Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B056405.430ON66966923940.0
NCAS0F033505.430ON63965115580.0
SAKL0G02442g5.430ON62362015060.0
Smik_4.6325.430ON62764415050.0
YDR365C (ESF1)5.430ON62864414770.0
Suva_2.5385.430ON62964314720.0
KLTH0F16148g5.430ON64664714130.0
Skud_4.6355.430ON62964313970.0
Kwal_55.214445.430ON64464313790.0
TBLA0A065405.430ON65964913770.0
Kpol_1016.85.430ON63761013650.0
TDEL0E019505.430ON61764613561e-180
ZYRO0F09944g5.430ON61164313511e-179
Ecym_47905.430ON63064913191e-174
TPHA0H017805.430ON62263813141e-173
KAFR0E039105.430ON62544311851e-154
CAGL0L11638g5.430ON60846311581e-150
KLLA0E21165g5.430ON62746210801e-138
KNAG0C049405.430ON64241610521e-134
AER259W5.430ON61945710481e-133
TDEL0F027204.77ON69467751.9
TBLA0A088904.77ON69863742.6
YGR145W (ENP2)4.77ON70744742.7
Smik_6.2484.77ON70744742.8
AFR468W4.77ON68963742.8
Skud_7.4674.77ON70844724.7
NDAI0D037804.77ON70744715.6
CAGL0E03069g4.77ON75444716.0
Suva_7.4354.77ON70833716.7
Kpol_1041.354.77ON70144699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05640
         (669 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   926   0.0  
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   604   0.0  
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   584   0.0  
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   584   0.0  
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   573   0.0  
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   571   0.0  
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   548   0.0  
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   542   0.0  
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   535   0.0  
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   535   0.0  
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   530   0.0  
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   526   e-180
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   525   e-179
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   512   e-174
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   510   e-173
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   461   e-154
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   450   e-150
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   420   e-138
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   409   e-134
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   408   e-133
TDEL0F02720 Chr6 complement(498279..500363) [2085 bp, 694 aa] {O...    33   1.9  
TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4...    33   2.6  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    33   2.7  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    33   2.8  
AFR468W Chr6 (1281915..1283984) [2070 bp, 689 aa] {ON} Syntenic ...    33   2.8  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    32   4.7  
NDAI0D03780 Chr4 complement(895256..897379) [2124 bp, 707 aa] {O...    32   5.6  
CAGL0E03069g Chr5 complement(286341..288485,288759..288878) [226...    32   6.0  
Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W ...    32   6.7  
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    31   9.7  

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/669 (72%), Positives = 487/669 (72%)

Query: 1   MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRK 60
           MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRK
Sbjct: 1   MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRK 60

Query: 61  LADSKGNEKEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNID 120
           LADSKGNEKEMN                 IA                          NID
Sbjct: 61  LADSKGNEKEMNDFDKYFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNID 120

Query: 121 RARGDVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLD 180
           RARGDVPADYV                            VTTQEPESGEPSKTLAVVNLD
Sbjct: 121 RARGDVPADYVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVNLD 180

Query: 181 WDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXX 240
           WDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQ        
Sbjct: 181 WDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTSK 240

Query: 241 XXXXXDEANDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETAT 300
                DEANDSDVSDVDIKDLYEEGDADKDVDTKA             AVVYCNNIETAT
Sbjct: 241 SKKISDEANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETAT 300

Query: 301 AIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVK 360
           AIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVK
Sbjct: 301 AIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVK 360

Query: 361 LTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXX 420
           LTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALV     
Sbjct: 361 LTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGGGF 420

Query: 421 XXXXXXXXXXAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIXXXXXXXXXXXXXX 480
                     AKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTI              
Sbjct: 421 GSREIFGGKGAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIEKVARKEKERRKAR 480

Query: 481 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTGST 540
                                         EDDAEAKKNQKSRA            TGST
Sbjct: 481 KQKLKELKTKAQQEKKDKLKLSKNKKNHTKEDDAEAKKNQKSRAELELLMMDDDEETGST 540

Query: 541 INNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSR 600
           INNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSR
Sbjct: 541 INNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSR 600

Query: 601 PEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIVNKLXXXXXXXXX 660
           PEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIVNKL         
Sbjct: 601 PEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIVNKLKTKSTSKSK 660

Query: 661 XXXXXEYLK 669
                EYLK
Sbjct: 661 KSKKSEYLK 669

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/651 (55%), Positives = 402/651 (61%), Gaps = 31/651 (4%)

Query: 1   MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRK 60
           M+  NS  K + D RF+ IYNDPKFRKTKNK+LKIKLD+RFSKKDLEIRRK+KVDKYGRK
Sbjct: 1   MSEDNS-TKGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRK 59

Query: 61  LA-DSKGNEKEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNI 119
           +  D+  N KE+                                               +
Sbjct: 60  IHEDNDMNNKELKDFDKYFEKEGESADEKKEEEEIETV--------------------TV 99

Query: 120 DRARGDVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNL 179
           DRARG+VPADYV                            V    PE+G+ +KTLAVVNL
Sbjct: 100 DRARGEVPADYVSSSDEYTSSESEDSGESDLESEGESEIEVDEATPETGDATKTLAVVNL 159

Query: 180 DWDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXX 239
           DWDHV+SSDLMITFS FLP+GG+IE I + PSEFGKERMQRE+ EGPP+ELFQ       
Sbjct: 160 DWDHVRSSDLMITFSGFLPKGGKIEKIVVLPSEFGKERMQREETEGPPRELFQKKKKKGK 219

Query: 240 XXXXXXDEANDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETA 299
                    +DSD SDVDIKDLYEEGDADKDVDT+A             AVVYCN++E A
Sbjct: 220 RAS----VESDSDDSDVDIKDLYEEGDADKDVDTRALRQYQLERLRYYYAVVYCNSVEAA 275

Query: 300 TAIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNV 359
            AIY+NCDGTEYESTANMFDLRYVPDGMDF DEPRDQC SLPKNYKPHQFSTDALQHSNV
Sbjct: 276 RAIYENCDGTEYESTANMFDLRYVPDGMDFDDEPRDQCSSLPKNYKPHQFSTDALQHSNV 335

Query: 360 KLTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXX 419
           KLTWDETP ER EVAKRAFTQKEI+DMDFKAYLASDSDGSEDE+N+DAKNKLK+LV    
Sbjct: 336 KLTWDETPAERVEVAKRAFTQKEIEDMDFKAYLASDSDGSEDEVNQDAKNKLKSLVGDSL 395

Query: 420 XXXXX-XXXXXXAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIXXXXXXXXXXXX 478
                          GEDE EVDMEITF+P L E   K +   E T              
Sbjct: 396 RIGNQPIFGSKDTLEGEDE-EVDMEITFDPGLSEGVEKTEEHEETTIEKVARKEKERRKA 454

Query: 479 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTG 538
                                           E DA      KS+A            T 
Sbjct: 455 RKQKLKELKNNAQKEKKDKLKSLKGKKHNDSTEGDAST---AKSKAELELLMMDDEDDTE 511

Query: 539 STINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDP 598
           + IN KAHFNM EILRSEKEK K+GKYQ+K +IVED FKPDLNDPRFKEVFEDHDFAIDP
Sbjct: 512 TGINKKAHFNMKEILRSEKEKSKKGKYQDKRRIVEDNFKPDLNDPRFKEVFEDHDFAIDP 571

Query: 599 SRPEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIVN 649
           SRPEFKET AMKEILKERSKR  K    KKR  S+ +N   E+SDI+NIV+
Sbjct: 572 SRPEFKETPAMKEILKERSKRSSKNAQKKKRSHSLMDNQANETSDISNIVS 622

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/620 (51%), Positives = 382/620 (61%), Gaps = 36/620 (5%)

Query: 1   MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRK 60
           M+   + N  + DPRF+ I++DPKF+  K K+LKIKLDDRFSKKDLEI++K+KVDKYGR+
Sbjct: 1   MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRR 60

Query: 61  LADSKGNEKEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNID 120
           L D    E                                                 ++D
Sbjct: 61  LKDVDNKE---------------------TKDFERYFEKEEESSSPSDEEGESTKVTSLD 99

Query: 121 RARGDVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLD 180
           RARG+VP+DY+                            +   +P +G+ ++ LAVVNLD
Sbjct: 100 RARGEVPSDYLSSSEEESSSESEEESENSELESEESDLEIEESKPPTGDATRMLAVVNLD 159

Query: 181 WDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXX 240
           WDHVKS+DLM+TFSSF+P+GG+I  IAIYPSEFGKERMQRE+VEGPP+ELFQ        
Sbjct: 160 WDHVKSTDLMVTFSSFVPKGGKILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKS-- 217

Query: 241 XXXXXDEANDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETAT 300
                 +  D D SDVDIKDLYEEGDA+KD D+KA             AVV+CNN+ETA 
Sbjct: 218 ------QRKDGDDSDVDIKDLYEEGDAEKDYDSKALRRYQLDRLRYYYAVVFCNNVETAE 271

Query: 301 AIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVK 360
           AIYQNCDGTEYESTANMFDLRYVP+GMDF+DEP+D+C+ +PKNYKP QFSTDALQHSNVK
Sbjct: 272 AIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVK 331

Query: 361 LTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXX 420
           LTWDETP ER E++KRAFTQKEI+DMDFKAYLASDS+GSE+E+NED++NKLK+LV     
Sbjct: 332 LTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIR 391

Query: 421 XXXXXXXXXXAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIXXXXXXXXXXXXXX 480
                        G D   VDMEITF P LDE    ++   +ETTI              
Sbjct: 392 IGDKSLFDKSDNEGGD---VDMEITFTPGLDEAKKDDEDGKDETTIEKIRRKEKERRKMR 448

Query: 481 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTGST 540
                                             E +K +KS+A            T S 
Sbjct: 449 KERVKELKKKAEEKKREKLNKSDSQSKTAD----EVEKEKKSKAELELLMMDDDNDTESK 504

Query: 541 INNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSR 600
           +N KAHFNM EILRSEKEKGKR KYQN++KIVEDEFKPDLNDPRF+EVFEDHDFAIDPS+
Sbjct: 505 LNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDPSQ 564

Query: 601 PEFKETKAMKEILKERSKRI 620
           PEFK T AMKEILKER++R+
Sbjct: 565 PEFKGTTAMKEILKERNQRV 584

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/644 (50%), Positives = 389/644 (60%), Gaps = 43/644 (6%)

Query: 9   KESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNE 68
           KE  D RFA IY+DPKF+ T+ KD KIKLD RFSKKDLE++ KSKVDKYGRK+ +++ N 
Sbjct: 8   KEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNTQNN- 66

Query: 69  KEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARGDVPA 128
           KE+                   +                           +DRARG++  
Sbjct: 67  KELEDFDKYFQKEAENDEDTEASVKTV-----------------------VDRARGEISG 103

Query: 129 DYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDWDHVKSSD 188
           DYV                            +   +PE G+ SKTLAVVNLDWDHVKS D
Sbjct: 104 DYVSSSDEFTSSDSESSEQSEVESEVESEVEIEDPKPECGDVSKTLAVVNLDWDHVKSED 163

Query: 189 LMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXXXXXDEA 248
           LMITFSSF+P+GG++E +AIYPSEFGKERMQRE+VEGPPKELFQ             DE+
Sbjct: 164 LMITFSSFVPKGGKLERVAIYPSEFGKERMQREEVEGPPKELFQKKNKNKVSRKKKSDES 223

Query: 249 NDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATAIYQNCDG 308
            DSD+ D+ I DLYEEGDADKDVD++A             A+VYC++I T+ AIY NCDG
Sbjct: 224 -DSDI-DIGINDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVYCSDITTSKAIYDNCDG 281

Query: 309 TEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETPV 368
           TEYESTANMFDLRYVPDGM F D  RD+C  LPKNY+PHQFSTDALQHSNVKLTWDETP 
Sbjct: 282 TEYESTANMFDLRYVPDGMTFDDAVRDECTLLPKNYRPHQFSTDALQHSNVKLTWDETPA 341

Query: 369 ERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXXXXXXXXX 428
           +R EVAKRAFTQKEIDDMDFKAYLASDSD S+++++EDAKNKLK+LV             
Sbjct: 342 DRLEVAKRAFTQKEIDDMDFKAYLASDSDESDEQIDEDAKNKLKSLVGGINFNSKKEN-- 399

Query: 429 XXAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIXXXXXXXXXXXXXXXXXXXXXX 488
                 + ++EVDMEITF PAL+  + +   E EETTI                      
Sbjct: 400 ----VKDSDEEVDMEITFTPALEGGNEQPSEEQEETTIEKIRRKEKERRKARKQKVKELK 455

Query: 489 XXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTGSTINNKAHFN 548
                                 ED    K N K++A               TINNKAHFN
Sbjct: 456 QQSEKDKKTKLKSINKKYAEGEED---IKNNAKAKAELELLMDDDDAEAQGTINNKAHFN 512

Query: 549 MNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETKA 608
           MNEILRSEKEK K+ +YQNK++IVED F PDLNDPRFKEVFEDHDFAIDP++PE+K T+A
Sbjct: 513 MNEILRSEKEKNKKSRYQNKERIVEDNFTPDLNDPRFKEVFEDHDFAIDPTQPEYKSTQA 572

Query: 609 MKEILKERSKRIHKKGSNKKRRLSITEN----AGAESSDITNIV 648
           M +ILKER KR+     +KKR+   +EN     G    +I N+V
Sbjct: 573 MNKILKERGKRV----KDKKRKHDGSENDIIKNGDSKGNIGNLV 612

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/644 (50%), Positives = 392/644 (60%), Gaps = 41/644 (6%)

Query: 1   MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRK 60
           MA  N + KE  D RFA IY+DPKF+ TK KD KIKLD RFSKKDLE++ KSKVDKYGRK
Sbjct: 1   MAGENPK-KEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRK 59

Query: 61  LADSKGNEKEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNID 120
           + +++ N +E+                  +                            +D
Sbjct: 60  IKNAQNN-RELEDFDKYFEKEAENDEDSEVNAKTV-----------------------VD 95

Query: 121 RARGDVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLD 180
           RARG+VP DYV                            +   +PESG+ SK LAVVNLD
Sbjct: 96  RARGEVPDDYVSSSDEFTSSDSESSGESEVESEEENEVEIENAKPESGDISKNLAVVNLD 155

Query: 181 WDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXX 240
           WDHVKS DLMITFSSF+P+GG+IE +AIYPSEFGKERMQRE+VEGPPKELFQ        
Sbjct: 156 WDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFGKERMQREEVEGPPKELFQKKNKNKTS 215

Query: 241 XXXXXDEANDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETAT 300
                D+++     D+ IKDLYEEGDADKDVD++A             A+VYC++  T+ 
Sbjct: 216 KKKKTDDSDSD--MDIGIKDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVYCSDTTTSK 273

Query: 301 AIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVK 360
           AIY NCDGTEYESTANMFDLRYVPDGM F D+ RD+C  LPKNY+PHQFSTDALQHS+VK
Sbjct: 274 AIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVK 333

Query: 361 LTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXX 420
           LTWDETP +R EVAKRAFTQKEIDDMDFKAYLASDSD S+ +++E+AKNKLK+LV     
Sbjct: 334 LTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDGQVDEEAKNKLKSLVGDFGF 393

Query: 421 XXXXXXXXXXAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIXXXXXXXXXXXXXX 480
                         ++++EVDMEITF PAL+  + K   + EETTI              
Sbjct: 394 NSKKET------PNDEDEEVDMEITFTPALEGGNEKSSEDKEETTIEKIRRKEKERRKAR 447

Query: 481 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTG-S 539
                                          D+ E +KN KS+A                
Sbjct: 448 KQKVKELKQQSEKDKKSKLKSVNKKHTN---DEEEIEKNAKSKAELELLMDDDDDTETQG 504

Query: 540 TINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPS 599
           TINNKAHFNMNEILRSEKEK K+G+YQ K++IVED F PDL DPRFKEVFEDHDFAIDP+
Sbjct: 505 TINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPT 564

Query: 600 RPEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSD 643
           +PEFK T+AM +ILKERSKR+     NKKR+L  +EN    ++D
Sbjct: 565 QPEFKGTQAMSKILKERSKRV----KNKKRKLGGSENNMTNNAD 604

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/643 (50%), Positives = 388/643 (60%), Gaps = 37/643 (5%)

Query: 9   KESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNE 68
           KES D RFA IYNDPKF+ T+ +D KIKLD RFSKKDLE++ KSKVDKYGRK+ D+  N 
Sbjct: 8   KESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDAH-NT 66

Query: 69  KEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARGDVPA 128
           KE+                                               +DRARG+VP 
Sbjct: 67  KEL-----------------------EDFDKYFEKEAENEEDTEADVKATVDRARGEVPN 103

Query: 129 DYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDWDHVKSSD 188
           DYV                                +PESG+ SKTLAVVNLDWDHVKS D
Sbjct: 104 DYVSSGDEFTSSDSESSGESEIESEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSED 163

Query: 189 LMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXXXXXDEA 248
           LMITFS F+P+GG+IE I++YPSEFGKERMQRE++EGPPKELFQ             +  
Sbjct: 164 LMITFSGFVPKGGKIERISVYPSEFGKERMQREEIEGPPKELFQRKKQVKASKKE--NAD 221

Query: 249 NDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATAIYQNCDG 308
           +     D+ IKDLYEEGDADKDVD++A             A+V C++I TA AIY+NCDG
Sbjct: 222 DSDSDIDIGIKDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDG 281

Query: 309 TEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETPV 368
           TEYESTANMFDLRYVPDGM F D  RD C +LPKNY+PHQFSTDALQHSNVKLTWDETP 
Sbjct: 282 TEYESTANMFDLRYVPDGMTFDDTARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPA 341

Query: 369 ERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXXXXXXXXX 428
           +R EVAKRAFTQKEIDDMDFKAYLASDSD S++E+NEDAK+KLK+LV             
Sbjct: 342 DRVEVAKRAFTQKEIDDMDFKAYLASDSDESDEEVNEDAKSKLKSLV----GGLGFNSKK 397

Query: 429 XXAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIXXXXXXXXXXXXXXXXXXXXXX 488
             A  G DE+EVDMEITF PAL+    K     EET+I                      
Sbjct: 398 ENANDG-DEEEVDMEITFTPALEGGDEKPIEGQEETSIEKIRRKEKERRKARKQKVKELK 456

Query: 489 XXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTG-STINNKAHF 547
                                  D+ E K N KS+A               S+IN+KAHF
Sbjct: 457 QQSEKEKRGKFKSANKKHVA---DEEEIKNNAKSKAELELLMDDDGDAEAESSINSKAHF 513

Query: 548 NMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETK 607
           NMNEILRSEKEK K+ +YQ K++IVED F PDL DPRFKEVFEDHDFAIDP++PE+K T+
Sbjct: 514 NMNEILRSEKEKHKKSRYQKKERIVEDNFTPDLEDPRFKEVFEDHDFAIDPTQPEYKGTQ 573

Query: 608 AMKEILKERSKRIH-KKGSNKKRRLSITENAGAESSDITNIVN 649
           AM +ILKER KR+H +K  + K    +TE+ G ++ +I N+VN
Sbjct: 574 AMNKILKERGKRVHDRKRKHGKNENDVTED-GNDNKNIGNLVN 615

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/647 (48%), Positives = 384/647 (59%), Gaps = 29/647 (4%)

Query: 11  STDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNE-K 69
           S+DPRFA + NDPKFR+T+ K  KIKLDDRFSKKDLE +RK++VDKYGR+L   KG E K
Sbjct: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRL---KGQESK 68

Query: 70  EMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARGDVPAD 129
           +                                               ++DRARG+V +D
Sbjct: 69  DKRDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDRARGEVHSD 128

Query: 130 YVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDWDHVKSSDL 189
           YV                            +   E +SG+ SKTLAVVNLDWDHVKS+DL
Sbjct: 129 YVSSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLDWDHVKSTDL 188

Query: 190 MITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXXXXXDEAN 249
           M+TFSSF+P+GG+I  +AIYPSEFGKER+ +E+ EGPP+E+F+             DE  
Sbjct: 189 MVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDSDE-- 246

Query: 250 DSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATAIYQNCDGT 309
                ++ +KDLYEEGDAD D D K+             AVVYCNN +TA +IY+NCDGT
Sbjct: 247 -----ELTVKDLYEEGDAD-DFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCDGT 300

Query: 310 EYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETPVE 369
           EYESTANMFDLRYVPDGMDF DE RD+CDS+PKNY+P +FSTDALQHS VK TWDETP +
Sbjct: 301 EYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPAD 360

Query: 370 RQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXXXXXXXXXX 429
           R  +AKRAFTQ+EI+DMDFKAYLASDS+ SE E N++ KNKLK+LV              
Sbjct: 361 RTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQ 420

Query: 430 XAKAGEDEDEVDMEITFNPALDENSP--KEDGEH-EETTIXXXXXXXXXXXXXXXXXXXX 486
             K G  E +VDM+ITF PAL E      +DGE  EETT+                    
Sbjct: 421 DPKDG--ESDVDMQITFAPALAEGGSGDADDGEKTEETTLEKVRRKEKERKKMRKERIKE 478

Query: 487 XXXXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTGSTINNKAH 546
                                    D        KS+A              S +N KAH
Sbjct: 479 LKKQAEDDKKQKLKEARRKPEPSATD-------SKSQAELELLMMDDSEEANSKLNKKAH 531

Query: 547 FNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKET 606
           FNMNEI+RSEKEKGK+ K+Q+K++IVEDEFKPDLNDPRF EVFEDHDFAIDPS+PEFK T
Sbjct: 532 FNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGT 591

Query: 607 KAMKEILKERSKRIHKKGSNKKRRLS--ITENAGAESSDITNIVNKL 651
            AMK+IL+ER+KR  +KG NKKR  +  I E +G  ++D+  +VNKL
Sbjct: 592 AAMKQILQERNKR-SQKGKNKKREANGDIAEPSG--NNDLKGLVNKL 635

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/643 (50%), Positives = 385/643 (59%), Gaps = 38/643 (5%)

Query: 1   MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRK 60
           MA   SE KES D RFA I +DPKF+ T+ +D KIKLD RFSKKDLE++ KSKVDKYGRK
Sbjct: 1   MAGDKSE-KESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRK 59

Query: 61  LADSKGNEKEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNID 120
           + D++ N KE+                  +A                           +D
Sbjct: 60  IKDARNN-KELEDFDKYFEKEAEHDEDSEVAAKIV-----------------------VD 95

Query: 121 RARGDVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLD 180
           RARG+VP+DYV                                  ESG+ SKTLAVVNLD
Sbjct: 96  RARGEVPSDYVSSSDEFTSSDSESSGESEVESEVEGEVETEDVAAESGDVSKTLAVVNLD 155

Query: 181 WDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXX 240
           WDHVKS DLMITFSSF+P GG+IE IAI+PSEFG+ERM+RE+VEGPPKELFQ        
Sbjct: 156 WDHVKSEDLMITFSSFVPRGGKIERIAIFPSEFGRERMEREEVEGPPKELFQKKNKNKHA 215

Query: 241 XXXXXDEANDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETAT 300
                    DSD  D+ I DLYEEGDADKDVD++A             AVV C++  +A 
Sbjct: 216 KEKNS-VGTDSD-GDIGINDLYEEGDADKDVDSRALRQYQLDRLRYYYAVVCCSDTTSAK 273

Query: 301 AIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVK 360
           AIY NCDGTEYESTANMFDLRYVPDGM F D  RD+C SLPKNY+PHQFSTDALQHSNVK
Sbjct: 274 AIYDNCDGTEYESTANMFDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVK 333

Query: 361 LTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXX 420
           LTWDETP +R EVAKRAFTQKEIDDMDFKAYLASDSD S+++++EDAKNKLK+LV     
Sbjct: 334 LTWDETPADRLEVAKRAFTQKEIDDMDFKAYLASDSDESDEQVDEDAKNKLKSLV----G 389

Query: 421 XXXXXXXXXXAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIXXXXXXXXXXXXXX 480
                     A  G++E EVDMEITF PAL+  + K     +ETTI              
Sbjct: 390 GLDFNMKKKGANDGKEEGEVDMEITFTPALEGENEKPIEGQDETTIEKIRRKEKERRKAR 449

Query: 481 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTGST 540
                                          D+ E K N KS+A            T  +
Sbjct: 450 KQKVKELKQQSEKDKKSKLKSVNKKHVA---DEEEIKNNAKSKAELELLMDEDDAETEGS 506

Query: 541 INNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSR 600
           +N+KAHF+M EILRSEKEK KRG+YQ K++IVED F PDL DPRFKEVFEDHDFAIDP++
Sbjct: 507 MNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQ 566

Query: 601 PEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSD 643
           PE+K T+AM  ILKER KR+     +KKR+ S   N  A++ D
Sbjct: 567 PEYKNTQAMSTILKERGKRV----KDKKRKHSDNGNDVAKNGD 605

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/643 (47%), Positives = 374/643 (58%), Gaps = 18/643 (2%)

Query: 10  ESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNEK 69
           ES+DPRFA +++DPKFR+TK K  KIKLDDRFSKKDL+ +RK++VDKYGR L   +  +K
Sbjct: 11  ESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLKGQENKDK 70

Query: 70  EMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARGDVPAD 129
           +                                               ++DRARG+VP+D
Sbjct: 71  KDFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSLDRARGEVPSD 130

Query: 130 YVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDWDHVKSSDL 189
           YV                            +   +P+SG+ SKTLAVVNLDWDHVKS+DL
Sbjct: 131 YVSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNLDWDHVKSTDL 190

Query: 190 MITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXXXXXDEAN 249
           MITFSSF+P GG+I  IA+YPSEFGKER++RE++EGPP+E+F+             D   
Sbjct: 191 MITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKKSHDDDSDSDV 250

Query: 250 DSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATAIYQNCDGT 309
           D        +DLYEEGDA+ D D K+             AVVYCNN+ TA AIY+NCDGT
Sbjct: 251 DV-------RDLYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDGT 302

Query: 310 EYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETPVE 369
           E+ESTANMFDLRYVPDGM F DE RD+C S+PKNY+P QFSTDALQHS VKLTWDETP +
Sbjct: 303 EFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPAD 362

Query: 370 RQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXXXXXXXXXX 429
           R  ++KRAFTQKEI+DMDFKAYLASDS+ SE E N+D K KLK+LV              
Sbjct: 363 RVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIFDQ 422

Query: 430 XAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIXXXXXXXXXXXXXXXXXXXXXXX 489
             + G  E +VDM+ITF P L E +  +  E+ E T                        
Sbjct: 423 APEEG--ESDVDMQITFAPGLAEGAEDDKQENAEETTLEKLKRKEKERKKMRKERIKELK 480

Query: 490 XXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTGST-INNKAHFN 548
                                 +DA      KS+A              S+ +N KAHFN
Sbjct: 481 KQAEEEKKQKRKESRYKPESTVEDA------KSKAELELLMMDDDENNSSSKLNKKAHFN 534

Query: 549 MNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETKA 608
           MNEI+RSEKEKGK+ +YQNKDKIVEDEFKPDLNDPRF EVFED DFAIDPS+PEFK T A
Sbjct: 535 MNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAA 594

Query: 609 MKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIVNKL 651
           MK+IL+ER+KR H KG NKKR+           SD+  +V KL
Sbjct: 595 MKQILQERTKRSH-KGQNKKRKADGNLANQNGQSDLKGLVKKL 636

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/649 (49%), Positives = 390/649 (60%), Gaps = 11/649 (1%)

Query: 6   SENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLAD-S 64
           SE K   D RFA ++ DPKFR++K   LK+KLD+RFSKKDL++  KSKVD+YGRK+ D +
Sbjct: 2   SERKPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRN 61

Query: 65  KGNEKEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARG 124
           + ++K+ +                  +                           +DRARG
Sbjct: 62  EKDKKDFDKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELARLDRARG 121

Query: 125 DVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDWDHV 184
           DVP+DYV                            + + +PE+G+PSKT+AVVNLDWDHV
Sbjct: 122 DVPSDYVSSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNLDWDHV 181

Query: 185 KSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXXXX 244
           KS+DLMITFS F+P+GG+I  IAIYPSEFGKERMQRE++EGPPKELF+            
Sbjct: 182 KSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGKKSTA- 240

Query: 245 XDEANDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATAIYQ 304
             E N+ DVSDVDI DLYEEGDADK++D+K+             AVVYCNNI TA +IY+
Sbjct: 241 --EDNEDDVSDVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAESIYK 298

Query: 305 NCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWD 364
           NCDGTEYESTAN+FD+RYVPD M F D PRD+CD LPKNYKP QFSTDALQHSNVKLTWD
Sbjct: 299 NCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWD 358

Query: 365 ETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXXXXX 424
           ETP +R E++KRAF+QKEID+MDFKAYLASDSD SE ELN D+KNKLK+LV         
Sbjct: 359 ETPADRVEISKRAFSQKEIDEMDFKAYLASDSDESESELNNDSKNKLKSLVGGGAFGNVF 418

Query: 425 XXXXXXAKAG-EDEDEVDMEITFNPALDENSPKEDGE--HEETTIXXXXXXXXXXXXXXX 481
                    G +DED VDMEITF P LDE     D E   EE+TI               
Sbjct: 419 GKDTEYDLDGSDDEDGVDMEITFTPGLDEKKEASDNETKKEESTIEKLQRKEKERRKLRK 478

Query: 482 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXED--DAEAKKNQKSRAXXXXXXXXXXXXTGS 539
                                         +    E +K  KS+A               
Sbjct: 479 QKVKDLKEKSVQERKEKLNSNRNRNKKNNNELLKDEKEKQDKSKAELELLMMDEDDRISG 538

Query: 540 TINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPS 599
             N KAHFNMNEILRSEKEKGK+ KYQ+K+KIV+DEFKP+LND RF E+FEDH FAIDP+
Sbjct: 539 VNN-KAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPT 597

Query: 600 RPEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIV 648
           +PEFK+T AMKEIL ER+KR  KK +  K      +N   + SDI+NIV
Sbjct: 598 QPEFKQTSAMKEILNERTKRASKKQNKDKDNKK-RKNTNEDKSDISNIV 645

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/610 (51%), Positives = 372/610 (60%), Gaps = 28/610 (4%)

Query: 9   KESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNE 68
           K+S+DPRF+ IY+DPKF+ +K K++KIKLDDRF K DL+I+ KSKVDKYGRKL D K N 
Sbjct: 8   KQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKLKDVKDN- 66

Query: 69  KEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARGDVPA 128
           KE+                  I                            +DRARG+VP+
Sbjct: 67  KELEDFDKYFEKEDEEDKEEEIGTEAKVKV--------------------LDRARGEVPS 106

Query: 129 DYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDWDHVKSSD 188
           DY                             V T +PESG+ SKTLAVVNLDWD+VKS D
Sbjct: 107 DYESSSEEFTSSDSESSGESEVDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQD 166

Query: 189 LMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXXXXXDEA 248
           LMITFSSFLP+GG+IE I IYPSEFGKERM RE+VEGPP+ELF              D+ 
Sbjct: 167 LMITFSSFLPKGGKIEKICIYPSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDD 226

Query: 249 NDSDVSD-VDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATAIYQNCD 307
            D +    VDI++LYEEGDA+KDVD+KA             AVVYCNNI +A +IY+NCD
Sbjct: 227 EDDESDSDVDIRELYEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCD 286

Query: 308 GTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETP 367
           GTEYES+AN+FDLRYVPDG +F DEPRD+C  LPKNYK  QF+TDALQHSNVKLTWDETP
Sbjct: 287 GTEYESSANIFDLRYVPDGTEFDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETP 346

Query: 368 VERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXXXXXXXX 427
            +R E+AKRAFTQKEI++MDFKAYLASDSD SE+E N+D KNKLK+LV            
Sbjct: 347 ADRVEIAKRAFTQKEIEEMDFKAYLASDSDESEEEPNDDVKNKLKSLVSQSTTIGDKSIF 406

Query: 428 XXXAKAGEDEDEVDMEITFNPALDENSPKEDG--EHEETTIXXXXXXXXXXXXXXXXXXX 485
                  E ED+VDMEITF P L E     D   ++EETTI                   
Sbjct: 407 DDKGDNNE-EDDVDMEITFTPGLGEGGEDGDEDKDNEETTIEKVRRKEKERRKARKDKLK 465

Query: 486 XXXXXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTGSTINNKA 545
                                    ++      + K++A            + ST+N KA
Sbjct: 466 QLKQQSENEKKEKLKELKKERNGNGKN---TNVDAKAKAELELLMMDDETESTSTLNKKA 522

Query: 546 HFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKE 605
           HFNMNEI+RSEKEKGK+ KYQ+K+KIVED+FKPDLNDPRFKE+FEDHDFAIDP++ EFKE
Sbjct: 523 HFNMNEIVRSEKEKGKKSKYQDKNKIVEDDFKPDLNDPRFKEIFEDHDFAIDPTQSEFKE 582

Query: 606 TKAMKEILKE 615
           T AMKEILKE
Sbjct: 583 TTAMKEILKE 592

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  526 bits (1356), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 330/646 (51%), Positives = 390/646 (60%), Gaps = 46/646 (7%)

Query: 9   KESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNE 68
           K S DPRF+KIY+DPKF   K K  K+KLDDRFSKKDLEI+RK+KVDKYGR++ D + ++
Sbjct: 4   KRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSK 63

Query: 69  --KEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARGDV 126
             K+ +                 I                            +DRARG+V
Sbjct: 64  ESKDFDKYFEQSDEEKKKDKDTEIL--------------------------TVDRARGEV 97

Query: 127 PADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDWDHVKS 186
           P+DYV                              T EP SG+ SKTLAVVNLDWD+V+S
Sbjct: 98  PSDYVSSSDEFTSSDSEVSDNEVESESESEVELEKT-EPSSGDSSKTLAVVNLDWDNVRS 156

Query: 187 SDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXXXXXD 246
           SDLMITFSSFLP GGRIE IAIYPSEFGKERMQRE+VEGPPKELFQ              
Sbjct: 157 SDLMITFSSFLPAGGRIEKIAIYPSEFGKERMQREEVEGPPKELFQKKKKKSKKG----- 211

Query: 247 EANDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATAIYQNC 306
           +  DSD SD+D+KDLYEEGDADK+VD KA             AVVYCNN+  A +IY NC
Sbjct: 212 QQEDSD-SDIDVKDLYEEGDADKNVDNKALRQYQLDRLRYYYAVVYCNNVAAAESIYNNC 270

Query: 307 DGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDET 366
           DGTEYESTAN+FD+RYVPDGMDF  +P+D C  LPKNYKP QFSTDALQHSNVKLTWDET
Sbjct: 271 DGTEYESTANIFDIRYVPDGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDET 330

Query: 367 PVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXXXXXXX 426
           P +R +VAKRAFTQKEI+DMDFKAYLASDSD SEDE++  +K+KLK+LV           
Sbjct: 331 PADRLDVAKRAFTQKEIEDMDFKAYLASDSDDSEDEVDAQSKSKLKSLVTGSSAFDFTRK 390

Query: 427 XXXXAKAGEDEDEVDMEITFNPALDE-NSPKEDGEHEETTIXXXXXXXXXXXXXXXXXXX 485
                  G DE EVDMEITF P LDE N   ++G+ EE+TI                   
Sbjct: 391 NADEVD-GNDE-EVDMEITFTPGLDEANKDGQEGQEEESTIDKVRRKEKERRKARKAKVK 448

Query: 486 XXXXXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTGSTINNKA 545
                                    E D       KS+A            T  +IN KA
Sbjct: 449 ELKHQAEQDKKVKLKKGRGKQTSDIEQDP------KSKAELELLMMDDEDDTEKSINKKA 502

Query: 546 HFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKE 605
           HFNM EIL+SEKEK K+ KYQ+K+KIV D+FKPDL DPRFKE+FE HDFAIDP++ EF+ 
Sbjct: 503 HFNMKEILKSEKEKKKKNKYQDKNKIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRG 562

Query: 606 TKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIVNKL 651
           TKAMKE+L +RSK+ H+   N KR+++  EN   E+ DI NIV KL
Sbjct: 563 TKAMKEMLNKRSKQAHR--VNSKRKIATQENDTNENGDIANIVAKL 606

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  525 bits (1351), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 318/643 (49%), Positives = 388/643 (60%), Gaps = 54/643 (8%)

Query: 8   NKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGN 67
           +K S+DPRFA I NDPKFR  K K LK+KLDDRFSKKDL++RRK+KVDKYGR++     +
Sbjct: 7   SKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITGESKD 66

Query: 68  EKEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARGDVP 127
            K+ +                  +                           +DRARG++P
Sbjct: 67  LKDFDKYFEKEGKEGKEDESSSSSEDEEEETESKV----------------VDRARGELP 110

Query: 128 ADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDWDHVKSS 187
             Y                             V   +PESG+PSKTLAVVNLDWDHV+++
Sbjct: 111 EAYTSSESEDSESDLSEEESEADVAEA-----VEEAKPESGDPSKTLAVVNLDWDHVRAA 165

Query: 188 DLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXXXXXDE 247
           DLMITFSSFLP GG+IE I IYPSEFGKERMQRE+ EGPP+E+F              DE
Sbjct: 166 DLMITFSSFLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNKKKKHH-------DE 218

Query: 248 ANDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATAIYQNCD 307
            +DSDV   DI+DLYEEGDADK+VD  A             A+VYCNN+ET  +IY NCD
Sbjct: 219 DSDSDV---DIRDLYEEGDADKEVDNAALRQYQLERLRYYYAIVYCNNVETGESIYSNCD 275

Query: 308 GTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETP 367
           GTEYESTAN+FDLRYVP+GM+F DEP+D+C  LPKNYKP +FSTDALQHSNVKLTWDETP
Sbjct: 276 GTEYESTANIFDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETP 335

Query: 368 VERQEVAKRAFTQKEIDDMDFKAYLASDSDGSE--DELNEDAKNKLKALVXXXXXXXXXX 425
            +R EV+KRAF+QKE++DMDF+AYLAS +D S+  +  NE+AKNKLK+LV          
Sbjct: 336 TDRLEVSKRAFSQKELEDMDFQAYLASGTDESDGEENNNEEAKNKLKSLV---------- 385

Query: 426 XXXXXAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIXXXXXXXXXXXXXXXXXXX 485
                A   + E+E DMEITF P LD++ P+ D +HEETTI                   
Sbjct: 386 -GQSLAYGKQQEEEPDMEITFTPGLDDSKPQADEDHEETTIEKVKRKEQERRKARKQRLK 444

Query: 486 XXXXXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTGSTINNKA 545
                                    E DA      KS+A            T  ++N KA
Sbjct: 445 ELKQQAEQEKKEKLRSGKNKKQVEDESDA------KSKAELELLMMEDEDDTEKSLNKKA 498

Query: 546 HFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKE 605
           HFNMNEIL+SEKEK K+GKYQ+K KI+EDEFKPDLNDPRF EVFE+ DFAIDPS+PE+K 
Sbjct: 499 HFNMNEILKSEKEKKKKGKYQDKGKIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKS 558

Query: 606 TKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIV 648
           TKAMKEIL+ERSKR HK    K++ L+   ++     DI+NIV
Sbjct: 559 TKAMKEILEERSKRAHK----KRKPLADDGDSKDNKHDISNIV 597

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  512 bits (1319), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 298/649 (45%), Positives = 374/649 (57%), Gaps = 54/649 (8%)

Query: 11  STDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNEKE 70
           + D RFA I+NDPKFRK K   LKI LDDRFSKKDLE +RK+KVDKYGR++     +EKE
Sbjct: 12  TNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSY--DEKE 69

Query: 71  M---------NXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDR 121
                     N                 IA                           +DR
Sbjct: 70  AKDFDRYFSKNESVEKIQSDDEEGETEDIAVSA------------------------LDR 105

Query: 122 ARGDVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDW 181
           ARG+VP DY                             +   +PE+G+P+K  AVVNLDW
Sbjct: 106 ARGEVPLDY-ESSSDENSSSESEEESEDSALDPDSELEIEESKPETGDPTKVFAVVNLDW 164

Query: 182 DHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXX 241
           DHV+S DL+ TF+SF+P GG I+ +AIYPSEFGKERM+RE+VEGPP+ELF+         
Sbjct: 165 DHVRSVDLLATFNSFVPNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQSKK--- 221

Query: 242 XXXXDEANDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATA 301
               ++ +D + SD+DI DLYE  DA+KD D+KA             AVVYC+++ TA A
Sbjct: 222 ----EKDSDDENSDIDINDLYEVDDAEKDYDSKALRRYQLDRLRYYYAVVYCSDVLTAKA 277

Query: 302 IYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKL 361
           IYQNCDGTE+ESTANMFDLRYVPD M F D+PRDQC S+PK+YKP QFST ALQHS VKL
Sbjct: 278 IYQNCDGTEFESTANMFDLRYVPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKL 337

Query: 362 TWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXX 421
           TWDETP +R E++KRAF QKEI++MDFKAYLASDSD SE E NE  KN L++LV      
Sbjct: 338 TWDETPADRVEISKRAFNQKEIEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQV 397

Query: 422 XXXXXXXXXAKAGEDEDEVDMEITFNPALDE-NSPKEDGEHEETTIXXXXXXXXXXXXXX 480
                          E+E D+EITF P L+  ++PKE+ E EET +              
Sbjct: 398 AHKSVFDKHGS----EEEADVEITFTPGLENGDAPKEENE-EETALDKIKRKEKERRKKR 452

Query: 481 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTGST 540
                                           +AE +  +K +A              ST
Sbjct: 453 KERVKELKMQAIDEKKARRRKGDDGAVT----EAEKELRKKKQAELELLMLEDETGKKST 508

Query: 541 INNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSR 600
           +NN AHFNMNEI++S+KEK K+ +YQNK+ IV+D FKPDLNDPRFKEVFEDHDFAIDPS+
Sbjct: 509 LNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQ 568

Query: 601 PEFKETKAMKEILKERSKRIHK-KGSNKKRRLSITENAGAESSDITNIV 648
           PEFK+T AMKEIL+ER++R  K K +  KR+ S       ++  + ++V
Sbjct: 569 PEFKKTPAMKEILEERTRRSSKMKKAFNKRKASYDHPQSGQTDSLNSLV 617

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  510 bits (1314), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 312/638 (48%), Positives = 381/638 (59%), Gaps = 35/638 (5%)

Query: 11  STDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNEKE 70
           +TD RF+ ++NDPKF+  + K+LKIKLD RFSK DLE+ RK++VDKYGRK+++    E +
Sbjct: 8   NTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISNLNNQEAK 67

Query: 71  MNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARGDVPADY 130
                              IA                           IDRARG+VP+DY
Sbjct: 68  ---DFDKYFEKEEDGKGEEIAVKPL-----------------------IDRARGEVPSDY 101

Query: 131 VXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDWDHVKSSDLM 190
                                        +   +PESG+ SKT+AVVNLDWDHVK++DL+
Sbjct: 102 QSSLDDYTSSESEDSEDEDLESEGESEAEIEETKPESGDSSKTIAVVNLDWDHVKATDLL 161

Query: 191 ITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXXXXXDEAND 250
           +TFSSF+P+GG+IE IAI+PSEFGK+RM+RE++EGPPKELFQ               A  
Sbjct: 162 VTFSSFVPKGGKIERIAIFPSEFGKQRMEREELEGPPKELFQKKKKKNSKKS----NAEF 217

Query: 251 SDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATAIYQNCDGTE 310
           +D SDVDI DLYEEGD DK+VD+K+             AVV+CNNI TA AIY NCDGTE
Sbjct: 218 NDDSDVDINDLYEEGDVDKEVDSKSLRQYQLDRLRYYYAVVFCNNISTAEAIYNNCDGTE 277

Query: 311 YESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETPVER 370
           YESTAN+FDLRYVPDGMDF D+P D+C  LPKNY P  F+TDALQHSNVKLTWDETP +R
Sbjct: 278 YESTANVFDLRYVPDGMDFEDQPYDECTELPKNYTPLNFTTDALQHSNVKLTWDETPADR 337

Query: 371 QEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXXXXXXXXXXX 430
            E+AKRAFTQKEID+MDFKAYLASDS+ SE E NE+ KNKLK+LV               
Sbjct: 338 VEIAKRAFTQKEIDEMDFKAYLASDSEESEGE-NEEVKNKLKSLVGLSMKIGDKSIMDN- 395

Query: 431 AKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIXXXXXXXXXXXXXXXXXXXXXXXX 490
            K+  ++ EVDMEITF P L EN   +  E  E T                         
Sbjct: 396 -KSDNEDGEVDMEITFTPGLAENDNNDKEEENEETTIEKVRRKEKERRKARKQKLKEIKQ 454

Query: 491 XXXXXXXXXXXXXXXXXXXXEDDAEAKKNQKSRAXXXXXXXXXXXXTGSTINNKAHFNMN 550
                                +D E+ KN K+              T STIN KAHFNM 
Sbjct: 455 NSEQEKREKLKSLKTERSKKSEDTESDKNAKAELELLMMDEDEINGT-STINKKAHFNMK 513

Query: 551 EILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETKAMK 610
           EILRSEKEK K+ K+QNK+KIVED FK DLNDPRF E+FEDHDFAIDP++ E+KET AMK
Sbjct: 514 EILRSEKEKTKKSKFQNKEKIVEDNFKADLNDPRFNEMFEDHDFAIDPTQSEYKETAAMK 573

Query: 611 EILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIV 648
           EILKERSKR   K +N+  +  I+ + G++  DI+NIV
Sbjct: 574 EILKERSKRSTMKKANRSEKRKISPSDGSQ-KDISNIV 610

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  461 bits (1185), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 253/443 (57%), Positives = 293/443 (66%), Gaps = 34/443 (7%)

Query: 9   KESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNE 68
           K+S DPRF++IYNDPKF+  K K LKI+LD RFSK+DLEIR K+KVDKYGRK  D +G++
Sbjct: 6   KKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD-EGSK 64

Query: 69  KEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARGDVPA 128
           KE++                                              +DRARG+VP+
Sbjct: 65  KELDDFEKYFEKEDEEEKKDTEETEEKPK---------------------VDRARGEVPS 103

Query: 129 DYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDWDHVKSSD 188
           DYV                            +   +PE+G+ SKTLAVVNLDWDHVKS+D
Sbjct: 104 DYVSSSDEYTSSESEDSEEEELDSDVESEVEIENTKPETGDASKTLAVVNLDWDHVKSAD 163

Query: 189 LMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXXXXXDEA 248
           LM+TFSSF+P+GG+I  I IYPSEFGKER+QRE+VEGPPKELFQ              E 
Sbjct: 164 LMVTFSSFVPKGGKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHK----ED 219

Query: 249 NDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATAIYQNCDG 308
            DSD SDVDIKDLYEEGDA+KDVD+KA             AVVYCNNI+TA AIY+NCDG
Sbjct: 220 FDSD-SDVDIKDLYEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIDTARAIYENCDG 278

Query: 309 TEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETPV 368
           TEYESTANMFDLRYVPDGM F DEPRD+C+SLPKNYKP QFSTDALQHSNVKLTWDETP 
Sbjct: 279 TEYESTANMFDLRYVPDGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPA 338

Query: 369 ERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXXXXXXXXX 428
           +R EVAKRAF+QKEI+DMDFKAYLASDSD SE+E+NE++KNKLKALV             
Sbjct: 339 DRVEVAKRAFSQKEIEDMDFKAYLASDSDESEEEVNENSKNKLKALVGESLDFGTNG--- 395

Query: 429 XXAKAGEDEDEVDMEITFNPALD 451
               A + E EVDMEITF P LD
Sbjct: 396 ----ASDGESEVDMEITFTPGLD 414

 Score =  140 bits (353), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 80/118 (67%), Positives = 98/118 (83%), Gaps = 4/118 (3%)

Query: 537 TGSTINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAI 596
           T  ++N KAHFN+NEI+RSEKEKGK+GKYQ K+KIVED+FKPDL+DPRFKEVFEDHDFAI
Sbjct: 497 TEQSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKIVEDDFKPDLSDPRFKEVFEDHDFAI 556

Query: 597 DPSRPEFKETKAMKEILKERSKRI---HKKGSNKKRRLSITENAGAESSDITNIVNKL 651
           DPS+PEFK+T AMK+IL ERSKR     K G NKKR+L  + +   +++ I+NIVNKL
Sbjct: 557 DPSQPEFKQTNAMKQILNERSKRSKERSKGGKNKKRKLDTSTSKNGKNA-ISNIVNKL 613

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  450 bits (1158), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 250/463 (53%), Positives = 301/463 (65%), Gaps = 39/463 (8%)

Query: 11  STDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNEKE 70
           S DPRF++IYNDPKF+K+ +K LKIKLDDRF KKDLE+ R++KVDKYGRK+ +  G+ K+
Sbjct: 6   SNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIKE--GSSKD 63

Query: 71  MNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARGDVPADY 130
           +                                               +DRARG+VP+DY
Sbjct: 64  IEDFDKYFEKDEKSAEEESADEGDVAKSKKI-----------------VDRARGEVPSDY 106

Query: 131 VXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEP--ESGEPSKTLAVVNLDWDHVKSSD 188
           V                               ++   E+G+ +KTLA VNLDWDHV+S D
Sbjct: 107 VSSEDEFTSSDSDTSGDSDYDSEIESGDEAQEEQTKVETGDATKTLAAVNLDWDHVRSVD 166

Query: 189 LMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXXXXXDEA 248
           +M+TFSSFLP+GG+IE I IYPSEFGKERM+RE+VEGPP+ELFQ               +
Sbjct: 167 MMVTFSSFLPKGGKIEKICIYPSEFGKERMKREEVEGPPRELFQKNKKKKKKNS-----S 221

Query: 249 NDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATAIYQNCDG 308
            D + SDVDIKDLYEEG+AD  VD +A             AV+YCNN+E+A AIY+NCDG
Sbjct: 222 EDEEESDVDIKDLYEEGNADDQVDKRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDG 281

Query: 309 TEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETPV 368
           TEYESTAN+ DLRYVPDGMDF DEP+DQC+ LPKNYKPHQFSTDALQHSNVKLTWDETPV
Sbjct: 282 TEYESTANIIDLRYVPDGMDFDDEPKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPV 341

Query: 369 ERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXXXXXXXXX 428
           +R EVAKRAFTQKEI+DMDFKAYLASDSD SE+E+NE+AKNKLK+LV             
Sbjct: 342 DRVEVAKRAFTQKEIEDMDFKAYLASDSDESEEEVNEEAKNKLKSLV--------GESLK 393

Query: 429 XXAKAGEDEDE-VDMEITFNPALDENSPK---EDGE-HEETTI 466
              K G DEDE +DMEITF P LDE + +   +DGE +EETTI
Sbjct: 394 IDGKDGSDEDEGMDMEITFTPGLDEANAEGEDKDGEDNEETTI 436

 Score =  116 bits (290), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/83 (80%), Positives = 76/83 (91%)

Query: 537 TGSTINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAI 596
           + S IN+KAHFNMNEILRSEKEK K+GK+Q K +IVED+FKP+L+D RFKEVFEDHDFAI
Sbjct: 495 SNSGINSKAHFNMNEILRSEKEKSKKGKFQKKQRIVEDDFKPNLDDDRFKEVFEDHDFAI 554

Query: 597 DPSRPEFKETKAMKEILKERSKR 619
           DPS+PEFKETKAMKEILKER KR
Sbjct: 555 DPSQPEFKETKAMKEILKERRKR 577

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  420 bits (1080), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 233/462 (50%), Positives = 289/462 (62%), Gaps = 29/462 (6%)

Query: 4   SNSENKE--STDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKL 61
           S  E KE  + DPRF+ I+NDPKFR TK+K+ KIKLDDRFSK+DLE+RRK+KVDKYGRK+
Sbjct: 3   SKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKI 62

Query: 62  ADSKGNEKEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDR 121
            D+  + K+ +                                             ++DR
Sbjct: 63  VDANKDVKDFDRYFTKEKPEDKEDESNSSESSDDQEAEAAVHAK------------SVDR 110

Query: 122 ARGDVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTLAVVNLDW 181
           ARG+ PADYV                                +P SG  + TLAVVNLDW
Sbjct: 111 ARGEPPADYVSSSDEESSSESEEESGDSDIESEEIEL--EESKPASGNATNTLAVVNLDW 168

Query: 182 DHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXX 241
           DHVKS+DL +TF SF+P+GG I+ IAIYPSEFGKERMQRE++EGPPKELFQ         
Sbjct: 169 DHVKSADLFVTFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQSKKS----- 223

Query: 242 XXXXDEANDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETATA 301
                + ND D  +++++ +YEEGDA+ D D+KA             AVVYC++I TA +
Sbjct: 224 -----KKNDKDDDEINVESIYEEGDAE-DYDSKALRRYQLERLRYYYAVVYCSDIRTAES 277

Query: 302 IYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKL 361
           IYQNCDGTEYESTAN+FDLRYVPDGM+  D+PRD+C SLPKNYKP QFSTDALQHS VKL
Sbjct: 278 IYQNCDGTEYESTANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKL 337

Query: 362 TWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVXXXXXX 421
           TWDETP +R E++KRAFTQKEI++MDFKAYLASDS+ SE E ++  KNKLKALV      
Sbjct: 338 TWDETPADRVEISKRAFTQKEIEEMDFKAYLASDSEESEVEHDDQVKNKLKALVMDSVKV 397

Query: 422 XXXXXXXXXAKAGEDEDEVDMEITFNPALDENSPKEDGEHEE 463
                     K  ED++E DMEITF P LDE+  ++  ++EE
Sbjct: 398 GQKSLFDQ--KEDEDDNEADMEITFTPGLDESGQQDTNDNEE 437

 Score =  130 bits (328), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 88/113 (77%), Gaps = 3/113 (2%)

Query: 539 STINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDP 598
           STINNKAHFNMNEIL+SEKEK K+ KYQNK+KIV+DEF PD+NDPRFKEVFEDHDFAIDP
Sbjct: 505 STINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDDEFTPDVNDPRFKEVFEDHDFAIDP 564

Query: 599 SRPEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIVNKL 651
           ++PEFK+T AM++ILKER+ R  KK   KKR   I   A  E S   N +  L
Sbjct: 565 TQPEFKKTPAMEKILKERTVRSSKKSRGKKRNHEI---ANTEHSKDINKIGGL 614

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  409 bits (1052), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 225/416 (54%), Positives = 269/416 (64%), Gaps = 26/416 (6%)

Query: 8   NKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGN 67
           +K S+DPRF+ +YNDPKFR TK K LK+KLD RFSKKDLE+++K+KVDKYGRK+ +   N
Sbjct: 3   DKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGDAN 62

Query: 68  EKEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXNIDRARGDVP 127
           +KE+                                               +DRARG+VP
Sbjct: 63  KKELEDFDKYFEKEDEAKESEDAEAPEAPVKVV------------------VDRARGEVP 104

Query: 128 ADYVXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXVTTQEPESGEPSKTLAVVNLDWD 182
            DYV                                   + +PESG+PSKTLAVVNLDWD
Sbjct: 105 DDYVSSADEFTSSDSESSGSSESESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWD 164

Query: 183 HVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXXXXXXXXXX 242
           HVKS DLMITF+ F+P+GG+IE I IYPSEFGKER+ RE+ EGPPKELF           
Sbjct: 165 HVKSVDLMITFTGFIPKGGKIERICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAA 224

Query: 243 XXXDEAN---DSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCNNIETA 299
                 +   D DVSDVDIKDLYEEGDA+KD+D+KA             AVVYCNN+ETA
Sbjct: 225 KSKGAESGKSDDDVSDVDIKDLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETA 284

Query: 300 TAIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNV 359
            AIY NCD TEYESTANMFDLRYVP+GM F D+PRD+C++LPKNYKP  F+TDALQHSNV
Sbjct: 285 KAIYDNCDATEYESTANMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNV 344

Query: 360 KLTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALV 415
           KLTWDETP +R E+AKRAF+QKEIDDMDFKAYLASDS+ S+ +++E  KN+LKALV
Sbjct: 345 KLTWDETPADRVEIAKRAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALV 400

 Score =  129 bits (323), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/111 (64%), Positives = 90/111 (81%), Gaps = 2/111 (1%)

Query: 539 STINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDP 598
           ST+N K HFNMNEI+RSEKEK K+ K+Q+K++IVEDEFKPDL+D RFKEVFEDHDFAIDP
Sbjct: 522 STLNKKMHFNMNEIMRSEKEKKKKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDP 581

Query: 599 SRPEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIVN 649
           SRPEFKET AM++IL+ERS R   KG  KKR+ +      ++ +DI+ IV+
Sbjct: 582 SRPEFKETPAMQKILQERSNRARSKG--KKRKSAEQSTDTSDKTDISQIVS 630

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  408 bits (1048), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 226/457 (49%), Positives = 280/457 (61%), Gaps = 47/457 (10%)

Query: 1   MAPSN-SENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGR 59
           MA +N    K+S D RFA+I +DPKFR  K K+LKIKLDDRFSK+DLE +RK+KVDKYGR
Sbjct: 1   MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR 60

Query: 60  KLADSKGNE-----KEMNXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXX 114
           ++  + G E     K                    +A                       
Sbjct: 61  RIGTAPGKEEKDFEKYFTKESSESAAEESDKEDSSVA----------------------- 97

Query: 115 XXXNIDRARGDVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTTQEPESGEPSKTL 174
               +DRARG+VPADYV                               +  ESG+PSK L
Sbjct: 98  ---KLDRARGEVPADYVSSSDEESSSESEADSDDATAESDEEVEIEEEKP-ESGDPSKVL 153

Query: 175 AVVNLDWDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQXX 234
           AVVNLDWDHVK +DL++ F+SF+PEGG+IE +AIYPSEFGKERMQRE+VEGPP+E+F+  
Sbjct: 154 AVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIYPSEFGKERMQREEVEGPPREVFKSK 213

Query: 235 XXXXXXXXXXXDEANDSDVSDVDIKDLYEEGDADKDVDTKAXXXXXXXXXXXXXAVVYCN 294
                       +A   D  ++ +KDLYE+GDA+KD D+KA             AVVYCN
Sbjct: 214 KDK---------KAKQDDDDEIGLKDLYEQGDAEKDYDSKALRRYQLERLRYYYAVVYCN 264

Query: 295 NIETATAIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDAL 354
           N+ TA AIYQNCDGTEYESTANMFDLRYVP+G+ F DEPR++C S+PK+YKP QFST AL
Sbjct: 265 NVATAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPREECASVPKDYKPVQFSTSAL 324

Query: 355 QHSNVKLTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKAL 414
           QH  VKLTWDETP +R E+AKRAF+QKEI+DMDFKAYLASDS+ SE + N +AKNKL++L
Sbjct: 325 QHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLASDSEESEADDNSEAKNKLRSL 384

Query: 415 VXXXXXXXXXXXXXXXAKAGEDEDEVDMEITFNPALD 451
           V                    DE+E D++ITF P L+
Sbjct: 385 VSSVKVADKPLFADES-----DEEEADVQITFTPGLE 416

 Score =  117 bits (293), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 62/76 (81%), Positives = 71/76 (93%)

Query: 540 TINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPS 599
           +IN+ AHFNMN+ILRSEKE+GK+ KYQ KDKIVED+FKPDLNDPRFKEVFED DFAIDPS
Sbjct: 499 SINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558

Query: 600 RPEFKETKAMKEILKE 615
           +PEFKET AMK+IL+E
Sbjct: 559 QPEFKETAAMKQILQE 574

>TDEL0F02720 Chr6 complement(498279..500363) [2085 bp, 694 aa] {ON}
           Anc_4.77 YGR145W
          Length = 694

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 6/67 (8%)

Query: 580 LNDPRFKEVFEDHDFAIDPSRPEFKE---TKAMKEILKERSKRIHKKGS---NKKRRLSI 633
           L D RFKE+FED DF +D    ++K+    K+ KE  +  +KRI    +   + + R+++
Sbjct: 477 LTDDRFKEMFEDEDFQVDEDAYDYKQLNPVKSAKETDEGAAKRIRALTAAEESDEERIAM 536

Query: 634 TENAGAE 640
            EN G +
Sbjct: 537 RENRGQQ 543

>TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4.77
           YGR145W
          Length = 698

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 12/63 (19%)

Query: 561 KRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKE---TKAMKEILKERS 617
           KRG     DK+VE+     L D RFKE+FED DF I+    ++K+    K+ +E  +  S
Sbjct: 467 KRG-----DKVVENV----LQDDRFKEMFEDEDFQINEDDYDYKQLNPVKSARETDEGAS 517

Query: 618 KRI 620
           KRI
Sbjct: 518 KRI 520

>YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essential
           nucleolar protein, required for biogenesis of the small
           ribosomal subunit; contains WD repeats, interacts with
           Mpp10p and Bfr2p, and has homology to Spb1p
          Length = 707

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 3/44 (6%)

Query: 580 LNDPRFKEVFEDHDFAIDPSRPEFKE---TKAMKEILKERSKRI 620
           L D RFKE+FED +F +D    +FK+    K++KE  +  +KRI
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSIKETEEGAAKRI 520

>Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W
           (REAL)
          Length = 707

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 3/44 (6%)

Query: 580 LNDPRFKEVFEDHDFAIDPSRPEFKE---TKAMKEILKERSKRI 620
           L D RFKE+FED +F +D    +FK+    K++KE  +  +KRI
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSIKETEEGAAKRI 520

>AFR468W Chr6 (1281915..1283984) [2070 bp, 689 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR145W (ENP2)
          Length = 689

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 12/63 (19%)

Query: 561 KRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKE---TKAMKEILKERS 617
           KRG  Q  +KI+EDE        RFKE+FED DF +D    ++K+    K+ +E     +
Sbjct: 470 KRGG-QAAEKILEDE--------RFKEMFEDEDFLVDEDDYDYKQLNPVKSARETDAGAA 520

Query: 618 KRI 620
           KRI
Sbjct: 521 KRI 523

>Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 29/44 (65%), Gaps = 3/44 (6%)

Query: 580 LNDPRFKEVFEDHDFAIDPSRPEFKE---TKAMKEILKERSKRI 620
           L D RFKE+FE+ +F +D +  +FK+    K+++E  +  +KRI
Sbjct: 477 LTDDRFKEMFENEEFQVDETDYDFKQLNPVKSLRETEEGAAKRI 520

>NDAI0D03780 Chr4 complement(895256..897379) [2124 bp, 707 aa] {ON}
           Anc_4.77 YGR145W
          Length = 707

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 580 LNDPRFKEVFEDHDFAIDPSRPEFKE---TKAMKEILKERSKRI 620
           L D RFKE+FED DF +D    ++K+    K+ +E  +  +KRI
Sbjct: 477 LTDDRFKEMFEDEDFQVDEDAYDYKQLNPVKSARETEEGAAKRI 520

>CAGL0E03069g Chr5 complement(286341..288485,288759..288878) [2265
           bp, 754 aa] {ON} highly similar to uniprot|P48234
           Saccharomyces cerevisiae YGR145w ENP2
          Length = 754

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 3/44 (6%)

Query: 580 LNDPRFKEVFEDHDFAIDPSRPEFKE---TKAMKEILKERSKRI 620
           L D RFKE+FED DF +D +  ++K+    K+ KE  +  +KRI
Sbjct: 538 LTDDRFKEMFEDEDFKVDENDYDYKQLNPVKSAKETDEGAAKRI 581

>Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 580 LNDPRFKEVFEDHDFAIDPSRPEFKETKAMKEI 612
           L D RFKE+FED  F +D    +FK+   +K I
Sbjct: 477 LTDDRFKEMFEDEQFQVDEDDYDFKQLNPVKSI 509

>Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {ON}
           complement(87507..89612) [2106 nt, 702 aa]
          Length = 701

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 580 LNDPRFKEVFEDHDFAIDPSRPEFKE---TKAMKEILKERSKRI 620
           L D RFKE+FED DF +D    ++K+    K+ +E  +  +KRI
Sbjct: 481 LTDDRFKEMFEDEDFQVDEEDYDYKQLNPVKSARETEEGAAKRI 524

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.128    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,016,170
Number of extensions: 2454040
Number of successful extensions: 9026
Number of sequences better than 10.0: 67
Number of HSP's gapped: 9286
Number of HSP's successfully gapped: 108
Length of query: 669
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 553
Effective length of database: 40,180,143
Effective search space: 22219619079
Effective search space used: 22219619079
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 69 (31.2 bits)