95

Query: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120
           +S    +D+ + H                        +Q +KKE A+KI+KTSILVFKDR
Sbjct: 96  ES---IEDSKDGH------------------------VQGEKKELAIKIYKTSILVFKDR 128

Query: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180
           ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRI QS VIP PKP+EVKNNVL+MEF
Sbjct: 129 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEF 188

Query: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240
           L+RGDGFASPRL+D+ + DR E+ HYYH  +AY+RL+YQVCRLVHADLSEYN ++H+  +
Sbjct: 189 LSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKL 248

Query: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300
           YIIDVSQSVEPEHPMSLDFLRMDIKNIN YF++MGIDIFPER+IFQF+ISETL+KF GN 
Sbjct: 249 YIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISETLEKFDGNP 308

Query: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360
               DL +YV+K LP+K T  D  EDEIFRSL+LVRNLEGLEERDFDR+TDGKFDLLKSL
Sbjct: 309 KSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSL 368

Query: 361 IAHDNEKNFSAA 372
           IAHDNE++  AA
Sbjct: 369 IAHDNERHLRAA 380

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/375 (70%), Positives = 311/375 (82%), Gaps = 26/375 (6%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +S T+ KT+KDKANRATVENVLDPRTM+FL+AL SRGVIS+FNGCLSTGKEANVYHAFAG
Sbjct: 92  LSVTRAKTSKDKANRATVENVLDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAG 151

Query: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120
                S++                   E ++ P     Q +++EYA+KI+KTSILVFKDR
Sbjct: 152 YGAKSSEE-------------------EQKVLPN----QGERREYAIKIYKTSILVFKDR 188

Query: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180
           ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS V+P P+PIEVK+NVL+MEF
Sbjct: 189 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEF 248

Query: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240
           LNRGDGFASP+L+D+PYKDR+E ++YYH  +AY+RL+YQ C+LVHADLSEYN ++HN  +
Sbjct: 249 LNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKL 308

Query: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300
           Y+IDVSQSV+PEHPMSLDFLRMDIKNIN YF+RM IDIFPER IFQF+IS+ L+KF G Y
Sbjct: 309 YVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEY 368

Query: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360
            +  DLR YVAKTL  K   +DEAEDE+FRSL+LVRNL GLEERDFDR+T GKFDLLKSL
Sbjct: 369 TNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSL 428

Query: 361 IAHDNEK---NFSAA 372
           IAHDN+K   NF+A+
Sbjct: 429 IAHDNQKVASNFTAS 443

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/376 (65%), Positives = 306/376 (81%), Gaps = 20/376 (5%)

Query: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60
           +S T+GKT+KDKANRATVENVLDPRTM+FL++L  RG+I++FNGCLSTGKEANVYHAF  
Sbjct: 68  LSVTRGKTSKDKANRATVENVLDPRTMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFG- 126

Query: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQIN-PEETRLQKDKKEYAVKIFKTSILVFKD 119
                          N +D    + K+  Q +   ++     K EYA+KI+KTSILVFKD
Sbjct: 127 ---------------NAVDIVEKQHKVIRQSSICSDSEGDTKKVEYAIKIYKTSILVFKD 171

Query: 120 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIME 179
           RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIY + VI  PKPIE+K+NVL+ME
Sbjct: 172 RERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVME 231

Query: 180 FLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNL 239
           FLNRGDGFASP+L+DYPY DR+E+ ++YH+ +AY+RL+YQVC+LVHADLSEYN ++H + 
Sbjct: 232 FLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESK 291

Query: 240 MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGN 299
           +YIIDVSQSV+PEHPMSLDFLRMDIKNIN YF ++GI++F ER IFQF+ISE L+KF G+
Sbjct: 292 LYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGD 351

Query: 300 YNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKS 359
           Y  Y+ L+ Y ++ LP+K T +DE EDEIFRSL+LVRNL GLEE DFDR+T+GKFDLLKS
Sbjct: 352 YRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKS 411

Query: 360 LIAHDNE---KNFSAA 372
           L++ DN+   K F+A+
Sbjct: 412 LVSQDNQKVAKTFTAS 427

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  499 bits (1284), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 246/371 (66%), Positives = 286/371 (77%), Gaps = 43/371 (11%)

Query: 2   SFTKGKTNK---DKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAF 58
            FT GK NK   DK++RATVENVLDPRTMKFL ALT+RGVIS+FNGC+S+GKEANVYHAF
Sbjct: 33  GFTSGKGNKTYKDKSDRATVENVLDPRTMKFLSALTNRGVISEFNGCISSGKEANVYHAF 92

Query: 59  AGDSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFK 118
                                             PE        +E A+KI+KTSILVFK
Sbjct: 93  G---------------------------------PE-------GQELAIKIYKTSILVFK 112

Query: 119 DRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIM 178
           DRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRI+ S V+P   P+EVK+NVL+M
Sbjct: 113 DRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHSSGVVPTACPVEVKSNVLVM 172

Query: 179 EFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNN 238
           +FLNRGDG  SPRL+DY YKD  EV HYY+ AIAYMRL+YQVCRLVHADLSEYNI++H N
Sbjct: 173 QFLNRGDGAPSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQVCRLVHADLSEYNIVVHQN 232

Query: 239 LMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTG 298
            ++IIDVSQSVEP HPMSLDFLRMDIKNIN YF +MG+ +F ER+IFQFII+ETL+ F G
Sbjct: 233 ALHIIDVSQSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLFQERMIFQFIIAETLEGFQG 292

Query: 299 NYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLK 358
           +Y   +DL +Y+ + LP+K   +   EDEIFRSL+LVR+L GLEERDFDR+TDGKFDLLK
Sbjct: 293 DYKTADDLVEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLGGLEERDFDRFTDGKFDLLK 352

Query: 359 SLIAHDNEKNF 369
           SLIA+DNE+N 
Sbjct: 353 SLIANDNERNL 363

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 79/180 (43%), Gaps = 35/180 (19%)

Query: 108 KIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPK 167
           ++ +TS    K+   Y+      RNSR   N   + K+ A KEF  +  +Y    I VP+
Sbjct: 126 RLGRTSFHTVKNNRDYL------RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQ 178

Query: 168 PIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRL---- 223
                 +V++M+ +   DG+   RLR++            +I   Y  LM  + +L    
Sbjct: 179 AYGCSRHVVVMDLI---DGYPMRRLREHK-----------NIPKLYSDLMTFIVKLANSG 224

Query: 224 -VHADLSEYNILIHNN---------LMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDR 273
            +H D +E+NI+I N+            +ID  Q +  +H  +  + + D+  I  +F +
Sbjct: 225 LIHCDFNEFNIMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKK 284

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/251 (19%), Positives = 100/251 (39%), Gaps = 60/251 (23%)

Query: 30  LKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHSDDTDEPHDDNNIDEEALKEKLET 89
           LK+L ++  +    G +  GKE+++Y                   D N ++  LK     
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEG----------------SDKNGNKRVLK----- 123

Query: 90  QINPEETRLQKDKKEYAVKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEK 149
                             ++ +TS    K+   Y+      R S    N   + K+ A K
Sbjct: 124 ----------------IHRLGRTSFHTVKNNRDYL------RRSNQGTNWMNLSKLAANK 161

Query: 150 EFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHI 209
           E++ +  +Y      VP+P +   +V++ME +    G+   RLR +     +++   Y  
Sbjct: 162 EYQFMSLLYTKG-FKVPEPFDNSRHVIVMELIR---GYPMRRLRKH-----KDIPKLYSD 212

Query: 210 AIAYMRLMYQVCRLVHADLSEYNILIHNNL-------MYIIDVSQSVEPEHPMSLDFLRM 262
            + ++ L      L+H D +E+NI+I + +         +ID  Q +  +H  +  + + 
Sbjct: 213 LMKFI-LQLANSGLIHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHKDADFYFKR 271

Query: 263 DIKNINMYFDR 273
           D+  I  +F +
Sbjct: 272 DVDGIRRFFKK 282

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 70/156 (44%), Gaps = 27/156 (17%)

Query: 130 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFAS 189
            R S    N   + ++ A KE++ +  +Y S    VP+P +   ++++ME +N   GF  
Sbjct: 142 LRKSSQGANWMHLSRLAANKEYQFMSMLY-SKGFKVPEPFDNSRHIVVMELIN---GFPM 197

Query: 190 PRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRL-----VHADLSEYNILIHNNL----- 239
            RLR +            +I   Y  LM  + +L     +H D +E+N++I + L     
Sbjct: 198 RRLRKHK-----------NIPKLYSDLMCFIVQLGNSGLIHCDFNEFNVMIKDELEDEND 246

Query: 240 --MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDR 273
               +ID  Q V  +H  +  + + D+  I  +F +
Sbjct: 247 CGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/256 (19%), Positives = 101/256 (39%), Gaps = 70/256 (27%)

Query: 30  LKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHSDDTDEPHDDNNIDEEALKEKLET 89
           LK + +R  I    G +  GKE+++Y   A D                            
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSAVDG--------------------------- 117

Query: 90  QINPEETRLQKDKKEYAVKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEK 149
             NP   ++ +        + +TS    ++   Y+      RN++   N   + ++ A K
Sbjct: 118 --NPRVMKIHR--------LGRTSFHTVRNNRDYL------RNTKQGVNWMYLSRLAANK 161

Query: 150 EFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHI 209
           E++ +  +Y      VP+P +   ++++ME +    G+   RLR +            +I
Sbjct: 162 EYQFMSMLYTKG-FEVPEPFDNSRHIIVMELIK---GYPMRRLRKHK-----------NI 206

Query: 210 AIAYMRLMYQVCRL-----VHADLSEYNILI------HNNLMY-IIDVSQSVEPEHPMSL 257
              Y  LM  + +L     +H D +E+NI+I       N+  + +ID  Q +  +H  + 
Sbjct: 207 PKLYSDLMNFIVKLGNSGLIHCDFNEFNIMIKDKPEDENDCGFVVIDFPQCISIQHQDAA 266

Query: 258 DFLRMDIKNINMYFDR 273
            + + D+  I  +F +
Sbjct: 267 YYFQRDVDCIRRFFKK 282

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 70/156 (44%), Gaps = 27/156 (17%)

Query: 130 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFAS 189
            RNS    N   + ++ A KE++ +  +Y S    VP+P +   ++++ME +   +G+  
Sbjct: 142 LRNSNQGANWMHLSRLAANKEYQFMSMLY-SKGFKVPEPFDNSRHIVVMELI---EGYPM 197

Query: 190 PRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRL-----VHADLSEYNILIHNNL----- 239
            RLR +            +I   Y  LM  +  L     +H D +E+NI+I N +     
Sbjct: 198 RRLRKHK-----------NIPKLYSDLMCFIVELANSGLIHCDFNEFNIMIKNEVEDEKD 246

Query: 240 --MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDR 273
               +ID  Q V  +H  +  + + D+  I  +F +
Sbjct: 247 CGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 70/152 (46%), Gaps = 19/152 (12%)

Query: 131 RNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASP 190
           +NS++  N   + K+ A KE++    +  S    VP+P +   +++IME +    GF   
Sbjct: 144 KNSKNGANWMFLSKLAAAKEYQ-FMSLLHSRGFRVPEPFDHSRHIIIMELIK---GFPMT 199

Query: 191 RLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNL---------MY 241
           RLR +     + V   Y   + ++ L      L+H D +E+NI+I + L           
Sbjct: 200 RLRKH-----QNVPKLYSDLMKFI-LELGNSGLIHCDFNEFNIMIKDKLDGSDPNDTGFI 253

Query: 242 IIDVSQSVEPEHPMSLDFLRMDIKNINMYFDR 273
           +ID  Q +  +H  +  + + D+  I  +F +
Sbjct: 254 VIDFPQCISIQHQDASFYFQRDVDCIRRFFKK 285

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 65/139 (46%), Gaps = 27/139 (19%)

Query: 145 IWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVI 204
           + A+KE++ +  +Y    I VP+P +   ++++ME +   DGF    LR++         
Sbjct: 157 LAAQKEYQFMSLLYSKGFI-VPQPYDNSRHIVLMELI---DGFPMRNLRNHS-------- 204

Query: 205 HYYHIAIAYMRLMYQVCRL-----VHADLSEYNILIHNNL-------MYIIDVSQSVEPE 252
              +I   Y  LM    +L     +H D +E+NI+I N +         +ID  Q +  +
Sbjct: 205 ---NIPKLYSDLMTFAVKLANSGLIHCDFNEFNIMIKNTVEDSKDCGFVVIDFPQCISIQ 261

Query: 253 HPMSLDFLRMDIKNINMYF 271
           H  +  + + DI+ I  +F
Sbjct: 262 HKDADFYFQRDIECIRRFF 280

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 70/156 (44%), Gaps = 27/156 (17%)

Query: 130 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFAS 189
            +NS    N   + ++ A KE++ +  +Y S    VP+P +   ++++ME +   +G+  
Sbjct: 142 LKNSNQGANWMHLSRLAANKEYQFMSMLY-SKGFKVPEPFDNSRHIVVMELI---EGYPM 197

Query: 190 PRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRL-----VHADLSEYNILIHNNL----- 239
            RLR +            +I   Y  LM  V  L     +H D +E+NI++ + +     
Sbjct: 198 RRLRKHK-----------NIPKLYSDLMCFVVELANSGLIHCDFNEFNIMVKDKVEDEQD 246

Query: 240 --MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDR 273
               +ID  Q V  +H  +  + + D+  I  +F +
Sbjct: 247 CGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 67/148 (45%), Gaps = 27/148 (18%)

Query: 138 NPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRDYPY 197
           N  ++  + AE+E+  +  +Y S    VPKP     + ++ME++    G+   RLR +  
Sbjct: 149 NWMRLSHLSAEREYAYMCLLY-SKGFSVPKPYANSRHAIVMEYIR---GYPMRRLRSHS- 203

Query: 198 KDREEVIHYYHIAIAYMRLMYQVCRL-----VHADLSEYNILIHNNL-------MYIIDV 245
                     ++   Y  LM  V +L     +H D +E+NI+I +++         +ID 
Sbjct: 204 ----------NVPKLYSDLMAFVVKLANHGMIHCDFNEFNIMIKDDIDDPEDQGFVVIDF 253

Query: 246 SQSVEPEHPMSLDFLRMDIKNINMYFDR 273
            Q +  +H  +  + + D+  I  +F +
Sbjct: 254 PQCISIQHQEAEYYFKRDVDCIRRFFKK 281

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/255 (18%), Positives = 99/255 (38%), Gaps = 73/255 (28%)

Query: 30  LKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHSDDTDEPHDDNNIDEEALKEKLET 89
           LKA+ +R  +      +  GKE++VY   A D                            
Sbjct: 85  LKAMLNRDTVYSIGNVIGVGKESDVYRVSAKDG--------------------------- 117

Query: 90  QINPEETRLQKDKKEYAVKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMI-KIWAE 148
              P   ++ +        + +TS    K+   Y+         R+Q      + ++ A 
Sbjct: 118 --TPRVLKIHR--------LGRTSFTTVKNNRDYL--------KRNQSGSWMFLSRLAAN 159

Query: 149 KEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYH 208
           KE++ +  +Y    + VP+P +   ++++M+ +   DG+   R+R +            +
Sbjct: 160 KEYQFMSLLYSKGFV-VPEPFDNSRHMILMQLI---DGYPMRRMRSHK-----------N 204

Query: 209 IAIAYMRLMYQVCRL-----VHADLSEYNILIHNNL-------MYIIDVSQSVEPEHPMS 256
           +   Y  LM  + +L     +H D +E+NI+I N +         +ID  Q +  +H  +
Sbjct: 205 LPKLYSDLMSFIVKLANHGLIHCDFNEFNIMIKNKVTDADDCGFIVIDFPQCISIQHQDA 264

Query: 257 LDFLRMDIKNINMYF 271
            ++ + D+  I  +F
Sbjct: 265 EEYFKRDVDCIRRFF 279

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 71/155 (45%), Gaps = 27/155 (17%)

Query: 131 RNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASP 190
           +N ++  N   + ++ A KE++ +  +Y      VP+P +   +++IM  +   +G+   
Sbjct: 144 KNVKNGVNWMYLSQLAANKEYQFMSMLYTKG-FEVPEPFDNSRHIIIMGLI---EGYPMR 199

Query: 191 RLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRL-----VHADLSEYNILIHNNL------ 239
           RLR +            +I   Y  LM  + RL     +H D +E+NI+I + +      
Sbjct: 200 RLRKHN-----------NIPKLYNDLMKFIVRLANSGLIHCDFNEFNIMIKDEVEDENDC 248

Query: 240 -MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDR 273
              +ID  Q +  +HP +  + + D+  I  +F +
Sbjct: 249 GFVVIDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/256 (19%), Positives = 100/256 (39%), Gaps = 69/256 (26%)

Query: 30  LKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHSDDTDEPHDDNNIDEEALKEKLET 89
           LK + +R  +    G +  GKE+++Y                   D N  E+ +K     
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIYRV----------------SDRNGTEKVMK----- 123

Query: 90  QINPEETRLQKDKKEYAVKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEK 149
                             ++ +TS    K++  Y+      +N+++  N   + KI A K
Sbjct: 124 ----------------IHRLGRTSFHTVKNKRDYIK-----KNAKNGVNWMYLSKIAAGK 162

Query: 150 EFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHI 209
           E++ +  ++      VP+  +   + ++ME +    G+   RLR +            +I
Sbjct: 163 EYQFMTLLFAKG-FDVPEAFDCSRHCIVMELIK---GYPMRRLRKHK-----------NI 207

Query: 210 AIAYMRLMYQVCR-----LVHADLSEYNILIHNNL-------MYIIDVSQSVEPEHPMSL 257
              Y  LM  + +     L+H D +E+NI+I + +         +ID  Q +  +H  + 
Sbjct: 208 PKLYSDLMSFIVKLGNSGLIHCDFNEFNIMIKDKVEDENDPGFVVIDFPQCISIQHNDAE 267

Query: 258 DFLRMDIKNINMYFDR 273
            + + D+  I  +F +
Sbjct: 268 FYFKRDVDCIRRFFKK 283

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 69/156 (44%), Gaps = 27/156 (17%)

Query: 130 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFAS 189
            + S    N   + ++ A KE++ +  +Y S    VP+P +   ++++ME +   +G+  
Sbjct: 142 LKKSNQGANWMHLSRLAANKEYQFMSMLY-SKGFKVPEPFDNSRHIVVMELI---EGYPM 197

Query: 190 PRLRDYPYKDREEVIHYYHIAIAYMRLMYQV-----CRLVHADLSEYNILIHNNL----- 239
            RLR +            +I   Y  LM  +       L+H D +E+NI+I + L     
Sbjct: 198 RRLRKHK-----------NIPKLYSDLMCFIVDLANSGLIHCDFNEFNIMIKDKLEDEND 246

Query: 240 --MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDR 273
               +ID  Q +  +H  +  + + D+  I  +F +
Sbjct: 247 CGFVVIDFPQCISIQHQDADYYFQRDVDCIRRFFKK 282

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 66/138 (47%), Gaps = 21/138 (15%)

Query: 145 IWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVI 204
           + A KE++ +  +Y S    VP+P +   ++++ME++    G+   RLR++    R    
Sbjct: 156 LAANKEYQFMNLLY-SKGFKVPRPYDNSRHIILMEYIK---GYPMRRLREHKDLPR---- 207

Query: 205 HYYHIAIAYMRLMYQVCR--LVHADLSEYNILIHNNL-------MYIIDVSQSVEPEHPM 255
               +    M+ + Q+    L+H D +E+NI+I +           +ID  Q +  +H  
Sbjct: 208 ----LYSELMKFIVQLGNHGLIHCDFNEFNIMIKDKTDGPDDLGFIVIDFPQCISIQHKD 263

Query: 256 SLDFLRMDIKNINMYFDR 273
           +  + + D++ I  +F +
Sbjct: 264 AEYYFQRDVECIRRFFKK 281

>TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44
           YNL207W
          Length = 444

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 66/128 (51%), Gaps = 13/128 (10%)

Query: 108 KIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPK 167
           ++ +TS    K+   Y+      +NS+   N   +  + A KE++ +  +Y SN   VPK
Sbjct: 126 RLGRTSFQTVKNNRDYLK-----KNSKIGTNWMVLSGLAALKEYQFMSILY-SNDFKVPK 179

Query: 168 PIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHAD 227
           P +   +++IME +   +G+   RLR    K++ ++   Y+  + ++  +     L+H D
Sbjct: 180 PFDNSRHIIIMELI---EGYPMRRLRS---KNQLKLAKLYNELMCFIVKLAD-HGLIHCD 232

Query: 228 LSEYNILI 235
            +E+NI+I
Sbjct: 233 FNEFNIMI 240

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 77/178 (43%), Gaps = 34/178 (19%)

Query: 108 KIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPK 167
           ++ +TS    K+   Y+ G       R   +   + ++ A KE++ +  +Y S    VP+
Sbjct: 126 RLGRTSFQTVKNNRDYLKG-------RQSASWMFLSRLAANKEYQFMSLLY-SKGFKVPE 177

Query: 168 PIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRL---- 223
           P +   ++++ME +    G+   RLR            ++ +   Y  LM  +  L    
Sbjct: 178 PFDNSRHIILMELIK---GYPMRRLR-----------KHHDLPKLYSDLMCFIVNLANHG 223

Query: 224 -VHADLSEYNILIHNNL-------MYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDR 273
            +H D +E+NI+I + +         +ID  Q +  +H  +  + + D+  I  +F +
Sbjct: 224 LIHCDFNEFNIMIKDEVDDENDCGFVVIDFPQCISIQHKDAEYYFQRDVDCIRRFFKK 281

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 65/144 (45%), Gaps = 27/144 (18%)

Query: 142 MIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDRE 201
           + ++ A KE++ +  +Y S    VPK  +   ++++ME +    GF   RLR +      
Sbjct: 154 LSRVAANKEYQFMSLLY-SKGFTVPKAFDNSRHIVVMELIK---GFPLRRLRKHD----- 204

Query: 202 EVIHYYHIAIAYMRLMYQVCRL-----VHADLSEYNILI------HNNLMYI-IDVSQSV 249
                 +I   Y  LM  +  L     +H D +E+NI+I       N+  +I ID  Q +
Sbjct: 205 ------NIPKLYSDLMCFIVNLANSGLIHCDFNEFNIMIKDEKDDENDCGFIVIDFPQCI 258

Query: 250 EPEHPMSLDFLRMDIKNINMYFDR 273
             +H  +  + + D+  I  +F +
Sbjct: 259 SIQHKDADFYFKRDVDCIRRFFKK 282

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 68/157 (43%), Gaps = 28/157 (17%)

Query: 130 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFAS 189
            ++SR   +   +  + A KE+  L  +  S    VP+  +   ++++MEF+    GF  
Sbjct: 142 LKHSRQGTSWMHLSLLAAHKEYEFLA-LLHSRGFQVPEAFDNSRHMVLMEFIK---GFPM 197

Query: 190 PRLRDYPYKDREEVIHYYHIAIAYMRLM-YQV----CRLVHADLSEYNILIHNN------ 238
             LR +            +I   Y  LM + V      L+H D +E+NI+I +       
Sbjct: 198 KNLRTHS-----------NIPKLYSDLMKFAVDLAKSGLIHCDYNEFNIMIKDQDTTDSS 246

Query: 239 --LMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDR 273
                +ID  Q +  +HP +  F R DI+ I  +F +
Sbjct: 247 DCGFVVIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 78/178 (43%), Gaps = 34/178 (19%)

Query: 108 KIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPK 167
           ++ +TS    K+   Y+      RN +S  +   + K+ A KE++ +  +Y  N   VP+
Sbjct: 126 RLGRTSFHTIKNNRDYL------RNGQSA-SWMHLSKLAANKEYQFMTMLYDRN-FEVPQ 177

Query: 168 PIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRL---- 223
           P +   + ++ME            +R YP +    +  + ++   Y  LM  + +L    
Sbjct: 178 PFDNSRHCVLME-----------HIRGYPMR---RLGKHKNLPKLYSDLMCFIVKLANHG 223

Query: 224 -VHADLSEYNILIHNN-------LMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDR 273
            +H D +E+NI+I +           +ID  Q +  +H  +  + + D+  I  +F +
Sbjct: 224 LIHCDFNEFNIMIKDEPEGEDDPGYVVIDFPQCISIQHQDAAYYFKRDVDCIRRFFKK 281

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 65/142 (45%), Gaps = 27/142 (19%)

Query: 144 KIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRDYPYKDREEV 203
           ++ A KE++ +  +  S    VP+P +   ++++ME +   DG+    +R          
Sbjct: 155 RLAANKEYQFMS-LLHSKGFTVPEPFDNSRHMILMELI---DGYPMRNMR---------- 200

Query: 204 IHYYHIAIAYMRLMYQVCRL-----VHADLSEYNILIHN-------NLMYIIDVSQSVEP 251
           +H  ++   Y  LM  + +L     +H D +E+NI+I N       N   +ID  Q +  
Sbjct: 201 LHK-NLPKLYSDLMLFIVKLANHGLIHCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISI 259

Query: 252 EHPMSLDFLRMDIKNINMYFDR 273
           +H  +  F + D+  I  +F +
Sbjct: 260 QHQDAEFFFKRDVDCIRRFFKK 281

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 114 ILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVI 163
           IL+F  R+ R VDGE R  N    H P  + KIW   E+ +L  ++ S+VI
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 109 IFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRI 157
           +F+T  + F+D++R+ +G    R   +QH+P +++K+    E+ +++R+
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRV 357

>KLTH0B03432g Chr2 complement(277684..279213) [1530 bp, 509 aa] {ON}
           similar to uniprot|Q07950 Saccharomyces cerevisiae
           YLR020C YEH2 Steryl ester hydrolase catalyzes steryl
           ester hydrolysis at the plasma membrane involved in
           sterol metabolism
          Length = 509

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 94  EETRLQKDKKEYAVKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRN 153
           ++T +  ++++     +   ++    ++R VDGE R  N  +   P+ + KIW   E+ +
Sbjct: 424 KQTEMHSNQEKITTDEYPRILMFIPKQDRLVDGE-RLINHFTNCEPQSLYKIWYIDEYSH 482

Query: 154 LRRIYQSNVIP-VPKPI 169
           L  ++  +VI  V KPI
Sbjct: 483 LDVLWSHDVIERVGKPI 499

>Kpol_2002.98 s2002 (234791..236497) [1707 bp, 568 aa] {ON}
           (234791..236497) [1707 nt, 569 aa]
          Length = 568

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 4/63 (6%)

Query: 113 SILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIP-VPKPIE 170
           +IL+F  R+ R VDGE R  N    H P    KIW   E+ ++  ++ +++I  + KPI 
Sbjct: 501 NILMFVPRQDRLVDGE-RLINHFINHEPHSTYKIWYIDEYSHMDVLWANDMIERIGKPI- 558

Query: 171 VKN 173
           VKN
Sbjct: 559 VKN 561

>KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1.24
            YDR523C
          Length = 1515

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 55/115 (47%), Gaps = 5/115 (4%)

Query: 137  HNPRKMIKIWA--EKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEFLNRGDGFASPRLRD 194
            HN +KM +I++  ++E   + R+   NVI     +EV  + L + F++  +G +   L D
Sbjct: 1250 HNVKKMERIYSCIKEEIEIMERLNHPNVINC-YGVEVHRDKLNI-FMDYCEGGSLSSLLD 1307

Query: 195  YPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILI-HNNLMYIIDVSQS 248
            +   + E V   Y + +           +VH D+   NIL+ HN L+  +D   +
Sbjct: 1308 HGRIEDEVVTQVYSLELLEGLAYLHRSGVVHQDIKPQNILLNHNGLIKYVDFGTA 1362

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,438,520
Number of extensions: 2085579
Number of successful extensions: 11351
Number of sequences better than 10.0: 101
Number of HSP's gapped: 11694
Number of HSP's successfully gapped: 102
Length of query: 462
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 349
Effective length of database: 40,524,141
Effective search space: 14142925209
Effective search space used: 14142925209
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)