Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B055905.423ON38038020450.0
NCAS0F032905.423ON40437316730.0
Suva_15.3085.423ON37837516560.0
YHR112C5.423ON37837516490.0
Smik_8.1905.423ON42037516510.0
Skud_8.1735.423ON37837516370.0
KAFR0E038605.423ON37837516130.0
CAGL0I01276g5.423ON38037315560.0
TBLA0A036805.423ON38437215210.0
SAKL0G02222g5.423ON37837715110.0
Kpol_1031.235.423ON37937915040.0
KNAG0C049905.423ON38037914280.0
KLLA0E21319g5.423ON38037414090.0
CAGL0K05665gsingletonON37937714050.0
KNAG0F01580singletonON37937913590.0
ZYRO0F09768g5.423ON37337413570.0
TBLA0B03020singletonON37937913510.0
NDAI0F00140singletonON37837813450.0
ZYRO0F15664gsingletonON37337413240.0
TDEL0G00140singletonON38137613100.0
Ecym_55235.423ON38138112861e-177
TDEL0G04970singletonON38138012711e-175
TPHA0A06070na 1ON37336512441e-171
AER250C5.423ON37437412291e-169
KLTH0E16566g5.423ON38137611941e-163
NDAI0B00595singletonON37837811931e-163
Kwal_55.222215.423ON38037211771e-161
NCAS0F015207.97ON4294023544e-37
NDAI0H024007.97ON3933963481e-36
CAGL0H06369g7.97ON3913973444e-36
Kpol_1044.107.97ON3913973437e-36
ZYRO0D05742g7.97ON3913983411e-35
KLLA0F07909g7.97ON3913963402e-35
KAFR0K007607.97ON3923973358e-35
SAKL0B09614g7.97ON3924013341e-34
TPHA0L005707.97ON3913963322e-34
TDEL0H035307.97ON3914003288e-34
Ecym_26297.97ON3923973243e-33
Skud_1.497.97ON3944113243e-33
TBLA0E022407.97ON3873973217e-33
Smik_1.557.97ON3944073211e-32
YAL012W (CYS3)7.97ON3944073201e-32
Suva_1.567.97ON3954163112e-31
KLTH0D02728g7.97ON3924023103e-31
KNAG0D047407.97ON3903982991e-29
AEL341W7.97ON3934002876e-28
KLTH0E06644g8.145ON4603942463e-22
CAGL0L06094g8.145ON4503952402e-21
Kwal_47.172218.145ON4634142305e-20
Skud_19.6singletonON4013552251e-19
ACL059C8.145ON4532582216e-19
ZYRO0G19162g8.145ON4553992209e-19
YGL184C (STR3)8.145ON4654202201e-18
SAKL0H24882g8.145ON4593972191e-18
Smik_7.898.145ON4654242181e-18
Skud_7.888.145ON4654182172e-18
KLLA0C17028g8.145ON4604132154e-18
TDEL0B046608.145ON4644042154e-18
Ecym_84058.145ON4724102101e-17
Suva_7.798.145ON4654242083e-17
Smik_7.375na 1ON4013542031e-16
Suva_17.6singletonON4013561941e-15
KAFR0F030704.53ON4454581923e-15
NDAI0D028804.53ON4474651871e-14
NCAS0A058104.53ON4474611871e-14
TDEL0D06630singletonON4023561862e-14
YFR055W (IRC7)na 1ON3402931814e-14
TPHA0L003304.354ON7172811802e-13
TPHA0F004204.53ON4424491773e-13
KNAG0I029204.53ON4454541764e-13
ADL031W4.53ON4674551745e-13
Kpol_1041.444.53ON4444521721e-12
KLTH0G00418gsingletonON5682611675e-12
SAKL0G18172g4.354ON6732981667e-12
Kwal_14.791na 2ON5712681641e-11
ZYRO0G22198g4.53ON4454631612e-11
Ecym_83654.53ON4444481612e-11
Skud_10.3534.354ON6403551622e-11
Smik_10.4234.354ON6393551623e-11
TBLA0C044004.53ON4453041603e-11
Suva_12.2214.354ON6392821604e-11
YJR130C (STR2)4.354ON6393411595e-11
YLR303W (MET17)4.53ON4444561586e-11
SAKL0H23892g4.53ON4423171586e-11
ZYRO0B08338g4.354ON6402721587e-11
Ecym_51694.354ON6812491588e-11
Skud_12.3844.53ON4444601551e-10
Smik_12.3834.53ON4444561551e-10
Suva_10.3974.53ON4444561551e-10
YLL058Wna 2ON5752731533e-10
KLTH0D17930g4.354ON6522791533e-10
TDEL0E05710singletonON5562621506e-10
KLTH0D03652g4.53ON4444431497e-10
TDEL0D006104.354ON6522911499e-10
AER164C4.354ON6453071462e-09
Kwal_26.74374.53ON4442971426e-09
TDEL0E056204.53ON4464571417e-09
Kpol_1028.804.354ON6893311401e-08
CAGL0D06402g4.53ON4424521363e-08
NCAS0A062704.354ON6592441363e-08
KLLA0D04037g4.53ON4444521354e-08
Smik_12.3na 2ON5662581331e-07
KAFR0B068304.354ON6673111331e-07
Skud_12.10na 2ON5712701311e-07
Suva_10.8na 2ON5722691312e-07
Kwal_47.166444.354ON6522641302e-07
KLLA0B04378g4.354ON6882751266e-07
Suva_13.684.354ON6882391266e-07
CAGL0M00550g4.354ON5692581222e-06
Skud_13.594.354ON6492691203e-06
YML082W4.354ON6492521195e-06
NDAI0D032604.354ON6962601195e-06
Smik_13.554.354ON6992561142e-05
Kwal_26.7197singletonOFF87721032e-05
KNAG0M003304.354ON6312971124e-05
Smik_2.3596.112ON67473860.050
TBLA0A104905.263ON28343712.4
NDAI0C038705.263ON253108694.1
Kwal_26.71947.97ON152111674.4
TPHA0I005408.810ON55668686.8
Ecym_41268.442ON179693679.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B05590
         (380 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa] ...   792   0.0  
NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {O...   649   0.0  
Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {...   642   0.0  
YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON} P...   639   0.0  
Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON...   640   0.0  
Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON...   635   0.0  
KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {O...   625   0.0  
CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {...   603   0.0  
TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {O...   590   0.0  
SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {...   586   0.0  
Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {O...   583   0.0  
KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.4...   554   0.0  
KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} high...   547   0.0  
CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa] ...   545   0.0  
KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {O...   528   0.0  
ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {...   527   0.0  
TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {O...   525   0.0  
NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON}                522   0.0  
ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} high...   514   0.0  
TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON}      509   0.0  
Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {O...   499   e-177
TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {O...   494   e-175
TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa] ...   483   e-171
AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}...   478   e-169
KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} simi...   464   e-163
NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}              464   e-163
Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR1...   457   e-161
NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {O...   140   4e-37
NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {O...   138   1e-36
CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly...   137   4e-36
Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON} (19232....   136   7e-36
ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly...   135   1e-35
KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly...   135   2e-35
KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7....   133   8e-35
SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {...   133   1e-34
TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97...   132   2e-34
TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {O...   130   8e-34
Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {O...   129   3e-33
Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W (...   129   3e-33
TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.9...   128   7e-33
Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W (...   128   1e-32
YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}  CYS3Cystat...   127   1e-32
Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W (...   124   2e-31
KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly...   124   3e-31
KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {O...   119   1e-29
AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homol...   115   6e-28
KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {...    99   3e-22
CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} simil...    97   2e-21
Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {...    93   5e-20
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...    91   1e-19
ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON} S...    90   6e-19
ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} simi...    89   9e-19
YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}  ...    89   1e-18
SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} high...    89   1e-18
Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}...    89   1e-18
Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}...    88   2e-18
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    87   4e-18
TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {O...    87   4e-18
Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar t...    86   1e-17
Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}...    85   3e-17
Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W ...    83   1e-16
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    79   1e-15
KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.5...    79   3e-15
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      77   1e-14
NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4...    77   1e-14
TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa] ...    76   2e-14
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    74   4e-14
TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.35...    74   2e-13
TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {O...    73   3e-13
KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.5...    72   4e-13
ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic ho...    72   5e-13
Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON} (1173...    71   1e-12
KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON...    69   5e-12
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    69   7e-12
Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON} ...    68   1e-11
ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]...    67   2e-11
Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}...    67   2e-11
Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {...    67   2e-11
Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {...    67   3e-11
TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4...    66   3e-11
Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {...    66   4e-11
YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON} ...    66   5e-11
YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}  MET17Meth...    65   6e-11
SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} high...    65   6e-11
ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {...    65   7e-11
Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}...    65   8e-11
Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303...    64   1e-10
Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303...    64   1e-10
Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303...    64   1e-10
YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative pro...    64   3e-10
KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} simi...    64   3e-10
TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa] ...    62   6e-10
KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {...    62   7e-10
TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.3...    62   9e-10
AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON} S...    61   2e-09
Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {O...    59   6e-09
TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa] ...    59   7e-09
Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON} (1796...    59   1e-08
CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly...    57   3e-08
NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa] ...    57   3e-08
KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly...    57   4e-08
Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)     56   1e-07
KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa] ...    56   1e-07
Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W (...    55   1e-07
Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)    55   2e-07
Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON...    55   2e-07
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    53   6e-07
Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W...    53   6e-07
CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar...    52   2e-06
Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W...    51   3e-06
YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative p...    50   5e-06
NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {O...    50   5e-06
Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C ...    49   2e-05
Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W ...    44   2e-05
KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.35...    48   4e-05
Smik_2.359 Chr2 complement(641781..643805) [2025 bp, 674 aa] {ON...    38   0.050
TBLA0A10490 Chr1 (2583135..2583986) [852 bp, 283 aa] {ON} Anc_5....    32   2.4  
NDAI0C03870 Chr3 complement(879232..879993) [762 bp, 253 aa] {ON...    31   4.1  
Kwal_26.7194 s26 (258018..258476) [459 bp, 152 aa] {ON} YAL012W ...    30   4.4  
TPHA0I00540 Chr9 (107264..108934) [1671 bp, 556 aa] {ON} Anc_8.8...    31   6.8  
Ecym_4126 Chr4 complement(259120..264510) [5391 bp, 1796 aa] {ON...    30   9.1  

>NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa]
           {ON} Anc_5.423
          Length = 380

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/380 (100%), Positives = 380/380 (100%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA
Sbjct: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN
Sbjct: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
           FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP
Sbjct: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM
Sbjct: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG
Sbjct: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA
Sbjct: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360

Query: 361 DDLIQDLANALETLQKESSN 380
           DDLIQDLANALETLQKESSN
Sbjct: 361 DDLIQDLANALETLQKESSN 380

>NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {ON}
           Anc_5.423 YHR112C
          Length = 404

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/373 (80%), Positives = 341/373 (91%)

Query: 3   HLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHP 62
           HLST LIH DDKDNRVSDVAPPINVTTTFRYD +DL+PW+ERENLDFM+KTPIYSRL HP
Sbjct: 29  HLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHP 88

Query: 63  NSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRNFQ 122
           NSTRLESIFSE+L+GHAVIYSSG++AFFAAM+HYNPKR+F+GQSYHG RAIANILTRN+ 
Sbjct: 89  NSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYN 148

Query: 123 TKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQ 182
            +QH L++IE++AQ GDIVHLETPVNP+GTSLD+ +FA++AH KGALL VDSTFAPPPLQ
Sbjct: 149 VEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQ 208

Query: 183 NVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFMLL 242
           +VW+F+ DI+MHSATKYFGGHSDLLSGVLVVK+E VARQLRDDRIYLGTNVANLES++LL
Sbjct: 209 DVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLL 268

Query: 243 RSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYGPV 302
           RSLRTF+MR+ +QSENATK+V FL+ N+ K+  VL  I HSSLQ E FVKKQLKGGY PV
Sbjct: 269 RSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPV 328

Query: 303 FSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADD 362
           FSI+L NKEQCKKFP +LKYFHHATSLGGIESLVEWRAMTDPYI+QTLIR+SIGCE+ADD
Sbjct: 329 FSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDADD 388

Query: 363 LIQDLANALETLQ 375
           LI DL+ AL  LQ
Sbjct: 389 LINDLSAALNKLQ 401

>Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/375 (78%), Positives = 344/375 (91%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M  LSTALIH+DDKDNRV+DVAPPINV+TTFRYD+DDL+PWTERENLDFMEK P+YSRLA
Sbjct: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPNSTRLES+FS+ILDG+AV+YSSGLAAFFAAM+HYNPK+IFIGQSYHGVRAIANILTRN
Sbjct: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
           +  KQH L++IE++A  GDIVHLE+PVNP+GTS D+E FA++AH KGALL++DSTFA PP
Sbjct: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQ  W+F  DI+++SATKYFGGHSDLLSGVLVVK+EAV+R+L+DDRIYLGTNVANLESFM
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLRT+E+R+ KQSENATKIV FL  ++ ++DKVLK+I HSSLQ E FVKKQL GGYG
Sbjct: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVF+I+L  KEQCK FP  LKYFHHATSLGGIESLVEWRAMTDPYI+QTLIRVS+GCE+A
Sbjct: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 DDLIQDLANALETLQ 375
           DDLI+DLA+AL+ LQ
Sbjct: 361 DDLIRDLASALKELQ 375

>YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON}
           Protein of unknown function; localizes to the cytoplasm
           and nucleus; overexpression affects protein trafficking
           through the endocytic pathway
          Length = 378

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/375 (78%), Positives = 340/375 (90%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M  LSTALIH DDKDNRV+DVAPPINV+TTFRYD+DDL+PWTERENLDFMEK P+YSRLA
Sbjct: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPNSTRLESIFSEILDG+AVIYSSGLAAF+AAM+HYNPK+IFIGQSYHGVRAIANILTRN
Sbjct: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
           +  +QH L++IE+ A  GDIVHLE+PVNP+GTS D+E  A++AH KGALL+VDSTFA PP
Sbjct: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQ  W+F  DI+++SATKYFGGHSDLLSGVLVVKEEA +RQL+DDRIYLGTNVANLESFM
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLRT+EMR+ KQSENATK+V FL  ++ ++DKVLK+I HSSLQ E FVKKQL GGYG
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVF+I+L  KEQCK+ P  LKYFHHATSLGGIESLVEWRAMTDPYI+QTLIRVS+GCE+A
Sbjct: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 DDLIQDLANALETLQ 375
           +DLI+DLA+AL+ LQ
Sbjct: 361 NDLIKDLASALKELQ 375

>Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON}
           YHR112C (REAL)
          Length = 420

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/375 (79%), Positives = 339/375 (90%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M  LST+LIH DDKDNRV+DVAPPINV+TTFRYD+DDLVPWTERENLDFMEK PIYSRLA
Sbjct: 43  MVDLSTSLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLA 102

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPNSTRLESIFSEILDG+AVIYSSGLAAF+AAM+HYNPKRIFIGQSYHGVRAIANIL+RN
Sbjct: 103 HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRN 162

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
           +  KQ+ L++IE++A  GDIVHLETPVNP+GTS D+E  A +AH KGALL+VDSTFA PP
Sbjct: 163 YDIKQYPLEDIEKYASEGDIVHLETPVNPYGTSSDIESLAHRAHAKGALLIVDSTFASPP 222

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQ VW+F  DI+++SATKYFGGHSDLLSGVLVVKEE  +RQL+DDRIYLGTNVANLESFM
Sbjct: 223 LQYVWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFM 282

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLRT+EMR+ KQSENATK+V FL  ++ ++ KVLK I HSSLQ+E FVKKQL GGYG
Sbjct: 283 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFGKVLKKIYHSSLQREEFVKKQLVGGYG 342

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVF+I+L  KEQCK+ P  LKYFHHATSLGGIESLVEWRAMTDPYI+QTLIRVS+GCE+A
Sbjct: 343 PVFAITLQTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 402

Query: 361 DDLIQDLANALETLQ 375
           +DLI+DLA+AL+ LQ
Sbjct: 403 NDLIKDLASALKELQ 417

>Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/375 (77%), Positives = 339/375 (90%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M +LST LIH DDKDNRV+DVAPPINV+TTFRYD+DDL+PWTERENLDFMEK P+YSRLA
Sbjct: 1   MVNLSTVLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPNSTRLES+FSEILDG+AVIYSSGLAAF+AAM+HYNPK+IFIGQSYHGVRAI NIL RN
Sbjct: 61  HPNSTRLESVFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
           +  KQ+ L++IE++A  GDIVHLE+PVNP+GTS D+E  A +AH KGALL+VDSTFA PP
Sbjct: 121 YDVKQYPLEDIEKYASEGDIVHLESPVNPYGTSYDIESLAHRAHTKGALLIVDSTFASPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQ  W+F  D++++SATKYFGGHSDLLSGVLVVK+EAV+RQL+DDRIYLGTNVANLESFM
Sbjct: 181 LQYAWNFGADVVLYSATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLRT+EMR+ KQSENATK+V FL  ++ ++DKVLK+I HSSLQ E FVKKQL GGYG
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVF+I L NKEQCK+ P  LKYFHHATSLGGIESLVEWRAMTDPYI+QTLIRVS+GCE+A
Sbjct: 301 PVFAIILHNKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 DDLIQDLANALETLQ 375
           +DLI+DL++AL+ LQ
Sbjct: 361 EDLIKDLSSALKELQ 375

>KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {ON}
           Anc_5.423 YHR112C
          Length = 378

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/375 (74%), Positives = 337/375 (89%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M HL T+LIH+DDKDNRVSDVAPPINV+TT+RYD  DL+PW ERENLDFMEK P+YSRLA
Sbjct: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPN+TRLES+FSEIL+GHAVIYSSG AAF+AAM+HYNPK+IF+GQ YHG+RAIANI+TRN
Sbjct: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
           +  +Q+TLD+IE++AQ GDIV +E+P+NP+GTS+D++  A+KAH KGA++LVDSTFAPPP
Sbjct: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQ  WD   D+++HSATKYFGGHSDLLSGV+VVK+E V ++LRDDRIYLGTNV NLES+M
Sbjct: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLR++E+R+LKQSENATK+V FL+ N++++DKVLK + HSSLQKE+FVKKQL GGYG
Sbjct: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVFS+SL   +QCKKFP  LKYFHHATSLGG+ESLVEWRAMTDPYI+QTLIRVSIG ENA
Sbjct: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360

Query: 361 DDLIQDLANALETLQ 375
           DDLI+DL  AL+ L 
Sbjct: 361 DDLIKDLETALQELH 375

>CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 380

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/373 (75%), Positives = 324/373 (86%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
           L+T LIH DD  NRV DVAPPINV TTFRYD +DLVPW ERE+L+FM++TPIYSRL HPN
Sbjct: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65

Query: 64  STRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRNFQT 123
           +TRLESIFSEIL+GHAVIYSSGLAAF AAM H+NPK++FIGQSYHGV  IA+IL+RN+  
Sbjct: 66  ATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGL 125

Query: 124 KQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQN 183
            Q +LD+IE++AQ GDIVH+ETPVNPFGTS DL+ FA KAH +GALL+VDSTFAPPPLQ 
Sbjct: 126 IQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185

Query: 184 VWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLR 243
            W+F  DIIMHSATK+FGGHSDLLSGVLV K+E V+++L+DDRIYLGTNVANLES +LLR
Sbjct: 186 AWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLR 245

Query: 244 SLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYGPVF 303
           SLRTFEMR+LKQS+N TKIV  L SNRDKY KVL+ + HSSLQ ESFVKKQL GGY PVF
Sbjct: 246 SLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVF 305

Query: 304 SISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADDL 363
           SI+LMNKEQCK+ P  LKYFHHATSLGG+ESL+EWRAMTDPYI+QTLIR SIGCE+ADDL
Sbjct: 306 SITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESADDL 365

Query: 364 IQDLANALETLQK 376
           I DL  A   L+K
Sbjct: 366 IADLDAAFIELEK 378

>TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {ON}
           Anc_5.423 YHR112C
          Length = 384

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/372 (72%), Positives = 321/372 (86%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
           L T LIH DD +NRV+DVAPPIN+ TTFRYDN+DL+PW ER +L FME  PIYSRLAHPN
Sbjct: 9   LETLLIHGDDVNNRVTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHPN 68

Query: 64  STRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRNFQT 123
           S+RLE++FS+ILDG+AVIY+SG++AFFAAM ++NPKR+F+GQ+YHG  A  NIL RN   
Sbjct: 69  SSRLETLFSKILDGNAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGTL 128

Query: 124 KQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQN 183
           K+HT  EIE+FAQ GDIVHLE+PVNP+GTS D+E+F KKAH KG L+++DSTFAPPPLQ 
Sbjct: 129 KKHTHKEIEEFAQKGDIVHLESPVNPYGTSYDIEEFVKKAHSKGVLVMIDSTFAPPPLQY 188

Query: 184 VWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLR 243
           VWDF+VDI+MHSATK+FGGHSDLLSGVLVVK+E +A+ LR+DRIYLGTN+ANLES++LLR
Sbjct: 189 VWDFDVDIVMHSATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLLR 248

Query: 244 SLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYGPVF 303
           SLRTFEMR+LKQS +AT+IV FL+ NR K++KVLK I HSSLQKE FVKKQLKGGY PVF
Sbjct: 249 SLRTFEMRILKQSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQKEDFVKKQLKGGYTPVF 308

Query: 304 SISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADDL 363
           SI L NKEQCK  P +LKYF HATSLGG+ESL+EWRA+TDPYI QTLIRVS+GCEN  DL
Sbjct: 309 SIVLHNKEQCKALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCENTQDL 368

Query: 364 IQDLANALETLQ 375
           I DL  AL  +Q
Sbjct: 369 INDLDQALTVIQ 380

>SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 378

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/377 (71%), Positives = 319/377 (84%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M  L T LIH+DDKDNRV+D+  PINV TTFRYDN++L+ W +REN DF+E TP+YSRLA
Sbjct: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPN+TRLESIFSEIL GHAVIYSSGLAA+FA + HYNPK++FIGQSYHG   IA+I TRN
Sbjct: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
              KQ+ LD IE+ A  GDIVHLETPVNPFGTS D+EDFA+KAH KGALL++DSTFAPPP
Sbjct: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQ+VW F  D+++HS TKYFGGHSDLLSGV+VVK   VA+++++DRIYLGTN+ANLES++
Sbjct: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLRTFEMR+ KQSENAT +V +LD ++ +++KVL  I HSSLQ E FVKKQL+GGYG
Sbjct: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVFSI L +K QCKK P  L+ F HATSLGG+ESLVEWRA+TDPYIEQTLIRVS+GCE  
Sbjct: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360

Query: 361 DDLIQDLANALETLQKE 377
           +DLI+DLA AL+ LQ E
Sbjct: 361 EDLIKDLAGALKQLQDE 377

>Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {ON}
           complement(55637..56776) [1140 nt, 380 aa]
          Length = 379

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/379 (70%), Positives = 323/379 (85%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M  LST LIH+DDK+NRV+DVAPPINVTTTFRY+  DL+P  ERE++ F+++ P+YSR  
Sbjct: 1   MVELSTLLIHADDKNNRVTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREG 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPN TRLE++FSE L GHAVIYSSGL+A+FAA++ +NPKRIF+ Q+YHG  AIA +  RN
Sbjct: 61  HPNGTRLETLFSEYLGGHAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQRN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
              K++TLDEIEQ+A+ GDIVHLE+PVNPFGTS D+E FAK+AH KGALLLVD TFAPPP
Sbjct: 121 GMVKKYTLDEIEQYAEKGDIVHLESPVNPFGTSYDIEAFAKRAHAKGALLLVDGTFAPPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQNVWDF  DI+MHSATKYFGGHSDLL GVLVVK++     L++DRI LGTN+ANLES++
Sbjct: 181 LQNVWDFGADIVMHSATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYL 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLRTFEMR++KQSEN TKIV +LD N+ KY KVL+ ITHSSLQKE FVKKQLKGGY 
Sbjct: 241 LLRSLRTFEMRIMKQSENVTKIVKYLDENKGKYGKVLRDITHSSLQKEDFVKKQLKGGYN 300

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVFSI+L   EQCK F   LKYF HATSLGG+ESLVEWRA++DP+I+QTL+RVS+GCE+A
Sbjct: 301 PVFSITLNTVEQCKSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCESA 360

Query: 361 DDLIQDLANALETLQKESS 379
           DDLI+DLA+AL+ LQ E++
Sbjct: 361 DDLIKDLASALQNLQDEAN 379

>KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.423
           YHR112C
          Length = 380

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/379 (67%), Positives = 319/379 (84%), Gaps = 2/379 (0%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M HL+T LIH+DD+DNRV DVAPPINV+TT+RYD DDLVPW +RE+L+FM+K PIYSRLA
Sbjct: 1   MEHLATTLIHADDRDNRVPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLA 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPNSTRLES+FS+IL GHAV+Y+SGLAAFFAA+IHYNPKR+FI QSYHG RAIA+ILTR 
Sbjct: 61  HPNSTRLESLFSQILGGHAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRT 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGT-SLDLEDFAKKAHEKGALLLVDSTFAPP 179
              +Q +LD++ Q AQPGD+VHLE+PVNP GT   D+   A++AHE+GA+L+VDSTFAPP
Sbjct: 121 TGMQQCSLDDVPQMAQPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPP 180

Query: 180 PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESF 239
           PLQ+ W F  D++MHSATKYFGGHSDLLSGVLV +++  A  LRDDRIYLGTNVANLE++
Sbjct: 181 PLQDPWRFGCDMVMHSATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAY 240

Query: 240 MLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQK-ESFVKKQLKGG 298
           +LLRSLRTFE+R+ +QS N T +V++L+ +R  +  VL  + HSSLQ  E +V +QL+GG
Sbjct: 241 LLLRSLRTFELRIQRQSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGG 300

Query: 299 YGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCE 358
           + PVF+++L + +QCK+FP +L YF HATSLGG+ESLVEWRAMTDP+I+QTL+RVS+GCE
Sbjct: 301 HPPVFALTLRSIDQCKRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCE 360

Query: 359 NADDLIQDLANALETLQKE 377
           NA+DLI DL  AL  LQ +
Sbjct: 361 NAEDLIADLTTALNALQSD 379

>KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 380

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/374 (66%), Positives = 312/374 (83%), Gaps = 2/374 (0%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
           LST L+H+DDK NRV+D+  PINV TTFRY+  DL+PW ERE+   +EK PIYSRLAHPN
Sbjct: 3   LSTELVHADDKHNRVTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAHPN 62

Query: 64  STRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRNFQT 123
           S R+ES+ S++L+G AV+Y++GLAA+FA + +YNPKR+FIG+ YHG R+IA+I TRN+  
Sbjct: 63  SLRVESVLSKVLEGEAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNWNL 122

Query: 124 KQHTL--DEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPL 181
           +QH L  DEI Q A  GD+VH+ETPVNP+GTS D++ FA   H KGA+L++DSTFAPPPL
Sbjct: 123 EQHKLEIDEILQHAGKGDVVHIETPVNPYGTSFDIKAFADATHSKGAILVIDSTFAPPPL 182

Query: 182 QNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFML 241
           QN WDF VD+I+HSATKYFGGHSDLL+GVL VK++ VA +LR DRIYLGTN+ANLE+F+L
Sbjct: 183 QNPWDFGVDVILHSATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAFLL 242

Query: 242 LRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYGP 301
           LRSLRTFEMR+  QSENATK+VS+L  ++  ++ VL+ + HSSLQ E FVK+QLKGGYGP
Sbjct: 243 LRSLRTFEMRIQTQSENATKLVSYLIEHKSDFEGVLEGVFHSSLQTEPFVKEQLKGGYGP 302

Query: 302 VFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENAD 361
           VF+++L +KEQC+KFP +L  F HATSLGG+ESLVEWRA+TDPYI  TLIRVS+G EN D
Sbjct: 303 VFAVTLNSKEQCRKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVENVD 362

Query: 362 DLIQDLANALETLQ 375
           DLI+D ANAL+TLQ
Sbjct: 363 DLIKDFANALKTLQ 376

>CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa]
           {ON} highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 379

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/377 (63%), Positives = 310/377 (82%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M  L+T LIH DDK NRVSDVAPPINV+TT+RY  +DL+PW +REN DFM++ P+YSR  
Sbjct: 1   MVELATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQRENFDFMDEAPVYSREG 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPN TRLE+IFS+IL+GHAV+Y+SGLAAFFAAM+HYNPK++F+GQ YHGV  I+++ TRN
Sbjct: 61  HPNCTRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVFLGQCYHGVHCISDMFTRN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
           F  +Q TL++I +FA+ GD+VHLE+PVNPFGT +D++  A  AH KGA++++DSTFAPPP
Sbjct: 121 FNVQQRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLADLAHSKGAIVIIDSTFAPPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQ  WD   D+IMHSATKYFGGHSDLL G+LV K++ ++R L++DRI LG+ + NLES++
Sbjct: 181 LQYAWDLGADMIMHSATKYFGGHSDLLGGILVTKDKEISRALKEDRINLGSMIGNLESYL 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           L+RSLRT+EMR++KQSEN  KIV +L+ N++KY  VL  I HSS+Q ++FVK QL GGY 
Sbjct: 241 LMRSLRTYEMRIMKQSENVVKIVKYLNDNKEKYPNVLGDIYHSSIQSDAFVKDQLVGGYN 300

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
            VFS  L ++EQCKKFP  LKYFHHATSLGGIESL+EWRA++D  I+Q L+RVS+GCE+A
Sbjct: 301 SVFSFCLKSEEQCKKFPDKLKYFHHATSLGGIESLIEWRALSDDKIDQKLMRVSVGCESA 360

Query: 361 DDLIQDLANALETLQKE 377
            DLI DL+ AL+ L+ E
Sbjct: 361 KDLIDDLSQALQELENE 377

>KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/379 (63%), Positives = 303/379 (79%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M H +T+ IH+DD++NRV DVAPPINV+ T+RYDND+L    E+E L+ M+  P+YSR A
Sbjct: 1   MTHFATSAIHADDQNNRVPDVAPPINVSVTYRYDNDNLKICDEKECLEEMDSVPVYSRTA 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPN TRLES+ S IL+GHAV+Y+SG +AF+AA++HYNPKR+FI +SY G+ AIA+I+TRN
Sbjct: 61  HPNCTRLESVLSSILNGHAVVYNSGCSAFYAALVHYNPKRLFIEESYDGMHAIADIMTRN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
           +  +QHT D IE++AQ GDIVHLE+P+NP+G S D++  A +AH KGALL+VDST APPP
Sbjct: 121 YGMQQHTFDNIEKYAQVGDIVHLESPLNPYGISSDIQALADRAHAKGALLMVDSTLAPPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQN WDF  DIIMHSATKYFGGHSDLL+G+LV K++ V+ QL+ DRIYLGT   NLESF+
Sbjct: 181 LQNTWDFGPDIIMHSATKYFGGHSDLLAGILVTKDKDVSIQLKGDRIYLGTIPGNLESFL 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLRT EMR+LKQSENATKIV +L  N++ +DKVL  I HSSLQ E FV  Q+ GGY 
Sbjct: 241 LLRSLRTMEMRVLKQSENATKIVQYLVDNKETFDKVLGEIYHSSLQDEPFVAAQMSGGYT 300

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           P+FS  L   +Q K FP  LK F HATSLGGIESL+EWR +++P ++QTL+R+S+GCEN 
Sbjct: 301 PLFSFKLQTIDQAKHFPEKLKIFQHATSLGGIESLIEWRVLSEPELDQTLLRISVGCENV 360

Query: 361 DDLIQDLANALETLQKESS 379
           DDLI DL NAL+  QKE +
Sbjct: 361 DDLIADLQNALQQAQKEEA 379

>ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 373

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/374 (63%), Positives = 299/374 (79%), Gaps = 1/374 (0%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M  L T L+H DD+ NRV+DVAPPINV +TFRYDND+L+PW ++ NLDF+++ P+YSR  
Sbjct: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPN  RLE++FS  L GHA+ YS GL  F   M+H+NPKR+F+ Q YHGV+ I  IL RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
           +  +++ L +IE+ AQ GDIVH+ETP+NPFGTSLD+ + A++AH KGALL+VDSTFAPPP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQN WDF  D+IMHSATKYF GHSDLLSGVLVVK++ VA +L++DRIYLG+N+ANLES++
Sbjct: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLRT+++R+ +Q+ENATK+V +L+ ++DKY   L  + HSSLQ E FVKKQL GGY 
Sbjct: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYT 299

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVFS++   +EQCKKF   LK F HATSLGG+ESLVEWRAM D  I+Q L+RVSIGCE+A
Sbjct: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 DDLIQDLANALETL 374
           DDLI DL+  L  L
Sbjct: 360 DDLINDLSTVLSQL 373

>TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/379 (63%), Positives = 311/379 (82%), Gaps = 1/379 (0%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTEREN-LDFMEKTPIYSRL 59
           M HL+T LIHSDDK+NRV+DVAPPINV++TFRYDN++L+P  E ++ L  +E++P+YSR 
Sbjct: 1   MVHLATTLIHSDDKNNRVTDVAPPINVSSTFRYDNNNLIPANEVDDFLASIEQSPVYSRE 60

Query: 60  AHPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTR 119
           +HPNS+R++SI S++L GHAVIY+SG +AF A M HYNPKR F+   Y GV AIA+++TR
Sbjct: 61  SHPNSSRVQSILSDLLGGHAVIYNSGCSAFHAVMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NFQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPP 179
           N+  +QH+LDEIE+FAQPGD+VHLE+P+NPFGT+ D++  A + H KGA+L +DST APP
Sbjct: 121 NYGLEQHSLDEIEEFAQPGDLVHLESPLNPFGTASDIKALADRVHSKGAILSIDSTLAPP 180

Query: 180 PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESF 239
           PLQNVW+F  DI++HSATKYFGGHSDLL+GVL VK +  A +L +DRI+LGTN+ NLES+
Sbjct: 181 PLQNVWNFGADIVLHSATKYFGGHSDLLAGVLAVKTKEQANELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGY 299
           +LLRSLRT+EMR++KQS+NATKIV +L ++++     LK I H+SLQ ESF+ KQL GG+
Sbjct: 241 LLLRSLRTYEMRIMKQSDNATKIVKYLHNHKESLKGSLKEIFHTSLQNESFINKQLSGGH 300

Query: 300 GPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCEN 359
           G VFSI L +  QCKK P  LKYF HATSLGGIESL+EWRAM+D  I+Q LIRVS+GCEN
Sbjct: 301 GAVFSIILNSINQCKKLPLHLKYFQHATSLGGIESLIEWRAMSDDKIDQCLIRVSVGCEN 360

Query: 360 ADDLIQDLANALETLQKES 378
            +DLI+DL NAL T+ K+S
Sbjct: 361 VEDLIKDLENALLTVAKQS 379

>NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/378 (62%), Positives = 311/378 (82%), Gaps = 1/378 (0%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTE-RENLDFMEKTPIYSRL 59
           MAHLSTALIH DDK NRV+DVAPPINV+TTFR+DN++L+P  E ++ L  +++ P+Y+R 
Sbjct: 1   MAHLSTALIHGDDKLNRVTDVAPPINVSTTFRFDNNNLIPANEVKDFLQSIDENPVYARE 60

Query: 60  AHPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTR 119
           +HPNS+R++++ S++L GHAVIY+SG +AF A M HYNPKR F+   Y GV AIA+++TR
Sbjct: 61  SHPNSSRVQAVLSDLLGGHAVIYNSGCSAFHALMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NFQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPP 179
           N+  +QH+LDEIE+FAQ GDIVHLETP+NPFGTS D+E  AK+ H+KGA+L +D+T APP
Sbjct: 121 NYGLEQHSLDEIEEFAQAGDIVHLETPLNPFGTSSDIEALAKRVHDKGAILSIDATLAPP 180

Query: 180 PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESF 239
           PLQ+ W F  DII+HSATKYFGGHSDLL+GVLVVK +  A +L +DRI+LGTN+ NLES+
Sbjct: 181 PLQDAWKFGADIILHSATKYFGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGY 299
           +LLRSLRT+EMR++KQ  N  K++++L+ N+ K++KVL  I HSSLQ + FV+KQL G Y
Sbjct: 241 LLLRSLRTYEMRIMKQENNTRKVITYLNENKSKFNKVLNKIYHSSLQDDDFVQKQLSGLY 300

Query: 300 GPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCEN 359
            PVF+I+L + +QCK+ P  LKYF HATSLGG+ESL+EWRAM+D  I+Q LIRVSIGCEN
Sbjct: 301 CPVFAITLHSIDQCKELPLYLKYFQHATSLGGVESLIEWRAMSDSDIDQCLIRVSIGCEN 360

Query: 360 ADDLIQDLANALETLQKE 377
           ADDLI+DL NAL+ LQ +
Sbjct: 361 ADDLIKDLENALQILQNK 378

>ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 373

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 231/374 (61%), Positives = 298/374 (79%), Gaps = 1/374 (0%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M  L+T L+H DD+ NRV+DVAPPINV +TFRYDND+LVPW +  NLD +++ P+YSR  
Sbjct: 1   MVDLATLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLVPWRDITNLDCLDEYPVYSREG 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPN  RLE++FS  L GHAV YS GL  F +AM+H+NPKR+F+ Q YHGV+ I  I+ RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAVCYSCGLGGFLSAMVHFNPKRVFMDQCYHGVQGIVGIMKRN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
           +  +++ L +IE+ AQ GDIVH+ETP+NPFGTSLD+ + A++AH KGALL+VDSTFAPPP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHAKGALLMVDSTFAPPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQN WDF  D+IMHSATKYFGGHSDLLSGVLVVK++  A +L++DRI LG+N++NL+S++
Sbjct: 181 LQNAWDFGADMIMHSATKYFGGHSDLLSGVLVVKDKETASKLKEDRICLGSNISNLDSYL 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLRT+++R+ +QSE+ATKIV +L+ +++ +   L  + HSSLQ + FVKKQL GGYG
Sbjct: 241 LLRSLRTYDLRIKRQSESATKIVQYLNDHKNDF-PALDKLYHSSLQSDDFVKKQLSGGYG 299

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVFS++L  +EQCKKF   LK F HATSLGG+ESLVEWRAM D  I+Q L+RVSIGCE+A
Sbjct: 300 PVFSLTLKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 DDLIQDLANALETL 374
           +DL  DL   L  L
Sbjct: 360 EDLTNDLTTVLSQL 373

>TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  509 bits (1310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 234/376 (62%), Positives = 297/376 (78%), Gaps = 1/376 (0%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTEREN-LDFMEKTPIYSRL 59
           M HLSTA IH+DD  NRV+DVAPPINV+TTFRYDN++LVP  E EN ++ +E+TP+YSR 
Sbjct: 1   MTHLSTACIHADDIHNRVTDVAPPINVSTTFRYDNENLVPEVEIENFIETIEQTPVYSRE 60

Query: 60  AHPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTR 119
           +HPNS RL+++ S+IL GHA +Y+SG++AF A + HYNPKR F+   Y GVR IA +   
Sbjct: 61  SHPNSLRLQTVLSDILGGHATVYNSGVSAFHALIFHYNPKRFFMDDGYSGVRGIATLYQE 120

Query: 120 NFQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPP 179
               + + L +IE+FA+ GD++HLE P+NP+GT  D+   AK+ H+KGA+L +DST APP
Sbjct: 121 KHGLETYKLHQIEEFAEKGDLIHLEVPLNPYGTCRDIAALAKRVHKKGAILSIDSTLAPP 180

Query: 180 PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESF 239
           PLQ+ WDF  D++MHSATKY GGHSDLL+GV+VVK     R+L  +RI+LGTNV NLESF
Sbjct: 181 PLQDAWDFGADVVMHSATKYLGGHSDLLAGVVVVKTMEQQRKLIRERIFLGTNVGNLESF 240

Query: 240 MLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGY 299
           +LLRSLRTFEMR+LKQSENA KIVSFL  N+ KY KVL  + HSSLQKE+FV++QL GG+
Sbjct: 241 LLLRSLRTFEMRVLKQSENAAKIVSFLHENKAKYSKVLNEVYHSSLQKEAFVQRQLAGGH 300

Query: 300 GPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCEN 359
           G VFS++L + EQCKK P  L YF HATSLGG+ESL+EWRA++D  I+  L+R+SIGCEN
Sbjct: 301 GAVFSVTLRSVEQCKKLPAKLVYFQHATSLGGVESLIEWRALSDTKIDPFLVRLSIGCEN 360

Query: 360 ADDLIQDLANALETLQ 375
           ADDLIQDL NAL+ LQ
Sbjct: 361 ADDLIQDLDNALQVLQ 376

>Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AER250C
          Length = 381

 Score =  499 bits (1286), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 231/381 (60%), Positives = 301/381 (79%), Gaps = 1/381 (0%)

Query: 1   MAHLSTALIHSDDK-DNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRL 59
           MA LST LIH+DD   + V+DVAPPINV+TTFRYDND+LV      +    E  P+YSR 
Sbjct: 1   MAGLSTLLIHADDGVSDHVTDVAPPINVSTTFRYDNDNLVLPEGDCDGYATEGAPVYSRE 60

Query: 60  AHPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTR 119
            HPNS R  SI S  L+G+AV Y+SGL+AF AA+ HYNPKR+FIGQSYHG   +A+I  R
Sbjct: 61  GHPNSNRCGSILSHALNGYAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWVR 120

Query: 120 NFQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPP 179
           N+   +  LDEIE+ AQPGD+VH+E+P+NP+GT++D+E++  K H+KGA++++DSTFAPP
Sbjct: 121 NYGLLKLGLDEIEERAQPGDMVHIESPMNPYGTAVDIEEYVSKGHKKGAIVMIDSTFAPP 180

Query: 180 PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESF 239
           PLQN W+F VDI+MHS TKY GGHSDLL GVLVVK++AV RQL  DRIYLGTN+ANL+S+
Sbjct: 181 PLQNAWEFGVDILMHSCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDSY 240

Query: 240 MLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGY 299
           +L+RSLRT E+R++KQS+ ATK+V++L  +  ++  VL  I H+SLQ+E FVKKQL GG+
Sbjct: 241 LLIRSLRTLELRVMKQSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQEEFVKKQLAGGH 300

Query: 300 GPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCEN 359
            PVFSI L   +QC++ P  LK+FHHATS GG+ESL+EWRA++DP IE+TL+RVS+GCE+
Sbjct: 301 TPVFSIMLKTVDQCRELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCED 360

Query: 360 ADDLIQDLANALETLQKESSN 380
            +DLI DLANAL  LQ + +N
Sbjct: 361 HNDLINDLANALRYLQTQVTN 381

>TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  494 bits (1271), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 289/380 (76%), Gaps = 1/380 (0%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTEREN-LDFMEKTPIYSRL 59
           M HLST  IH+DD  NRVSDVAPPINVTTTFR+DND+L+P  E EN ++ +E++P+Y+R 
Sbjct: 1   MTHLSTTSIHADDIHNRVSDVAPPINVTTTFRFDNDNLIPEAELENFIEAIEESPVYARE 60

Query: 60  AHPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTR 119
            HPNS R++SI S IL GHA +Y+SG +AF A M   NPKR+F+  +Y GV  IA+++  
Sbjct: 61  THPNSIRVQSILSSILGGHAAVYNSGCSAFHALMFRLNPKRVFMDDAYGGVETIASLIKE 120

Query: 120 NFQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPP 179
            +  K   LD+IE+FA+ GD+VHLETP+NPFG   ++   A++ H+KGALL VDST APP
Sbjct: 121 KYGLKIFKLDQIEEFAEKGDLVHLETPLNPFGICTNIVALAERVHKKGALLSVDSTLAPP 180

Query: 180 PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESF 239
           PLQN WDF  DI+MHSATKY GGHSDLL+GVLVVK+    R L  +RIYLGTN+ NLESF
Sbjct: 181 PLQNAWDFGADIVMHSATKYLGGHSDLLAGVLVVKDVETQRALIKERIYLGTNLGNLESF 240

Query: 240 MLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGY 299
           +LLRSLRTFEMR+ KQSENA K+V+FL  N  KY KVL  + HSSLQKE FV+KQL GG+
Sbjct: 241 LLLRSLRTFEMRVTKQSENALKVVTFLHENSAKYPKVLDQLYHSSLQKEEFVQKQLAGGH 300

Query: 300 GPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCEN 359
           G VFS+ L + EQ KK P  L YF HATSLGG+ESL+EWRAM+D  I+  L+R+S+GCEN
Sbjct: 301 GAVFSMILKSVEQAKKLPTKLVYFQHATSLGGVESLIEWRAMSDSTIDPCLVRLSVGCEN 360

Query: 360 ADDLIQDLANALETLQKESS 379
            DDLIQDL   L+ LQ  ++
Sbjct: 361 VDDLIQDLDQGLQALQNAAA 380

>TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa]
           {ON}  YFR055W
          Length = 373

 Score =  483 bits (1244), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 221/365 (60%), Positives = 294/365 (80%), Gaps = 1/365 (0%)

Query: 17  RVSDVAPPINVTTTFRYDNDDLVPWTE-RENLDFMEKTPIYSRLAHPNSTRLESIFSEIL 75
           ++SD+APPINV+TT+RYD  +L+P  E ++ L  +E+ P+YSR +H NS+R++ + S++L
Sbjct: 8   KISDIAPPINVSTTYRYDEHNLIPAAEVKDFLSSIEENPVYSRESHANSSRVQKVLSKVL 67

Query: 76  DGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRNFQTKQHTLDEIEQFA 135
           +GHAVIY+SG +AF A M HYNPKRIF  +SY G++AIAN++TRN+  KQ++L +I++FA
Sbjct: 68  NGHAVIYNSGCSAFHALMCHYNPKRIFFDESYFGIKAIANLITRNYGLKQYSLKDIDKFA 127

Query: 136 QPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHS 195
           Q GDI+H+ETP+NPFGT++++++ A KAH K ALL VDST APPPLQN +DF  DI++HS
Sbjct: 128 QEGDIIHIETPLNPFGTAINIKEIAVKAHAKKALLSVDSTLAPPPLQNAFDFGADIVLHS 187

Query: 196 ATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQ 255
           ATKY GGHSDLL+GVLVVK E  AR L +DRI+LGTN+ NLESF+LLRSLRT+EMR+  Q
Sbjct: 188 ATKYLGGHSDLLAGVLVVKTEKEARALIEDRIHLGTNIGNLESFLLLRSLRTYEMRLSTQ 247

Query: 256 SENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYGPVFSISLMNKEQCKK 315
           S+N  KIV+FL++NR +Y  V++ I HSSLQKE FV +QL  G+  VF++   ++EQCK 
Sbjct: 248 SQNVVKIVNFLETNRCQYKNVIQHIYHSSLQKEVFVSEQLSKGHTAVFAVIFKSQEQCKN 307

Query: 316 FPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADDLIQDLANALETLQ 375
           F   LKYF HATSLGG+ESLVEWRAM+DP I+  LIR SIGCENA+DLI+DL +AL  L+
Sbjct: 308 FVQYLKYFQHATSLGGVESLVEWRAMSDPDIDPCLIRFSIGCENAEDLIEDLKSALCRLE 367

Query: 376 KESSN 380
           KE+ N
Sbjct: 368 KENIN 372

>AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR112C
          Length = 374

 Score =  478 bits (1229), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 210/374 (56%), Positives = 286/374 (76%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M  L T+LIH+DD  NRV+DVAPPINVTTTFRY  DDL+P  ER           YSR++
Sbjct: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPN  R E + +E L G AV+YSSGLAAF AA+ H+NPKR+FIG+ YHG   +A+I  RN
Sbjct: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
              ++ +L+E+ + ++PGD+VH+E+P+NP+GT +D+   A  AHEKGA +++D+TFAPPP
Sbjct: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVAGIAAAAHEKGAYVVLDATFAPPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           LQ+ W+   D+++HS TKYFGGHSDLL GV  V++ AVARQLR DR+YLGTN+ANLE+++
Sbjct: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           L+RS+RT EMR+++QS +ATK+V++L+S++ ++  VL  + HSSLQ E +V++ L+GG  
Sbjct: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVFSI L   EQCK+ P +LK FHHATSLGG+ESL+EWRAM+D  +EQ L+R+S+GCE+ 
Sbjct: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360

Query: 361 DDLIQDLANALETL 374
           +DLI DLA A   L
Sbjct: 361 EDLIADLAGAFRQL 374

>KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38716 Saccharomyces cerevisiae YHR112C
           Hypothetical ORF
          Length = 381

 Score =  464 bits (1194), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 220/376 (58%), Positives = 282/376 (75%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           M   STA IH DD+ NRVSDVAPPINV+TTFRYD++ L P T        +   IYSRL 
Sbjct: 1   MPFSSTATIHGDDRLNRVSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLG 60

Query: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120
           HPN+ RLE + +EILDG  V+Y+SGLAA+ A +IH NPKR+F    YHG  A+A I++R 
Sbjct: 61  HPNADRLEVVLTEILDGPTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRI 120

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180
              +   L+ +E   Q GD+VHLE P NP+G  ++L++FA+K H  GAL+LVDST APPP
Sbjct: 121 SGMEILPLENLEDKCQSGDLVHLEDPGNPYGEVVNLDEFAEKIHRAGALMLVDSTLAPPP 180

Query: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240
           L+N W+F  DI+MHS TKYFGGHSDLLSG++ V++E VA+QLR+DR YLGT  A+LES++
Sbjct: 181 LRNTWEFGADIVMHSGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYL 240

Query: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300
           LLRSLRT E+R+LKQS N T++V +L S++D+Y+ V+K I H+SLQKE FVKKQL GGYG
Sbjct: 241 LLRSLRTMEIRVLKQSSNCTRLVEYLASHKDRYNSVVKDIRHASLQKEEFVKKQLPGGYG 300

Query: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360
           PVFS+ L ++EQCK        F HATSLGG ESL+EWRAM+DP+  + LIRVS+G ENA
Sbjct: 301 PVFSLLLFSQEQCKLLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLENA 360

Query: 361 DDLIQDLANALETLQK 376
           +DLI+DLA  LE ++K
Sbjct: 361 EDLIEDLAGTLEKIEK 376

>NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}
          Length = 378

 Score =  464 bits (1193), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 219/378 (57%), Positives = 295/378 (78%), Gaps = 1/378 (0%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTE-RENLDFMEKTPIYSRL 59
           M HLST LIH DDK NRV+ VAPPINV+TTFR+D+++L+P  E ++ L  +++ P+Y++ 
Sbjct: 1   MVHLSTTLIHGDDKLNRVTYVAPPINVSTTFRFDSNNLIPANEVKDFLQSIDENPVYAKE 60

Query: 60  AHPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTR 119
           ++PNS+R++++ S++L GHAVIY+SG + F A M HYNPKR F+   Y GV AIA++LTR
Sbjct: 61  SYPNSSRVQAVLSDLLGGHAVIYNSGCSFFHALMCHYNPKRFFMDGGYFGVHAIADLLTR 120

Query: 120 NFQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPP 179
           N+  +Q  LDEIE+FAQ GDIVHLETP+NPFGTS D+E   ++ H KGA+L +D+T A P
Sbjct: 121 NYGLEQQFLDEIEEFAQAGDIVHLETPLNPFGTSSDMEALGERVHTKGAILSIDATLASP 180

Query: 180 PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESF 239
           PLQ+ W F  DII+HSATKY GGHSDLL+GVLVVK +  A +L +DRI+LGTN+ NLES+
Sbjct: 181 PLQDAWKFGADIILHSATKYSGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 MLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGY 299
           +LLR L T+EMR++KQ +N  K++ +L+ N+ K++KV+  I HSS Q + F++KQL G Y
Sbjct: 241 LLLRLLSTYEMRIMKQEKNTRKVIIYLNENKSKFNKVVNKIYHSSSQDDDFIQKQLSGLY 300

Query: 300 GPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCEN 359
            PVF+I+L + +QCK+ P  LKYF HATSLG  ESL+EWRA++D  I+Q LI VSIGCEN
Sbjct: 301 CPVFAITLHSIDQCKELPLHLKYFQHATSLGAAESLIEWRAVSDVDIDQCLIGVSIGCEN 360

Query: 360 ADDLIQDLANALETLQKE 377
           ADDLI+DL NAL+ LQ +
Sbjct: 361 ADDLIKDLENALQILQNK 378

>Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR112C
           - Hypothetical ORF [contig 697] FULL
          Length = 380

 Score =  457 bits (1177), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 204/372 (54%), Positives = 284/372 (76%)

Query: 5   STALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPNS 64
           +T  IHSDD  NRVSDVAPPINV+TTFRYDN+ LVP T    +   +   IYSRL HPN+
Sbjct: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64

Query: 65  TRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRNFQTK 124
            RLE++ S++LD HAV+Y+SGLAA+ A ++H+ PKR+F+   YHG + +A I++R    +
Sbjct: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124

Query: 125 QHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNV 184
             +L++IE   Q GD+VH+E P+NPFG ++DL  +A + H  G L+++DST  PPPL+N 
Sbjct: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184

Query: 185 WDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRS 244
           WD+  DIIMHS TKYFGGHSDLLSG++ V +EA+A QL++DR YLGT  A+LESF+LLRS
Sbjct: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFLLLRS 244

Query: 245 LRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYGPVFS 304
           LRT ++R+ +QS+N T++VS+L +N +K+  V++ I H+SLQ E+FVK+Q+ GG+GPVF+
Sbjct: 245 LRTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304

Query: 305 ISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADDLI 364
           + L +++QC+K    + +F HATSLGG+ESL+EWRAM+DP   +TLIRVS+G EN +DLI
Sbjct: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLI 364

Query: 365 QDLANALETLQK 376
            DLA +LE + K
Sbjct: 365 ADLAGSLEKINK 376

>NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {ON}
           Anc_7.97 YAL012W
          Length = 429

 Score =  140 bits (354), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 124/402 (30%), Positives = 196/402 (48%), Gaps = 46/402 (11%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTF+         +    +   E    YSR  +PN
Sbjct: 46  FATKAIHAGTHTDVHGSVIEPISLSTTFKQS-------SPANPVGIYE----YSRSQNPN 94

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR----AIAN 115
              LE+  + + +G + + +SSG +A  A ++   P+    I IG  Y G       +AN
Sbjct: 95  RENLENAIAALENGKYGLAFSSG-SATTATVLQSLPQGSHAISIGDVYGGTHRYFTKVAN 153

Query: 116 ILTRNFQTKQHTLDEIEQFAQPG-DIVHLETPVNPFGTSLDLEDFAK--KAHEKGALLLV 172
                       L E+    +    +V +E+P NP     D++  A   K+  K  +L+V
Sbjct: 154 AHGVETTFTNDLLKELPNLVKENTKLVWIESPTNPTLKVTDIQAVADAIKSLNKDIILVV 213

Query: 173 DSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN 232
           D+TF  P L N  DF  DI++HSATKY  GHSD++ GVL   ++A+  +L+  +  +G  
Sbjct: 214 DNTFLSPYLSNPLDFGADIVVHSATKYINGHSDVVLGVLATNDKALYEKLQFLQNAIGAI 273

Query: 233 VANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSL---QKES 289
            +  +S++  R L+T  +R+ + S NATKI  FL S+      ++K++ +  L   +  +
Sbjct: 274 PSPFDSWLAHRGLKTLHLRVRQASLNATKIAQFLQSS-----PLVKAVNYPGLPTHENYA 328

Query: 290 FVKKQLK---GGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDPY 345
            V+KQ +   GG    F I     E   KF    + F  A SLGGIESL+E  A MT   
Sbjct: 329 VVQKQHREALGGGMISFRIQ-GGSEAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 387

Query: 346 IEQT----------LIRVSIGCENADDLIQDLANALETLQKE 377
           I +           L+R+S+G E+ DDL+ D+  ALE   K+
Sbjct: 388 IPKEAREASGVYDDLVRLSVGIEDGDDLLDDIKQALEIAAKK 429

>NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {ON}
           Anc_7.97
          Length = 393

 Score =  138 bits (348), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 125/396 (31%), Positives = 190/396 (47%), Gaps = 44/396 (11%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTF+  +    P    E          YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFK-QSAPAQPIGTYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLA--AFFAAMIHYNPKRIFIGQSYHGV-RAIANILTR 119
              LE+  + + +G + + +SSG A  A     +  N   I IG  Y G  R    +   
Sbjct: 58  RENLENAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFTKVANA 117

Query: 120 NFQTKQHTLDEIEQF----AQPGDIVHLETPVNPFGTSLDLEDFAK--KAHEKGALLLVD 173
           +      T D I+       +   +V +E+P NP     D+E  +K  K+  K  LL+VD
Sbjct: 118 HGVETTFTNDLIKDLPNLVKENTKLVWIESPTNPTLKVTDIEAVSKSIKSLNKDILLVVD 177

Query: 174 STFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNV 233
           +TF  P L N  +F  DI++HSATKY  GHSD++ GVL    + +  +L+  +  +G   
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNQEIYERLQFLQNAVGAIP 237

Query: 234 ANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSL---QKESF 290
           +  +S++  R L+T  +R+ + S  ATKI  FL +N +     +K++ +  L   +    
Sbjct: 238 SPFDSWLTHRGLKTLHLRVRQASLTATKIAEFLSTNPN-----VKAVNYPGLPTHENYDI 292

Query: 291 VKKQLK---GGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDPYI 346
           VKKQ +   GG    F I+    E   KF    + F  A SLGGIESL+E  A MT   I
Sbjct: 293 VKKQHREALGGGMISFRIN-GGSEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 347 EQT----------LIRVSIGCENADDLIQDLANALE 372
            +           LIR+S+G E+A DL+ D+  ALE
Sbjct: 352 PKESREASGVYDDLIRLSVGIEDAGDLLDDIKQALE 387

>CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012w CYS3
          Length = 391

 Score =  137 bits (344), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 119/397 (29%), Positives = 197/397 (49%), Gaps = 46/397 (11%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+   ++    V  PI+++TTF+  ++   P    E          YSR  +PN
Sbjct: 9   FATKAIHAGAHEDIHGSVIEPISLSTTFK-QSEPAKPIGTYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR----AIAN 115
              LE+  + +  G + + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RENLEAAIASLEGGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNFQTKQHTLDEIEQFAQPG-DIVHLETPVNPFGTSLDLEDFAK--KAHEKGALLLV 172
               +     + ++++ +  +    +V +E+P NP     D++  A+  K   K  LL+V
Sbjct: 117 AHGVDTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLKVTDIQLVAENVKKINKDILLVV 176

Query: 173 DSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN 232
           D+TF  P L N   F  DI++HSATKY  GHSD++ GVL    + +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAIGCI 236

Query: 233 VANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKE---S 289
            +  ++++  R L+T  +R+ + S NATKI +FL+SN +     + ++ +  LQ      
Sbjct: 237 PSPFDAWLTHRGLKTLHLRVRQASLNATKIATFLESNEN-----VVAVNYPGLQSHPNYD 291

Query: 290 FVKKQLK---GGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDPY 345
            VKKQ +   GG    F I     E   KF    + F  A SLGGIESL+E  A MT   
Sbjct: 292 VVKKQHREALGGGMISFRIK-GGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 346 IEQT----------LIRVSIGCENADDLIQDLANALE 372
           I +           L+R+S+G E+ +DL++D+  AL+
Sbjct: 351 IPKEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQ 387

>Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON}
           (19232..20407) [1176 nt, 392 aa]
          Length = 391

 Score =  136 bits (343), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 123/397 (30%), Positives = 198/397 (49%), Gaps = 46/397 (11%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTF+  +    P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFK-QSAPAQPIGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR----AIAN 115
              LE   + + +G + + +SSG +A  + ++   P+    + IG  Y G       +AN
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSG-SATTSVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNFQTKQHTLDEIEQFAQPGD-IVHLETPVNPF--GTSLDLEDFAKKAHEKGALLLV 172
                     + ++E+ Q  +    +V +E+P NP    T + L     K+ +K  +L+V
Sbjct: 117 THGVETTFTNNLVEELPQLIKENTRLVWIESPTNPTLKVTDIGLVSQTIKSLKKDIILVV 176

Query: 173 DSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN 232
           D+TF  P L N  +F  DI++HSATKY  GHSD++ GVL   ++ +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKDIYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSL-QKESF- 290
            +  +S+++ R L+T  +R+ + + NATKI  FL SN +     + ++ +  L   E+F 
Sbjct: 237 PSPFDSWLVHRGLKTLHLRVRQAALNATKIAEFLASNEN-----VIAVNYPGLPSSENFE 291

Query: 291 -VKKQLK---GGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDPY 345
            VKKQ +   GG    F I     E   KF    + F  A SLGGIESL+E  A MT   
Sbjct: 292 VVKKQHRDALGGGMISFRIK-GGAEAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 346 IEQT----------LIRVSIGCENADDLIQDLANALE 372
           I +           LIR+S+G E++DDL+ D+  AL+
Sbjct: 351 IPKEQREASGVFDDLIRLSVGIEDSDDLLDDIKQALQ 387

>ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  135 bits (341), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 121/398 (30%), Positives = 193/398 (48%), Gaps = 46/398 (11%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTF+  +    P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHVDVHGSVIEPISLSTTFK-QSAPAQPLGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR----AIAN 115
              LE   + + +G H + +SSG +A  A ++   P+    I IG  Y G       +AN
Sbjct: 58  RKNLEDAIASLENGKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNFQTKQHTLDEIEQFAQPG-DIVHLETPVNPFGTSLDLEDFAKKAHE--KGALLLV 172
               +       + ++    +P   ++ +E+P NP     D+    K   E  K  L++V
Sbjct: 117 AHGVDVSFTNELVKDLPSLVKPNTKLLWIESPTNPTLQVTDIALVNKTVKELNKDILVVV 176

Query: 173 DSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN 232
           D+TF  P L N  DF VD+++HSATKY  GHSD++ GVL      +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLDFGVDVVVHSATKYINGHSDVVLGVLATNSTELYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQ---KES 289
            +  ++++  R L+T  +R+ + +  ATKI  FL SN    D+V+ ++ +  L       
Sbjct: 237 PSPFDAWLAHRGLKTLHLRVRQAATTATKIAEFLQSN----DRVI-AVNYPGLASHPSHD 291

Query: 290 FVKKQLKGGYGPVFSISLMNK---EQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDPY 345
            V++Q + G G    IS   K   E   KF    + F  A SLGGIESL+E  A MT   
Sbjct: 292 VVQRQHRDGLGGGM-ISFRIKGGAEGAAKFSSNTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 346 IEQ----------TLIRVSIGCENADDLIQDLANALET 373
           I +           LIR+S+G E+ +DL++D+  AL++
Sbjct: 351 IPEDQREASGVYDDLIRLSVGIEDTEDLLEDIKQALKS 388

>KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  135 bits (340), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 124/396 (31%), Positives = 191/396 (48%), Gaps = 42/396 (10%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTF+  +    P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGTHVDVHGSVIEPISLSTTFK-QSAPAQPIGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR----AIAN 115
              LE   + + +G + + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNFQTKQHTLDEIEQFAQPG-DIVHLETPVNPFGTSLDLEDFAKKAHE--KGALLLV 172
                     + + E+    +    +V +ETP NP     D+E  AK A    K  LL+V
Sbjct: 117 AHGVETTFTNNLVAELPSLIKENTKLVWIETPTNPTLKVTDIELVAKTAKSINKDILLVV 176

Query: 173 DSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN 232
           D+TF  P L N  +F  DI++HSATKY  GHSD++ GVL   ++ +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKVIYEKLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSI-THSSLQKESFV 291
            +  +S+++ R ++T  +R+ + S +A KI  FL SN +        + TH S    + V
Sbjct: 237 PSPFDSWLVHRGVKTLHLRVRQASLSAHKIAEFLSSNENVIAVNYPGLPTHESY---AVV 293

Query: 292 KKQLK---GGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDPYIE 347
           KKQ +   GG    F I     E    F    + F  A SLGGIESL+E  A MT   I 
Sbjct: 294 KKQHRDALGGGMISFRIK-GGAEAASTFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 348 QT----------LIRVSIGCENADDLIQDLANALET 373
           +           L+R+SIG E+ DDL++D+  AL +
Sbjct: 353 KEQREASGVYDDLVRLSIGIEDTDDLLEDIKQALAS 388

>KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7.97
           YAL012W
          Length = 392

 Score =  133 bits (335), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 120/397 (30%), Positives = 192/397 (48%), Gaps = 46/397 (11%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTFR  +    P    E          YSR  +PN
Sbjct: 9   FATKAIHAGAHVDVHGSVIEPISLSTTFR-QSAPAQPIGTYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR----AIAN 115
              LE   + + +G + + +SSG +A  A ++   P+    I IG  Y G       +AN
Sbjct: 58  RENLEVAIASLENGKYGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNFQTKQHTLDEIEQFAQPG-DIVHLETPVNPFGTSLDLEDFAKKAHE--KGALLLV 172
                       L+++ +  +    +V +E+P NP     D+E  ++K     K  LL+V
Sbjct: 117 AHGVETSFTNDLLNDLPKLVKENTKLVWIESPTNPTLKITDIEAVSQKVKSLNKDILLVV 176

Query: 173 DSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN 232
           D+TF  P L N  +F  DI++HSATKY  GHSD++ GVL    + +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKDIYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSL---QKES 289
            +  ++++  R LRT  +R+ + S +A KI  FL +N +     ++++ +  L   +   
Sbjct: 237 PSPFDAWLTHRGLRTLHLRVRQASLSAQKIAEFLQNNEN-----VEAVNYPGLPTHKDYD 291

Query: 290 FVKKQLK---GGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDPY 345
            VKKQ +   GG    F I     E   KF    + F  A SLGG+ESL+E  A MT   
Sbjct: 292 VVKKQHREALGGGMISFRIK-GGAEAAAKFSSSTRLFALAESLGGVESLLEVPAVMTHGG 350

Query: 346 IEQ----------TLIRVSIGCENADDLIQDLANALE 372
           I +           L+R+S+G E+ DDL++D+  ALE
Sbjct: 351 IPKEAREASGVYDNLVRLSVGIEDGDDLLEDVKQALE 387

>SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {ON}
           highly similar to uniprot|P31373 Saccharomyces
           cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
           catalyzes one of the two reactions involved in the
           transsulfuration pathway that yields cysteine from
           homocysteine with the intermediary formation of
           cystathionine
          Length = 392

 Score =  133 bits (334), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 124/401 (30%), Positives = 191/401 (47%), Gaps = 46/401 (11%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHTDVHGSVIEPISLSTTFK-QTAPAQPVGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGV-RAIANILT 118
              LE   + + +  + + +SSG +A  A ++   P+    + IG  Y G  R    +  
Sbjct: 58  RKNLEDAVAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 119 RNFQTKQHTLDEIEQFAQ----PGDIVHLETPVNPFGTSLDLEDFAK--KAHEKGALLLV 172
            +      T + +E  AQ       +V +E+P NP     D+E  +K  K+  K  LL+V
Sbjct: 117 AHGVETTFTNNLVEDLAQLVKENTRLVWIESPTNPTLKVTDIELVSKTIKSINKDILLVV 176

Query: 173 DSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN 232
           D+TF  P L N  +F  DI++HSATKY  GHSD++ GVL   ++ +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKEIYERLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSL---QKES 289
            +  ++++  R L+T  +R+ + +  ATKI  FL  + D     + ++ +  L      +
Sbjct: 237 PSPFDAWLSHRGLKTLHLRVRQAATTATKIAEFLSQSED-----VVAVNYPGLPTHPNHN 291

Query: 290 FVKKQLKGGYGPVFSISLMNK---EQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDPY 345
            V KQ + G G    IS   K   E   KF    + F  A SLGGIESL+E  A MT   
Sbjct: 292 VVLKQHRDGLGGGM-ISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 346 IEQ----------TLIRVSIGCENADDLIQDLANALETLQK 376
           I +           LIR+SIG E+ DDL+ D+  ALE   K
Sbjct: 351 IPKDQREASGVFDDLIRLSIGIEDTDDLLDDIKQALEVAAK 391

>TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97
           YAL012W
          Length = 391

 Score =  132 bits (332), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 122/396 (30%), Positives = 190/396 (47%), Gaps = 44/396 (11%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTF+  +    P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFK-QSAPAEPIGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLA--AFFAAMIHYNPKRIFIGQSYHGVR----AIANI 116
              LE   + + +G + + +SSG A  A     +  N   I IG  Y G       +AN 
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFSKVANT 117

Query: 117 LTRNFQTKQHTLDEIEQFAQPGD-IVHLETPVNPFGTSLDLEDFAK--KAHEKGALLLVD 173
              +       + ++ +  +    +V +E+P NP     D+E  AK  K+  K  LL+VD
Sbjct: 118 HGVDTDFTNDLVADLPKLVKENTRLVWIESPTNPTLKVTDIELVAKTIKSLNKDILLVVD 177

Query: 174 STFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNV 233
           +TF  P L N  +F  DI++HSATKY  GHSD++ GVL      +  +L+  +  +G   
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSRDIYERLQFLQNAVGAIP 237

Query: 234 ANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKE---SF 290
           +  ++++  R L+T  +R+ + + NATKI  FL     + D V+ ++ +  L      + 
Sbjct: 238 SPFDAWLTHRGLKTLHLRVRQAALNATKIAEFL----AQSDNVV-AVNYPGLPTNPDYAI 292

Query: 291 VKKQLKGGYGPVFSISLMNK---EQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDPYI 346
           VKKQ +   G    IS   K   E   KF    + F  A SLGGIESL+E  A MT   I
Sbjct: 293 VKKQHRDALGGGM-ISFRVKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 347 EQT----------LIRVSIGCENADDLIQDLANALE 372
            +           L+R+S+G E+ DDL++D+  AL+
Sbjct: 352 PKEQREASGVFDDLVRLSVGIEDGDDLLEDVKAALQ 387

>TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {ON}
           Anc_7.97 YAL012W
          Length = 391

 Score =  130 bits (328), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 119/400 (29%), Positives = 191/400 (47%), Gaps = 44/400 (11%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTF+  +    P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHVDIHGSVIEPISLSTTFK-QSSPAAPLGEYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGV-RAIANILT 118
              LE   + + +  + + +SSG +A  A ++   P+    + IG  Y G  R    +  
Sbjct: 58  RKNLEEALAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 119 RNFQTKQHTLDEIEQF----AQPGDIVHLETPVNPFGTSLDLEDFAKKAHE--KGALLLV 172
            +      T D I+       +   +V +E+P NP     D+    K A +  K  L++V
Sbjct: 117 AHGVDTSFTNDLIKDLPSLIKENTKLVWIESPTNPTLKVTDIALVVKTAKQINKEILVVV 176

Query: 173 DSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN 232
           D+TF  P L N  +F VDI++HSATKY  GHSD++ GVL   ++A+  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATNDKAIYEKLQFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQK---ES 289
            +  +S++  R L+T  +R+ + +  ATKI  FL+      D  + ++ +  L       
Sbjct: 237 PSPFDSWLAHRGLKTLHLRVRQAALTATKIAEFLEQ-----DSNVLAVNYPGLASNPDRE 291

Query: 290 FVKKQLKGGY-GPVFSISLMNKEQ-CKKFPPMLKYFHHATSLGGIESLVEWRA-MTDPYI 346
            V++Q + G  G + S  +    Q   KF    + F  A SLGGIESL+E  A MT   I
Sbjct: 292 IVQRQHRDGLGGGMISFRIKGGAQAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 347 EQT----------LIRVSIGCENADDLIQDLANALETLQK 376
            +           LIR+S+G E++DDL+ D+  AL    K
Sbjct: 352 PKEQREASGVYDDLIRLSVGIEDSDDLLTDIKEALAATTK 391

>Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {ON}
           similar to Ashbya gossypii AEL341W
          Length = 392

 Score =  129 bits (324), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 121/397 (30%), Positives = 192/397 (48%), Gaps = 46/397 (11%)

Query: 3   HLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHP 62
            +ST ++H+ +  +    V  PI+++TTF+      VP    E          YSR  +P
Sbjct: 8   QISTKVVHAGEHVDIHGSVIEPISLSTTFK-QASPAVPVGAYE----------YSRSQNP 56

Query: 63  NSTRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGV-RAIANIL 117
           N   LE   + + +  H + +SSG +A  A ++   P+    I IG  Y G  R   N+ 
Sbjct: 57  NRKNLEDAIAVLENAKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFNNVA 115

Query: 118 TRNFQTKQHTLDEIEQFA----QPGDIVHLETPVNPFGTSLDLEDFAK--KAHEKGALLL 171
             +      T + +E       +   +V +E+P NP     D++  ++  K+  K  +L+
Sbjct: 116 NAHGVETTFTNNLVEDLPTLIRENTKLVWIESPTNPTLKVTDIQLVSQIIKSSNKDIILV 175

Query: 172 VDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGT 231
           VD+TF  P L N  +F  DI++HSATKY  GHSD++ GVL    + +  +L+  +  +G 
Sbjct: 176 VDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGVLATNSQVLYDKLQYLQNAIGA 235

Query: 232 NVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQ---KE 288
             +  ++++  R L+T  +R+   S +A +I  FL     K DKV+ S+ +  L      
Sbjct: 236 VPSPFDAWLTHRGLKTLHLRVRTASNSAQEIAEFL----VKSDKVI-SVNYPGLSSHPNN 290

Query: 289 SFVKKQLKGGYGPVFSISLMNK---EQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDP 344
             VKKQ + G G    IS   K   +   KF    + F  A SLGGIESL+E  A MT  
Sbjct: 291 DIVKKQHRDGLGGGM-ISFRIKGGADGAAKFSASTRLFTLAESLGGIESLLEVPAVMTHG 349

Query: 345 YIEQ----------TLIRVSIGCENADDLIQDLANAL 371
            I +           LIR+S+G E+  DL++D+  AL
Sbjct: 350 GIPKDQREASGVYDDLIRLSVGIEDTGDLLKDIEQAL 386

>Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  129 bits (324), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 118/411 (28%), Positives = 188/411 (45%), Gaps = 71/411 (17%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPI----YSRL 59
            +T  IH+ +  +    V  PI+++TTF+  +                  PI    YSR 
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFKQSS---------------PANPIGTYEYSRS 53

Query: 60  AHPNSTRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR---- 111
            +PN   LE   + + +  + + +SSG +A  A ++   P+    + IG  Y G      
Sbjct: 54  QNPNRENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGAHAVSIGDVYGGTHRYFT 112

Query: 112 AIANILTRNFQTKQHTLDEIEQFAQPG-DIVHLETPVNPFGTSLDLEDFAK--KAHEKG- 167
            +AN            L ++ Q  +    +V +ETP NP     D++  A   K H  G 
Sbjct: 113 KVANAHGVETSFTNDLLTDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQ 172

Query: 168 -ALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDR 226
             +L+VD+TF  P + N  DF  DI++HSATKY  GHSD++ GVL    + +  +L+  +
Sbjct: 173 DVILVVDNTFLSPYISNPLDFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQ 232

Query: 227 IYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRD--------------K 272
             +G   +  ++++  R L+T  +R+ + + +A KI  FL S+++               
Sbjct: 233 NAIGAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKENIVAVNYPGLKTHPN 292

Query: 273 YDKVLKSITHSSLQKESFVKKQLKGGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGI 332
           YD VLK   H        +  ++KGG            E   KF    + F  A SLGGI
Sbjct: 293 YDVVLKQ--HRDALGGGMISFRIKGG-----------AEAASKFASSTRLFTLAESLGGI 339

Query: 333 ESLVEWRA-MTDPYIEQT----------LIRVSIGCENADDLIQDLANALE 372
           ESL+E  A MT   I +           LIR+S+G E+ DDL++D+  AL+
Sbjct: 340 ESLLEVPAVMTHGGIPKEAREASGVFDDLIRISVGIEDTDDLLEDVKQALK 390

>TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.97
           YAL012W
          Length = 387

 Score =  128 bits (321), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 119/397 (29%), Positives = 190/397 (47%), Gaps = 48/397 (12%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTF+            + +   E    YSR  +PN
Sbjct: 9   FATKAIHAGAHIDVHGSVIEPISLSTTFKQS-------APSQPIGIYE----YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR----AIAN 115
              LE   + + +G + + +SSG +A  A ++   P+    I IG  Y G       +AN
Sbjct: 58  RKNLEEAIATLENGKYGLAFSSG-SATTAVILQSLPQGSHSISIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNFQTKQHTLDEIEQFAQPGD-IVHLETPVNPFGTSLDLE---DFAKKAHEKGALLL 171
                     + ++E+    +P   +V +E+P NP     D++   D  KK + K  L++
Sbjct: 117 AHGVESTFSNNLIEELPTLVKPNTRLVWIESPTNPTLKVTDIQLVVDTVKKLN-KDILVV 175

Query: 172 VDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGT 231
           VD+TF  P L N  +F  DI++HSATKY  GHSD++ GVL    + +  +L+  +  +G 
Sbjct: 176 VDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKEIYERLQFLQNAIGA 235

Query: 232 NVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQ---KE 288
             +  ++++  R L+T  +R+ + S +A KI  FL       D  + ++ +  L+     
Sbjct: 236 IPSPFDAWLAHRGLKTLHLRVRQASLSAQKIAEFL-----AQDPNVIAVNYPGLESHPNR 290

Query: 289 SFVKKQLKGGYGPVFSISLMNK---EQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDP 344
             VKKQ + G G    IS   K   E   KF    + F  A SLGGIESL+E  A MT  
Sbjct: 291 DIVKKQHRDGLGGGM-ISFRIKGGAEGASKFTQKTRLFTLAESLGGIESLLEVPAVMTHG 349

Query: 345 YIEQT----------LIRVSIGCENADDLIQDLANAL 371
            I +           L+R+S+G E+ DDL+ D+  AL
Sbjct: 350 GIPKEAREATGVYDDLVRLSVGIEDVDDLLADVKQAL 386

>Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  128 bits (321), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 116/407 (28%), Positives = 189/407 (46%), Gaps = 63/407 (15%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+ +  +    V  PI+++TTF+  +    P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHIDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR----AIAN 115
              LE   + + +  + + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RENLEKAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNFQTKQHTLDEIEQFAQPG-DIVHLETPVNPFGTSLDLEDFAK--KAHEKG--ALL 170
                       L+++ Q  +    +V +ETP NP     D++  A   K H  G   +L
Sbjct: 117 AHGVETSFTNDLLNDLPQLLKNNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 LVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLG 230
           +VD+TF  P + N  +F  DI++HSATKY  GHSD++ GVL    + +  +L+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKQLYERLQFLQNAIG 236

Query: 231 TNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRD--------------KYDKV 276
              +  ++++  R L+T  +R+ + + +A KI  FL S+++               YD V
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKENVVAVNYPGLKTHPNYDVV 296

Query: 277 LKSITHSSLQKESFVKKQLKGGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLV 336
           LK   H        +  ++KGG            E   KF    + F  A SLGGIESL+
Sbjct: 297 LKQ--HRDALGGGMISFRIKGG-----------AEAASKFASSTRLFTLAESLGGIESLL 343

Query: 337 EWRA-MTDPYIEQT----------LIRVSIGCENADDLIQDLANALE 372
           E  A MT   I +           L+R+S+G E+ DDL++D+  AL+
Sbjct: 344 EVPAVMTHGGIPKEAREASGVYDDLVRISVGIEDTDDLLEDVKQALK 390

>YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}
           CYS3Cystathionine gamma-lyase, catalyzes one of the two
           reactions involved in the transsulfuration pathway that
           yields cysteine from homocysteine with the intermediary
           formation of cystathionine
          Length = 394

 Score =  127 bits (320), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 115/407 (28%), Positives = 189/407 (46%), Gaps = 63/407 (15%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+ +  +    V  PI+++TTF+  +    P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR----AIAN 115
              LE   + + +  + + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNFQTKQHTLDEIEQFAQPG-DIVHLETPVNPFGTSLDLEDFAK--KAHEKG--ALL 170
                       L+++ Q  +    +V +ETP NP     D++  A   K H  G   +L
Sbjct: 117 AHGVETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 LVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLG 230
           +VD+TF  P + N  +F  DI++HSATKY  GHSD++ GVL    + +  +L+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIG 236

Query: 231 TNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRD--------------KYDKV 276
              +  ++++  R L+T  +R+ + + +A KI  FL ++++               YD V
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADKENVVAVNYPGLKTHPNYDVV 296

Query: 277 LKSITHSSLQKESFVKKQLKGGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLV 336
           LK   H        +  ++KGG            E   KF    + F  A SLGGIESL+
Sbjct: 297 LKQ--HRDALGGGMISFRIKGG-----------AEAASKFASSTRLFTLAESLGGIESLL 343

Query: 337 EWRA-MTDPYIEQT----------LIRVSIGCENADDLIQDLANALE 372
           E  A MT   I +           L+R+S+G E+ DDL++D+  AL+
Sbjct: 344 EVPAVMTHGGIPKEAREASGVFDDLVRISVGIEDTDDLLEDIKQALK 390

>Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W
           (REAL)
          Length = 395

 Score =  124 bits (311), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 118/416 (28%), Positives = 193/416 (46%), Gaps = 68/416 (16%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+ +  +    V  PI+++TTF+  +    P    E          YSR  +PN
Sbjct: 9   FATKAIHAGEHVDVHGSVIEPISLSTTFK-QSSPANPIGTYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR----AIAN 115
              LE   + + +  + + +SSG +A  A ++   P+    + IG  Y G       +AN
Sbjct: 58  RENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNFQTKQHTLDEIEQFAQPG-DIVHLETPVNPFGTSLDLEDFA---KK--AHEKGAL 169
                       L ++ Q  +    +V +ETP NP     D++  A   KK  A  +  +
Sbjct: 117 AHGVETSFTNDLLKDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADAIKKHTAASQDVI 176

Query: 170 LLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYL 229
           L+VD+TF  P + N  +F  DI++HSATKY  GHSD++ GVL    + +  +L+  +  +
Sbjct: 177 LVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAI 236

Query: 230 GTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRD--------------KYDK 275
           G   +  ++++  R L+T  +R+ + + +A KI  FL ++++               YD 
Sbjct: 237 GAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLAADKENIVAVNYPGLKTHPNYDV 296

Query: 276 VLKSITHSSLQKESFVKKQLKGGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESL 335
           V+K   H        +  ++KGG            E   KF    + F  A SLGGIESL
Sbjct: 297 VVKQ--HRDALGGGMISFRIKGG-----------AEAASKFASSTRLFTLAESLGGIESL 343

Query: 336 VEWRA-MTDPYIEQT----------LIRVSIGCENADDLIQDLANALETLQKESSN 380
           +E  A MT   I +           L+R+S+G E+ADDL+ D+  AL    K++SN
Sbjct: 344 LEVPAVMTHGGIPKEAREASGVFDDLVRISVGIEDADDLLDDIKQAL----KQASN 395

>KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 392

 Score =  124 bits (310), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 114/402 (28%), Positives = 183/402 (45%), Gaps = 56/402 (13%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTF+  +    P    E          YSR  +PN
Sbjct: 9   FATLAIHAGAHTDVHGSVIEPISLSTTFK-QSAPAQPIGAYE----------YSRSQNPN 57

Query: 64  STRLESIFSEILDGH-AVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVRAIANILTR 119
              LE+  + +      + +SSG +A  A ++   P     I IG  Y G       +  
Sbjct: 58  RANLEAAVAALERAQFGLAFSSG-SATTAVVLQSLPTDSHAISIGDVYGGTHRYFTQVAH 116

Query: 120 NFQTKQHTLDEIE----QFAQPGD-IVHLETPVNPFGTSLDLEDFAKKAHEKGA--LLLV 172
               +    +++E    Q  +P   +V LE+P NP     D+   A  AH      L++V
Sbjct: 117 AHGVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVADAAHAANPDILVVV 176

Query: 173 DSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN 232
           D+TF  P + N      DI++HSATKY  GHSD++ GVL    E +  +LR  +  +G  
Sbjct: 177 DNTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPLYERLRFLQNAIGAV 236

Query: 233 VANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSN----RDKYDKVLKSITHSSLQKE 288
            +  +S++  R L+T  +R+   +++A +I  FL+++       Y  +     ++ +QK+
Sbjct: 237 PSPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFLEASDRVEHVNYPGLSSHPAYAVVQKQ 296

Query: 289 -------SFVKKQLKGGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRA- 340
                    +  ++KGG G              +F    + F  A SLGGIESLVE  A 
Sbjct: 297 HRDALGGGMISFRIKGGAG-----------AAARFTSTTRLFTLAESLGGIESLVEVPAV 345

Query: 341 MTDPYIEQ----------TLIRVSIGCENADDLIQDLANALE 372
           MT   I +           LIR+S+G E+ DDL++D+  ALE
Sbjct: 346 MTHGGIPREQREASGVFDNLIRLSVGIEDIDDLLEDVRQALE 387

>KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {ON}
           Anc_7.97 YAL012W
          Length = 390

 Score =  119 bits (299), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 112/398 (28%), Positives = 182/398 (45%), Gaps = 48/398 (12%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPI----YSRL 59
            +T  +H+ +  +    V  PI+++TTF+  +                  PI    YSR 
Sbjct: 7   FATLAVHAGEHTDVHGSVIEPISLSTTFKQSS---------------PANPIGVYEYSRS 51

Query: 60  AHPNSTRLESIFSEILDG-HAVIYSSGLAAFFAAM--IHYNPKRIFIGQSYHGVR----A 112
            +PN   LE+  + +    + + +SSG AA    M  +      + IG  Y G       
Sbjct: 52  QNPNRDNLENAIAALEKAQYGLAFSSGSAATSVIMQSLPQGSHAVSIGDVYGGTHRYFTK 111

Query: 113 IANILTRNFQTKQHTLDEIEQFAQPGD-IVHLETPVNPFGTSLDLEDF--AKKAHEKGAL 169
           +AN          + L+E+    +    +V +E+P NP     D++    A K   K  L
Sbjct: 112 VANTHGVETTFTNNLLEELPNLVKDNTRLVWIESPTNPTLKVTDIQAVSNAIKKINKDIL 171

Query: 170 LLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYL 229
           L+VD+TF  P L N   F  DI++HSATKY  GHSD++ GVL    + +  +L+  +  +
Sbjct: 172 LVVDNTFLSPYLSNPLTFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAI 231

Query: 230 GTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRD----KYDKVLKSITHSSL 285
           G   +  ++++  R L+T  +R+ + S  A KI  FL +++      Y  +     H+ +
Sbjct: 232 GAIPSPFDAWLTHRGLKTLHLRVKQASVTAQKIAEFLSASKHVEAVNYPGLKTHPNHAVV 291

Query: 286 QKESFVKKQLKGGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRA-MTDP 344
           Q++    +   GG    F +         KF    + F  A SLGGIESL+E  A MT  
Sbjct: 292 QRQ---HRDALGGGMISFRVKGG-AAAAAKFSSTTRLFTLAESLGGIESLLEVPAVMTHG 347

Query: 345 YIEQ----------TLIRVSIGCENADDLIQDLANALE 372
            I +           LIR+S+G E+ +DL++D+  ALE
Sbjct: 348 GIPKESREASGVYDNLIRLSVGIEDTEDLLEDIKQALE 385

>AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YAL012W (CYS3)
          Length = 393

 Score =  115 bits (287), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 109/400 (27%), Positives = 186/400 (46%), Gaps = 44/400 (11%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  IH+    +    V  PI+++TTF+  +    P    E          YSR  +PN
Sbjct: 9   FATKAIHAGAHTDLHGSVIEPISLSTTFKQSSPG-NPVGAYE----------YSRGQNPN 57

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGVR----AIAN 115
              LE   + +    + + +SSG +A  A ++   P+    I IG  Y G       +AN
Sbjct: 58  RQNLEEAIAALESAKYGLAFSSG-SATTAVIVQSLPQGSHAISIGDVYGGTHRYFTKVAN 116

Query: 116 ILTRNFQTKQHTLDEIEQFAQPGD-IVHLETPVNPFGTSLDLEDFAK--KAHEKGALLLV 172
                       L+++ +  +    +V +E+P NP     D++  A   KA  +  +L+V
Sbjct: 117 AHGVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVADTVKALNEDIILVV 176

Query: 173 DSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN 232
           D+TF  P L N  +F  DI++HSATKY  GHSD++ G L     ++  +L   +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATNSTSLYERLAFLQNAIGAI 236

Query: 233 VANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSL---QKES 289
            +  ++++  R L+T  +R+ + +++A KI  +L+ +       + S+ +  L   +   
Sbjct: 237 PSPFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYLEQSEH-----VVSVNYPGLPSHRGYQ 291

Query: 290 FVKKQLKGGY-GPVFSISLMNKEQCKK-FPPMLKYFHHATSLGGIESLVEWRA-MTDPYI 346
             +KQ + G  G + S  +    Q         + F  A SLGGIESL+E  A MT   I
Sbjct: 292 IAQKQHRDGLGGGMISFRVKGGAQGAALLSQSTRLFTLAESLGGIESLLEVPAVMTHAGI 351

Query: 347 EQT----------LIRVSIGCENADDLIQDLANALETLQK 376
            +           L+RVS+G E+ DDL++D+  AL  + +
Sbjct: 352 PKEAREASGVYDDLVRVSVGIEDTDDLLEDIKQALSVVAE 391

>KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P53101 Saccharomyces
           cerevisiae YGL184C STR3 Cystathionine beta-lyase
           converts cystathionine into homocysteine
          Length = 460

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 100/394 (25%), Positives = 170/394 (43%), Gaps = 61/394 (15%)

Query: 23  PPINVTTTFR---YDNDDLVPWTERENLDFMEKTPIYSRLAHPNSTRLESIFSEILD--- 76
           PPI  +TTF+    ++D   P+              Y+R  +P  T ++    ++ D   
Sbjct: 25  PPIYQSTTFKIGSLEDDASQPYD-------------YTRSGNPTRTVVQHQIGKLYDVDA 71

Query: 77  GHAVIYSSGLAAF---FAAMIHYNPKR---IFIGQSYHG--VRAIANILTRNFQTKQH-- 126
              +  SSG+ A      A++  N  R   I  G   +G   R + ++ +RN     H  
Sbjct: 72  AQVLAVSSGMTALDVILRALVLTNKSRVPTIIAGDDLYGGTQRLLTHLESRNHARVLHVD 131

Query: 127 -----TLDEIEQFAQPGDIVHLETPVNPFGTSLDL---EDFAKKAHEKGALLLVDSTFAP 178
                T  E+ +  +  D V LE+P NP     DL     F K A+E   L+ +D+T   
Sbjct: 132 TANYETFVEVFKQQEHVDCVLLESPTNPLLKVADLPRLTHFIKSANE-ACLVAIDNTMMS 190

Query: 179 PPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLES 238
             L N   F  D++  SATKY  GH D+++G++V +   +A+++       G+ ++  +S
Sbjct: 191 GMLCNPLKFQCDVVYESATKYLNGHHDIMAGIVVTQTLKMAQEIYFVINSTGSGLSPFDS 250

Query: 239 FMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVK------ 292
           ++L+R L+T  +R+ +Q  NA  +  +L+++     K  K +  S   +   +K      
Sbjct: 251 WLLVRGLKTLGVRLYQQQHNAMVLAHWLENSCGFVGK--KGVKGSPRTRFVGLKSHPQFE 308

Query: 293 --KQLKGGYGPVFSISLMNKEQCKKF--PPMLKYFHHATSLGGIESLVEW-----RAMTD 343
             K    G G V S    + E  ++      +K +    S G + SL+        A  D
Sbjct: 309 LHKSFNAGPGAVLSFETGSYEHSRRLVSSRKIKIWAVTVSFGCVNSLISMPCKMSHAAID 368

Query: 344 PYIEQT------LIRVSIGCENADDLIQDLANAL 371
           P + Q       L+R+  G EN  DL  DL  A+
Sbjct: 369 PALRQERDFPEDLVRLCCGIENISDLQNDLLEAM 402

>CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184c
          Length = 450

 Score = 97.1 bits (240), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 98/395 (24%), Positives = 171/395 (43%), Gaps = 65/395 (16%)

Query: 24  PINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPNSTRLESIFSEILD----GHA 79
           P+ ++TTF+ D        E EN  +      YSR  +P  T L+   +++ D       
Sbjct: 11  PLYLSTTFKVD-------LENENNQYD-----YSRSGNPTRTLLQQQVAKLYDDIDPNFV 58

Query: 80  VIYSSGLAAFFAAMIHYNPKR-----IFIGQS-YHGVRAIANIL-------------TRN 120
              SSG+ A    +  + P       I  G   Y G + + N+L             T N
Sbjct: 59  FAVSSGMTALDVVLRSFLPSETNNHCIIAGDDLYGGTQRLLNLLKISIDTMHFDLSHTEN 118

Query: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAK--KAHEKGALLLVDSTFAP 178
           F+ K + L  I++     DI+ LE+P NP    +D+    K  + +    L+++D+T   
Sbjct: 119 FKAKFYDLVTIKKTIV--DIIVLESPTNPLCKIIDIPHLIKFIRKYSPETLIVIDNTMMS 176

Query: 179 PPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLES 238
               N   F  D++  SATKY  GH D+++GV++ K + +A ++       G+ +  ++S
Sbjct: 177 GLNCNPLKFGADVVYESATKYLNGHHDIMAGVIIAKNKLLAEKIYFLINSTGSGLNPMDS 236

Query: 239 FMLLRSLRTFEMRMLKQSENATKIVSFLD---------SNRDKYDKVLKSITHSSLQKES 289
           ++L+R L+T  +R+ KQ  NA  I  +L+         +N +   + +   +H   +   
Sbjct: 237 WLLIRGLKTLSIRLHKQQLNALAISHWLEEGCGFKTHNNNNNLKTRYIGLKSHPDYE--- 293

Query: 290 FVKKQLKGGYGPVFSISLMNKEQCKKF--PPMLKYFHHATSLGGIESLVEW-----RAMT 342
            + +    G G V S+   +    KK     +LK ++   S G + SL+        A  
Sbjct: 294 -LHRSFNKGPGAVISLQTGSIPISKKIVASKLLKLWNVTVSFGCVNSLISMPCLMSHASI 352

Query: 343 DPYIE------QTLIRVSIGCENADDLIQDLANAL 371
           DP +       + LIR+  G E+   L +DL  A 
Sbjct: 353 DPELRKERQFPEDLIRLCCGIEDVKALQEDLLGAF 387

>Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {ON}
           YGL184C (STR3) - Cystathionine beta-lyase [contig 211]
           FULL
          Length = 463

 Score = 93.2 bits (230), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 108/414 (26%), Positives = 178/414 (42%), Gaps = 66/414 (15%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFR---YDNDDLVPWTERENLDFMEKTPIYSRLA 60
           L + + HSD   + V    PPI  +TTF+    ++D   P+              Y+R  
Sbjct: 12  LVSVVQHSDQHGSSV----PPIYQSTTFKIGSLEDDASQPYD-------------YTRSG 54

Query: 61  HPNSTRLESIFSEI--LDGHAVI-YSSGLAAF---FAAMI----HYNPKRIFIGQSYHGV 110
           +P  T ++    ++  +D   V+  SSG+ A      A++     Y P  I     Y G 
Sbjct: 55  NPTRTVVQHQIGKLYGVDASQVLAVSSGMTALDVILRALVLTNNSYVPTIIAGDDLYGGT 114

Query: 111 RAIANIL-TRNFQTKQHT-LDEIEQF-----AQPG-DIVHLETPVNPFGTSLDL---EDF 159
           + +   L +RN     H      + F     AQP  D V LE+P NP     DL     F
Sbjct: 115 QRLLTYLESRNHARVLHVDTTNYDAFTALFNAQPRVDCVLLESPTNPLLKVADLPRITRF 174

Query: 160 AKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVA 219
            K+++EK  ++ +D+T     L N   F+ D++  SATKY  GH D+++G++V +   +A
Sbjct: 175 VKQSNEK-CVVAIDNTMMSGMLCNPLHFHCDVVYESATKYLNGHHDIMAGIVVARSAQLA 233

Query: 220 RQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKS 279
            ++       G  ++  +S++L+R L+T  +R+ +Q  NA  +  +L+++        K 
Sbjct: 234 GEIYFMINSTGCGLSPFDSWLLIRGLKTLGVRIYQQQHNAMVLAHWLENSCGFVSHGKKG 293

Query: 280 ITHSSLQK---------ESFVKKQLKGGYGPVFSISLMNKEQCKKF--PPMLKYFHHATS 328
               SLQ          E  + K    G G V S    + E  ++      +K +    S
Sbjct: 294 --KGSLQTRFVGLKSHPEFELHKSFNTGPGAVLSFETGSFEHSRRLVSSKKIKLWAVTVS 351

Query: 329 LGGIESLVEW-----RAMTDPYIEQT------LIRVSIGCENADDLIQDLANAL 371
            G + SL+        A  DP + Q       L+R+  G EN  DL  DL  A+
Sbjct: 352 FGCVNSLISMPCKMSHAAIDPALRQERDFPEDLVRLCCGIENIVDLQNDLLEAM 405

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 91/355 (25%), Positives = 155/355 (43%), Gaps = 25/355 (7%)

Query: 45  ENLDFMEKTPIYSRLAHPNSTRLESIFSEILDGHAVIYS-SGLAAFFAAMIHYNPK--RI 101
           ++++ M+    Y     P    LE  ++ +  G   + S SGL +   A++        I
Sbjct: 46  DDVEHMKGRFFYGTAGSPTIANLEDAWTHLTGGAGTVLSPSGLGSISLALLTLAKAGDHI 105

Query: 102 FIGQS-YHGVRAIANILTRNFQTKQHTLD-----EIEQFAQPGD-IVHLETPVNPFGTSL 154
            I  S Y   R + + L   F  +    D     +I++  +P   ++ LE+P +      
Sbjct: 106 LITDSVYVPTRMLCDGLLAKFGIETEYYDPSVGEDIKKLIKPNTTVIFLESPGSGTMEIQ 165

Query: 155 DLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVK 214
           D+      A + G   ++D+T+A P   +     +DI + + TKY GGHSDLL G+    
Sbjct: 166 DIPALVSVAKKHGIKTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLIGLTSAN 225

Query: 215 EEAVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYD 274
           EE     LR     +       +  + LR +RT  +R+ +    A  + ++L+ +RD+ +
Sbjct: 226 EECWP-LLRSTYDAMAMLPGADDCLLALRGMRTLHLRLKEAERKALDLAAWLE-DRDEVE 283

Query: 275 KVLKSITHSSLQKESFVKKQLKGGYGPVFSISLMN---KEQCKKFPPMLKYFHHATSLGG 331
           KVL          E +V +  KG  G +FSI L +   +   +     +K FH   S GG
Sbjct: 284 KVLHPAFKDCPGHEYWV-RDYKGSSG-LFSIVLKDGYTRTGLENMVEKMKVFHLGFSWGG 341

Query: 332 IESLV-------EWRAMTDPYIEQTLIRVSIGCENADDLIQDLANALETLQKESS 379
            ESL+       + +A   P+     +R+ +G E   DL +DL    E L +E S
Sbjct: 342 YESLITPVNPARQRKAANWPH-RGFALRIQVGLEELTDLKRDLELGFERLAQEIS 395

>ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL184C
           (STR3)
          Length = 453

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 117/258 (45%), Gaps = 36/258 (13%)

Query: 143 LETPVNPFGTSLDLEDFAK--KAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYF 200
           LE+P NP     D+       KAH  G  ++VD+T       N      D +  SATKY 
Sbjct: 148 LESPTNPLMKVADVPALVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYL 207

Query: 201 GGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENAT 260
            GH D+++GV+V    A+A +       +G  +A +++++L+R L+T  +R+ KQ  NA 
Sbjct: 208 NGHHDIMAGVIVAATRALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQHNAM 267

Query: 261 KIVSFLDSNRDKYDKVLKSITHSSLQKESFVK----------KQLKGGYGPVFSI----- 305
            +  +L   R+      +++  +   +  FV           +    G G V SI     
Sbjct: 268 VLAHWL---REVCG--FRAVGGNHALQTRFVGLRSHPQHKLHRSFNRGPGAVLSIQTGDT 322

Query: 306 SLMNKEQCKKFPPMLKYFHHATSLGGIESLVEW-----RAMTDPYIEQT------LIRVS 354
           +L  +  C K    L+++    S G + SL+        A  DP + +       LIR+S
Sbjct: 323 ALSERIVCSK---KLQFWGVTVSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLIRLS 379

Query: 355 IGCENADDLIQDLANALE 372
            G E+ +DL QDL  ALE
Sbjct: 380 CGVEDVEDLQQDLLAALE 397

>ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184C STR3
           Cystathionine beta-lyase converts cystathionine into
           homocysteine
          Length = 455

 Score = 89.4 bits (220), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 101/399 (25%), Positives = 168/399 (42%), Gaps = 76/399 (19%)

Query: 24  PINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPNSTRLESIFSEILDG-----H 78
           P+ ++TTF+ D       ++ +  D       YSR  +P  + L     ++ +      H
Sbjct: 23  PVYMSTTFKVD-----LRSDGQAYD-------YSRSGNPTRSLLHRQLGQLYNVPESQVH 70

Query: 79  AVIYSSGLAAFFAAM---IHYNPKR---IFIGQSYHG--------------VRAIANILT 118
           AV  SSG+ A  A M   I  N      I  G   +G               R I N+ T
Sbjct: 71  AV--SSGMTALDAIMRGLILSNTSHVPTILAGDDLYGGSDRLLTFLKTRCHARTI-NVDT 127

Query: 119 RNFQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLE---DFAKKAHEKGALLLVDST 175
            NF   Q     +++     D VH+E+P NP    +D+     F K    +   ++VD+T
Sbjct: 128 SNFDKFQEAFLSVDKV----DCVHIESPTNPMCKVVDVPRIISFVKSVSPQ-TYVIVDNT 182

Query: 176 FAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYL-----G 230
                L N      D +  SATK+  GH D+++GV+V + + +A     D IY      G
Sbjct: 183 MMSGLLCNPLSLGADAVYESATKFLNGHHDIMAGVVVSRNQKIA-----DAIYFVVNATG 237

Query: 231 TNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSN---RDKYDKVLKSITHSSLQK 287
             +A ++S++L+R L+T  +R+ +Q  NA  +  +L+ +   +   D  L    +  LQ 
Sbjct: 238 CGLAPMDSWLLIRGLKTLSVRLYQQQFNAMVLAEWLEQSCGFKQSKDNSLLRTRYVGLQS 297

Query: 288 --ESFVKKQLKGGYGPVFSISLMNKEQCKKF--PPMLKYFHHATSLGGIESLVEW----- 338
             +  + +    G G V S    +    ++      LK +    S G + SL+       
Sbjct: 298 HPQFSLHRSFNDGPGAVLSFETGSTPLSRRIVSSKALKIWSVTVSFGCVNSLISLPCSMS 357

Query: 339 RAMTDPYIE------QTLIRVSIGCENADDLIQDLANAL 371
            A  DP +       + LIR+ +G E+  DL +DL  A+
Sbjct: 358 HASIDPNVRKEREFPEDLIRLCVGIEDIVDLQKDLLAAM 396

>YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}
           STR3Peroxisomal cystathionine beta-lyase, converts
           cystathionine into homocysteine; may be redox regulated
           by Gto1p
          Length = 465

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 97/420 (23%), Positives = 176/420 (41%), Gaps = 67/420 (15%)

Query: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60
           +  L T ++++  ++++ S   PP+ ++TTF+ D ++     + +N D       YSR  
Sbjct: 3   IKRLDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EDAQNYD-------YSRSG 51

Query: 61  HPNSTRLESIFSEIL---DGHAVIYSSGLAAF---------FAAMIHYNPKRIFIGQSYH 108
           +P  + L+    ++      + +  SSG+ A               ++ P  I     Y 
Sbjct: 52  NPTRSVLQHQIGKLYRVPQENVLAVSSGMTALDVILRGLVLLNGTDNHTPTIIAGDDLYG 111

Query: 109 GVRAIANILTRN---------------FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTS 153
           G + + N   +                F+T   +LD++       D V LE+P NP    
Sbjct: 112 GTQRLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKV-------DCVLLESPTNPLCKV 164

Query: 154 LDLEDFAK--KAHEKGALLLVDSTFAPPPLQNVWDFN--VDIIMHSATKYFGGHSDLLSG 209
           +D+    +  K       ++VD+T       N    N   D++  SATKY  GH DL+ G
Sbjct: 165 VDIPRILRFVKCISPDTTVVVDNTMMSGLNCNPLQLNPGCDVVYESATKYLNGHHDLMGG 224

Query: 210 VLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSN 269
           V++ K   +A +L       G  ++ ++S++L+R L+T  +R+ +Q  NA  +  +L+++
Sbjct: 225 VIISKTPEIASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENS 284

Query: 270 RD----KYDKVLKSITHSSLQKESF-VKKQLKGGYGPVFSISLMNKEQCKKF--PPMLKY 322
                 + +K  K+          F + K    G G V S    + E  K+      L  
Sbjct: 285 CGFKPTRTNKATKTRFVGLRSNPDFKLHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSI 344

Query: 323 FHHATSLGGIESLVEW-----RAMTDPYIE------QTLIRVSIGCENADDLIQDLANAL 371
           +    S G + SL+        A  DP +       + L+R+  G EN  DL +DL  A+
Sbjct: 345 WAVTVSFGCVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} highly
           similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 459

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 97/397 (24%), Positives = 174/397 (43%), Gaps = 51/397 (12%)

Query: 14  KDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPNSTRLESIFSE 73
           KD   S V PP+  +TTF+  + +          D  ++   Y+R  +P  + L+   ++
Sbjct: 17  KDQHGSSV-PPLYQSTTFKQSSLE----------DDADQEYDYTRSGNPTRSVLQEQIAK 65

Query: 74  ILD--GHAVI-YSSGLAAF---FAAMI----HYNPKRIFIGQSYHGVRAIANILTRNFQT 123
           + +  G  V   SSG+        A++    ++ P  I     Y G + +   L R    
Sbjct: 66  LYNVPGFQVFAVSSGMTCLDVILRALVLGNSNHTPTIIAGDDLYGGTQRLLTFLERKNHA 125

Query: 124 KQHTLDE------IEQFAQPG--DIVHLETPVNPFGTSLDL---EDFAKKAHEKGALLLV 172
           +   +D       +  F   G  D V LE+P NP     DL     F K+A+ K   ++V
Sbjct: 126 RVIHVDTTDFDKFVSAFNGCGFVDCVVLESPTNPLCKVADLPGLTKFIKQANPK-CHVVV 184

Query: 173 DSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN 232
           D+T       N  +F  D++  S TKY  GH D+++GV++ + + +A++L       G  
Sbjct: 185 DNTMVSGLNCNPLEFQCDVVYESGTKYLNGHHDIMAGVIIGRSKEIAQELYFVINSTGCG 244

Query: 233 VANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNR----DKYDKVLKSITHSSLQKE 288
           ++ ++ ++L+R L+T  +R+ +Q  NA  +  +L S+     +  +K+L++         
Sbjct: 245 LSPMDCWLLIRGLKTLSIRLYQQQHNAMILARWLYSSCGFRPNSENKLLRTRYVGLKSHP 304

Query: 289 SF-VKKQLKGGYGPVFSISLMNKEQCKKF--PPMLKYFHHATSLGGIESLVEW-----RA 340
            F + +    G G V S    + E  K+      LK +    S G + SL+        A
Sbjct: 305 QFELHRSFNKGPGAVLSFDTGSFEHSKRLVSSKKLKIWAVTVSFGCVNSLISMPCKMSHA 364

Query: 341 MTDPYIE------QTLIRVSIGCENADDLIQDLANAL 371
             DP +       + L+R+  G E+  DL +DL  A+
Sbjct: 365 SIDPELRKERDFPEDLVRLCCGIEDVKDLQKDLLAAM 401

>Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 100/424 (23%), Positives = 174/424 (41%), Gaps = 81/424 (19%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
           L T ++++  ++++ S   PP+ ++TTF+ D  +       ++ D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLSN----ETAQDYD-------YSRSGNPT 54

Query: 64  STRLESIFSEIL---DGHAVIYSSGLAAF---------FAAMIHYNPKRIFIGQSYHGVR 111
            + L++   ++      + +  SSG+ A          F    ++ P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLFNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 AIANILTRN---------------FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDL 156
            + N   +                F+T   +LD++       D V LE+P NP    +D+
Sbjct: 115 RLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKV-------DCVLLESPTNPLCKVVDI 167

Query: 157 EDFAK--KAHEKGALLLVDSTFAPP----PLQNVWDFNVDIIMHSATKYFGGHSDLLSGV 210
               +  K       ++VD+T        PLQ   D   D++  SATKY  GH DL+ GV
Sbjct: 168 PRILRFVKCISPETTVVVDNTMMSGLNCNPLQ--LDPGCDVVYESATKYLNGHHDLMGGV 225

Query: 211 LVVKEEAVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNR 270
           ++ K   +A +L       G  ++ ++S++L+R L+T  +R+ +Q  NA  +  +L+ + 
Sbjct: 226 IISKTAEIAAKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLEDSC 285

Query: 271 DKYDKVLKSITHSSLQKESFVK----------KQLKGGYGPVFSISLMNKEQCKKF--PP 318
                  K    +   K  FV           +    G G V S    + E  K+     
Sbjct: 286 G-----FKPTETNKTTKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSFEHSKRLVSSK 340

Query: 319 MLKYFHHATSLGGIESLVEW-----RAMTDPYIE------QTLIRVSIGCENADDLIQDL 367
            L  +    S G + SL+        A  DP +       + LIR+  G EN  DL +DL
Sbjct: 341 KLSIWAVTVSFGCVNSLLSMPCKMSHASIDPELRKERDFPEDLIRLCCGIENIVDLKKDL 400

Query: 368 ANAL 371
             A+
Sbjct: 401 LAAM 404

>Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 98/418 (23%), Positives = 176/418 (42%), Gaps = 69/418 (16%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
           L T ++++  ++++ S   PP+ ++TTF+ D ++       +N D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EAAQNFD-------YSRSGNPT 54

Query: 64  STRLESIFSEIL---DGHAVIYSSGLAAF---------FAAMIHYNPKRIFIGQSYHGVR 111
            + L++   ++      + +  SSG+ A               ++ P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 AIANILTRNFQTKQHTLD--EIEQF------AQPGDIVHLETPVNPFGTSLDLED---FA 160
            + N            +D  + E+F          D V LE+P NP    +D+     F 
Sbjct: 115 RLLNFFKHQTHAVTAHVDTSDFEKFKTVFQSVDKVDCVLLESPTNPLCKVVDIPKILRFV 174

Query: 161 KKAHEKGALLLVDSTFAPP----PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEE 216
           K+   +  +++VD+T        PLQ   + + D++  SATKY  GH DL+ GV++ K  
Sbjct: 175 KRISPE-TIVIVDNTMMSGLNCNPLQ--LNPSCDVVYESATKYLNGHHDLMGGVIISKTP 231

Query: 217 AVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKV 276
            +A +L       G  ++ ++S++L+R L+T  +R+ +Q  NA  +  +L+++       
Sbjct: 232 EIASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLENSCG----- 286

Query: 277 LKSITHSSLQKESFVK----------KQLKGGYGPVFSISLMNKEQCKKF--PPMLKYFH 324
            K    +   K  FV           +    G G V S    + E  K+      L  + 
Sbjct: 287 FKPTETNKATKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSSEHSKRLVSSKKLNIWA 346

Query: 325 HATSLGGIESLVEW-----RAMTDPYIE------QTLIRVSIGCENADDLIQDLANAL 371
              S G + SL+        A  DP +       + L+R+  G EN  DL +DL  A+
Sbjct: 347 VTVSFGCVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 106/413 (25%), Positives = 171/413 (41%), Gaps = 62/413 (15%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
           L+T+L+     D   S V PP+  +TTF+  + D     + +  D       Y+R  +P 
Sbjct: 6   LNTSLVSVSHNDKYGSSV-PPLYQSTTFKASSFD-----QLQEYD-------YTRSGNPT 52

Query: 64  STRLESIFSEILD---GHAVIYSSGLAAF---FAAMIHYN---PKRIFIGQSYHGVRAIA 114
            T L+   + + D         SSG+ A       +I  +   P  I     Y G + + 
Sbjct: 53  RTVLQQQIANLYDVAPEQVFAVSSGMTALDIILRTLIDNSDHIPTIIAGDDLYGGTQRLL 112

Query: 115 NIL-TRNFQTKQHT-LDEIEQFAQ------PGDIVHLETPVNPFGTSLDLEDFAKKAHEK 166
             L TRN     HT   + E F +        DIV LE+P NP     DL    +   +K
Sbjct: 113 TFLQTRNHAKVIHTDTTDAESFIKLYNSLGQVDIVLLESPTNPLMKVADLPRLCQFVKQK 172

Query: 167 G-----ALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQ 221
           G       ++VD+T       N   F  D++  S TKY  GH D+++GV++ K++ VA  
Sbjct: 173 GGSSSNCKIVVDNTMMSGLNSNPLQFGADVVYESGTKYLNGHHDIMAGVIIAKKD-VAPS 231

Query: 222 LRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFL---------DSNRDK 272
           +       G  ++ ++S++L+R L+T  +R+ KQ  NA  +  +L         D+N+  
Sbjct: 232 VYFVINSTGAGLSPMDSWLLIRGLKTLSVRLYKQQINAMVLSHWLQDICGFKPTDNNQQL 291

Query: 273 YDKVLKSITHSSLQKESFVKKQLKGGYGPVFSISLMNKEQCKKF--PPMLKYFHHATSLG 330
             + +   +H   +    + K    G G V SI   +    +       L  +    S G
Sbjct: 292 KTRFVGLESHPQFE----LHKSFNNGPGAVLSIETGDLALSEAIVTSKRLNIWAVTVSFG 347

Query: 331 GIESLVEW-----RAMTDPYIEQT------LIRVSIGCENADDLIQDLANALE 372
            + SL+        A  DP + +       LIR+  G E+  DL  DL  A E
Sbjct: 348 CVNSLISMPCKMSHASIDPELRKQRAFPEDLIRLCCGIEDVKDLQYDLLAAFE 400

>TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {ON}
           Anc_8.145 YGL184C
          Length = 464

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 95/404 (23%), Positives = 168/404 (41%), Gaps = 75/404 (18%)

Query: 24  PINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPNSTRLESIFSEILD---GHAV 80
           P+ ++TTF+ D D+     E +  D       YSR  +P  + L+    ++ +    H +
Sbjct: 29  PLYLSTTFKVDLDN----PESQVFD-------YSRSGNPTRSLLQYQIGKLYEVPVEHVL 77

Query: 81  IYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIA--------NILTRNFQTKQHT----- 127
             +SG+ A    +     + + I  + H    IA        N L    ++K H      
Sbjct: 78  AVASGMTALDVIL-----RGLVISSATHVPTIIAGDDLYGGSNRLLAYLESKSHARAVHV 132

Query: 128 -LDEIEQFA------QPGDIVHLETPVNPFGTSLDLEDFAK--KAHEKGALLLVDSTFAP 178
              ++E+F          D V LE+P NP    +D+       K      +++VD+T   
Sbjct: 133 DTTDMEKFKAVFGSLDKVDCVLLESPTNPLCKVVDVPQLVAYVKRISPSTVVIVDNTMMS 192

Query: 179 PPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLES 238
               N  ++  D++  SATKY  GH D++ G++V K   +A+++       G+ ++ ++S
Sbjct: 193 GLQCNPLEYGCDVVYESATKYLNGHHDIMGGIIVGKTAEIAQEIYYVVNATGSGLSPMDS 252

Query: 239 FMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGG 298
           ++L R L+T  +RM +Q  N+  I  +L+ +        K    +S  K  +V  +   G
Sbjct: 253 WLLNRGLKTLGVRMYQQQYNSMVIAQWLEESCG-----FKPTEKNSALKTRYVGLKTNPG 307

Query: 299 Y----------GPVFSISLMNKEQCKKF--PPMLKYFHHATSLGGIESLVEW-----RAM 341
           +          G V S    + E  ++       + F    S G + SL+        A 
Sbjct: 308 FELHRSFNKGPGAVLSFETGSLEHSQRIVASKAFQLFSVTVSFGCVNSLISLPCKMSHAS 367

Query: 342 TDPYIEQT------LIRVSIGCENADDLIQDL------ANALET 373
            DP + +       LIR+ +G E+  DL +DL      AN LE 
Sbjct: 368 IDPEVRKQREFPEDLIRLCVGIEDVGDLQKDLLYAMIDANVLEV 411

>Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar to
           Ashbya gossypii ACL059C
          Length = 472

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 95/410 (23%), Positives = 169/410 (41%), Gaps = 52/410 (12%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
           L T L++   + +      PP+  +TTF+   +   P  +  +         Y+R  +P 
Sbjct: 16  LHTRLVNVTQQKDPYGASVPPLYQSTTFK--QESFEPGCQEYD---------YTRSGNPT 64

Query: 64  STRLESIFSEI--LDGHAVI-YSSGLAAFFAAM--------IHYNPKRIFIGQSYHGVRA 112
            + +E    ++  + G  V+  SSG++A    +            P  I     Y G + 
Sbjct: 65  RSVVERQVGKLYGVCGEQVLAVSSGMSALDVILRSILGSYQAGKTPVVIAGDDLYGGTQR 124

Query: 113 IANILTRNFQTKQHTLDE------IEQFAQPGDI--VHLETPVNPFGTSLDLEDFAK--K 162
           +  IL      K   +D       ++ F    ++  V LE+P NP     DL       K
Sbjct: 125 LLGILGIQGHVKVLHVDTSDAARFVDVFLSQRNVACVLLESPTNPLMKVADLPKLISFVK 184

Query: 163 AHE--KGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVAR 220
           +H    G  ++VD+T       N  +   D++  SATK+  GH D+++GV+V     +A+
Sbjct: 185 SHRGGSGCKIVVDNTMVSGINCNPLELGADLVYESATKFLNGHHDIMAGVIVAASVELAQ 244

Query: 221 QLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSN-----RDKYDK 275
            +      +G  +A ++S++L+R L+T  +RM +Q  NA  +  +L  +      ++  +
Sbjct: 245 DMYFIVNSMGAGLAPMDSWLLIRGLKTLGVRMYQQQHNAMVLAHWLQDSCGFAPTEQNSQ 304

Query: 276 VLKSITHSSLQKESFVKKQLKGGYGPVFSISLMNKEQCKKF--PPMLKYFHHATSLGGIE 333
           +           +  + +    G G V SI   + E  +K       KY++   S G + 
Sbjct: 305 LRTRFVGLKSHPQFHLHRSFNSGPGAVLSIETGDIELSEKIVCSKKFKYWNVTVSFGCVN 364

Query: 334 SLVEW-----RAMTDPYIE------QTLIRVSIGCENADDLIQDLANALE 372
           SL+        A  DP +       + LIR+  G E+  DL  DL  A E
Sbjct: 365 SLISMPCKMSHASIDPELRKDRKFPEDLIRICCGIEDVSDLQWDLLGAFE 414

>Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 100/424 (23%), Positives = 177/424 (41%), Gaps = 81/424 (19%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
           L T ++++  ++++ S   PP+ ++TTF+ D ++       ++ D       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EAAQDYD-------YSRSGNPT 54

Query: 64  STRLESIFSEIL---DGHAVIYSSGLAAF---FAAMIHYN------PKRIFIGQSYHGVR 111
            + L++   ++      + +  SSG+ A       ++  N      P  I     Y G +
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTEDHTPTIIAGDDLYGGTQ 114

Query: 112 AIANIL------------TRNF---QTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDL 156
            + N              T NF   +T   +LD++       D V LE+P NP    +D+
Sbjct: 115 RLLNFFKHQTHAVTVHVDTSNFDRFKTVFQSLDKV-------DCVLLESPTNPLCKVVDI 167

Query: 157 EDFAK--KAHEKGALLLVDSTFAPP----PLQNVWDFNVDIIMHSATKYFGGHSDLLSGV 210
               +  K       ++VD+T        PLQ   + + D++  SATKY  GH DL+ GV
Sbjct: 168 PKILRYVKCVSPDTKVIVDNTMMSGLNCNPLQ--LNPSCDVVYESATKYLNGHHDLMGGV 225

Query: 211 LVVKEEAVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNR 270
           ++ K   +A +L       G  ++ ++S++L+R L+T  +R+ +Q  NA  +  +L+ + 
Sbjct: 226 IISKTAEIASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLEDSC 285

Query: 271 DKYDKVLKSITHSSLQKESFVK----------KQLKGGYGPVFSISLMNKEQCKKF--PP 318
                  K    +   K  FV           +    G G V S    + E  K+     
Sbjct: 286 G-----FKPTATNKATKTRFVGLRSNPDFKLHQSFNNGPGAVLSFETGSFEHSKRLVSSK 340

Query: 319 MLKYFHHATSLGGIESLVEW-----RAMTDPYIE------QTLIRVSIGCENADDLIQDL 367
            L  +    S G + SL+        A  DP +       + L+R+  G EN  DL +DL
Sbjct: 341 KLNIWAVTVSFGCVNSLLSMPCKMSHASIDPEVRKERDFPEDLVRLCCGIENIVDLKKDL 400

Query: 368 ANAL 371
             A+
Sbjct: 401 LAAM 404

>Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W
           (REAL)
          Length = 401

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 87/354 (24%), Positives = 149/354 (42%), Gaps = 23/354 (6%)

Query: 45  ENLDFMEKTPIYSRLAHPNSTRLESIFSEILDGHAVIYS-SGLAAFFAAMIHYNPK--RI 101
           E+L+  +    Y     P    LE  ++ +      + S SGL +   A++  +     I
Sbjct: 46  EDLEQRKGRFFYGTAGSPTIANLEDAWTHLTGSAGTVLSPSGLGSISLALLTLSKAGDHI 105

Query: 102 FIGQS-YHGVRAIANILTRNFQTKQHTLD-----EIEQFAQPGD-IVHLETPVNPFGTSL 154
            I  S Y   R + + L   F  +    D     +IE+  +P   ++ LE+P +      
Sbjct: 106 LITDSVYFPTRMLCDGLLAKFGIETEYYDPSIGEDIEKLVKPNTTVIFLESPGSGTMEIQ 165

Query: 155 DLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVK 214
           ++      A + G   ++D+T+A P   +     +DI + + TKY GGHSDLL G++   
Sbjct: 166 NIPALVSVAKKHGIKTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLLGLVSAN 225

Query: 215 EEAVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYD 274
           EE     LR     +       +  + LR +RT  +R+ +    A  + ++    RD+ +
Sbjct: 226 EECWP-LLRSTYDAMAMLPGADDCLLALRGMRTLHLRLKEAERKALDLAAWF-KKRDEVE 283

Query: 275 KVLKSITHSSLQKESFVKKQLKGGYGPVFSISL---MNKEQCKKFPPMLKYFHHATSLGG 331
           KVL          E +V +  KG  G +FSI L     +   +     +K F    S GG
Sbjct: 284 KVLHPAFEDCPGHEYWV-RDYKGSSG-LFSIVLKDGFTRSGLENMVDNMKVFELGYSWGG 341

Query: 332 IESLVE-----WRAMTDPYIEQTL-IRVSIGCENADDLIQDLANALETLQKESS 379
            +SL+       +    P+      +R+ +G E  +DL +DL    E L +E S
Sbjct: 342 YDSLITPVNPPTQRKAAPWSHNGFALRIQVGLEELEDLKRDLELGFERLTEEIS 395

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 145/356 (40%), Gaps = 29/356 (8%)

Query: 46  NLDFMEKTPIYSRLAHPNSTRLESIFSEILDGHAVIYS-SGLAAFFAAMIHYNPK--RIF 102
           +++ M+    Y     P    LE  ++ +      + S SGL +   A++        I 
Sbjct: 47  DVESMKGRFFYGTAGSPTIANLEDAWTHLTGAAGTVLSPSGLGSITLALMTLAKAGDHIL 106

Query: 103 IGQS-YHGVRAIANILTRNFQTKQHTLD-----EIEQFAQPG-DIVHLETPVNPFGTSLD 155
           I  S Y   R + + L   F  +    D     +IE+  +P   ++ LE+P +      D
Sbjct: 107 ITDSVYVPTRVLCDGLLAKFGIQTEYYDPTVGEDIEKLVKPNTSVIFLESPGSGTMEIQD 166

Query: 156 LEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKE 215
           +      A + G   ++D+T+A P   +     +DI + + TKY GGHSD L G+    +
Sbjct: 167 IPALVSIAKKHGIRTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDFLLGLTSANQ 226

Query: 216 EA--VARQLRDDRIYL-GTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDK 272
           E   + R   D    L G +   L     LR +RT  +R+ +    A  + ++L   RD+
Sbjct: 227 ECWPLLRSTYDAMAMLPGADDCQLA----LRGMRTLHLRLKEAERKALDLAAWL-GKRDE 281

Query: 273 YDKVLKSITHSSLQKESFVKKQLKGGYGPVFSISL---MNKEQCKKFPPMLKYFHHATSL 329
            + VL            +  +  KG  G +FSI L     +   +     +K FH   S 
Sbjct: 282 VETVLHP-AFEDCPGHKYWLRDYKGSSG-LFSIVLKEGFTRAGLESMVEKMKIFHLGFSW 339

Query: 330 GGIESLV------EWRAMTDPYIEQTLIRVSIGCENADDLIQDLANALETLQKESS 379
           GG ESL+      E R   +       +R+ +G E   DL +DL    E L  E S
Sbjct: 340 GGYESLITPVKPAEQRKPHNWPHRGFALRIQVGLEELSDLKRDLELGFERLAAELS 395

>KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 109/458 (23%), Positives = 179/458 (39%), Gaps = 111/458 (24%)

Query: 2   AHLSTALIHS---DDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP--IY 56
           +H  T  +H+   D  DN     A PI  TT++ +D+      ++  +  F  + P  +Y
Sbjct: 3   SHFDTIQLHAGQEDAGDNAHRPRAVPIYATTSYVFDD------SKHGSQLFGLEVPGYVY 56

Query: 57  SRLAHPNSTRLES-IFSEILDGHAVIYSSGLAA---FFAAMIHYNPKRIFIGQSYHGVRA 112
           SR  +P S  LE  I +      A+  +SG AA       + H     +     Y G   
Sbjct: 57  SRFQNPTSNVLEERIAALEGGAAALAVASGQAAQTLAIQGLAHNGDNIVATSYLYGGTYN 116

Query: 113 IANILTRNFQTKQHTL-----DEIE-QFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEK 166
              +  + F  +   +     D+ E QF +    V+LE+  NP     D E     AH+ 
Sbjct: 117 QFKVAFKRFGIEARFVEGDNQDDFEKQFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKH 176

Query: 167 GALLLVDSTFAPP-----PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLV--------- 212
           G  ++VD+TF        P++    + VDI+ HSATK+ GGH   L GV++         
Sbjct: 177 GIPVMVDNTFGAGGFFCQPIK----YGVDIVTHSATKWIGGHGTTLGGVIIDSGKFPWKD 232

Query: 213 ------------------VKEEAVA----------RQLRDDRIYLGTNVANLESFMLLRS 244
                             +  EA              LRD    LG+ ++   +F+LL+ 
Sbjct: 233 YPEKFPQFSKPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGSLMSPFAAFLLLQG 288

Query: 245 LRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYGP 301
           + T  +R  +  ENA K+  +L+ +       +  +++  L   S     KK L  G+G 
Sbjct: 289 VETLSLRGERHGENALKLAKWLEQS-----PYVSWVSYPGLPSHSHHENAKKYLSNGFGG 343

Query: 302 VFSISLMN-----------KEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPY----- 345
           + S  + +           K    +    LK   +  ++G  ++LV       PY     
Sbjct: 344 MLSFGVKDLPNADTETDPFKLSGAQVVDNLKIASNLANVGDSKTLV-----IAPYFTTHQ 398

Query: 346 -----------IEQTLIRVSIGCENADDLIQDLANALE 372
                      + + LIRVS+G E  DD+I D   + E
Sbjct: 399 QLNDEEKLASGVTKDLIRVSVGTEFIDDIINDFQQSFE 436

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 110/465 (23%), Positives = 182/465 (39%), Gaps = 118/465 (25%)

Query: 2   AHLSTALIHS-----DDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP-- 54
           +H  T  +H+     DD  NR   V  PI  TT++ +++ +        NL F  K P  
Sbjct: 3   SHFDTIQLHAGQENPDDNANRPRAV--PIYATTSYVFNDSE-----HGSNL-FGLKVPGY 54

Query: 55  IYSRLAHPNSTRLESIFSEILDG-HAVIYSSGLAA---FFAAMIHYNPKRIFIGQSYHGV 110
           +YSR  +P    LE   + +  G  AV  +SG AA       + H     I     Y G 
Sbjct: 55  VYSRFQNPTQNVLEERMAALEGGVAAVAVASGQAAQTLAICGLAHSGDNIISTSFLYGGT 114

Query: 111 RAIANILTR--NFQTKQHTLDEIEQFAQPGD----IVHLETPVNPFGTSLDLEDFAKKAH 164
                +  +    + +  T D  + F +  D     V+LE+  NP     D E   + AH
Sbjct: 115 YNQFKVAFKRLGIEARFVTGDNPDDFEKLIDDKTKAVYLESIGNPKYNVPDFEKIVEIAH 174

Query: 165 EKGALLLVDSTFAPP-----PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLV------- 212
           + G  ++VD+TF        P++    +  DI+ HSATK+ GGH   ++G++V       
Sbjct: 175 KHGVPVVVDNTFGAGGFFCQPIK----YGADIVTHSATKWIGGHGTTIAGMIVDSGKFPW 230

Query: 213 --------------------VKEEAVA----------RQLRDDRIYLGTNVANLESFMLL 242
                               +  EA              LRD    LG  ++   +F+L+
Sbjct: 231 ADYPEKFPQFSKPAEGYHGTIFNEAYGNLAYIVHVRVELLRD----LGPAISPFAAFLLI 286

Query: 243 RSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGY 299
           + + T  +R  +  +NA K+  +L+ +       +  +++  L    +    KK L  G+
Sbjct: 287 QGIETLSLRGERHGQNALKLAQWLEQS-----PYVSWVSYPGLPSHPYHENAKKYLSNGF 341

Query: 300 GPVFSISLMN-----KEQCKKFP---------PMLKYFHHATSLGGIESLVEWRAMTDPY 345
           G V S  + +     KE+    P           LK   +  ++G  ++LV       PY
Sbjct: 342 GGVLSFGVKDIPGQTKEELAAKPFSASGAQVVDSLKLASNLANVGDSKTLV-----IAPY 396

Query: 346 ----------------IEQTLIRVSIGCENADDLIQDLANALETL 374
                           + + LIRVS+G E  DD+I D   + E +
Sbjct: 397 FTTHEQLDDDEKLLSGVTKDLIRVSVGTEFIDDIIADFQQSFEKV 441

>NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 105/461 (22%), Positives = 181/461 (39%), Gaps = 110/461 (23%)

Query: 2   AHLSTALIHS-----DDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP-- 54
           +H  T  +H+     DD  NR   V  PI  TT++ +++      ++     F  + P  
Sbjct: 3   SHFDTVQLHAGQENPDDNKNRPRAV--PIYATTSYVFND------SKHGAQLFGLEVPGY 54

Query: 55  IYSRLAHPNSTRLESIFSEILDGHA-VIYSSGLAA---FFAAMIHYNPKRIFIGQSYHGV 110
           +YSR  +P +   E   + +  G A V  SSG AA     + + H     +     Y G 
Sbjct: 55  VYSRFQNPTNNVFEERIAALEGGAAAVAVSSGQAAQTLAISGLAHVGDNIVSTSYLYGGT 114

Query: 111 RAIANILTRNFQTKQHTLD-----EIEQ-FAQPGDIVHLETPVNPFGTSLDLEDFAKKAH 164
                +  +    +   +D     + E+ F +    V+LE+  NP     D E     AH
Sbjct: 115 YNQFKVAFKRLGVEARFVDGDNPADFEKLFDERTKAVYLESIGNPKYNVPDFEGIVAVAH 174

Query: 165 EKGALLLVDSTFAPP-----PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEE--- 216
           + G  ++VD+TF        PL+    F  DI+ HSATK+ GGH   ++GV+V   +   
Sbjct: 175 KHGIPVVVDNTFGAGGFFCQPLK----FGADIVTHSATKWIGGHGTTVAGVVVDSGKFPW 230

Query: 217 -------------------AVARQLRDDRIY-----------LGTNVANLESFMLLRSLR 246
                               +  +   +  Y           LG  +    +F+LL+ + 
Sbjct: 231 KDYPEKFPQFSKPAEGYHGTIFNETYGNLAYIVHVRVELLRDLGPGMNPFAAFLLLQGVE 290

Query: 247 TFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYGPVF 303
           T  +R  + + NA  +  +L+ +       +  +++  L+  S     KK L  G+G V 
Sbjct: 291 TLSLRCERHASNALALAKWLEKS-----PYVSWVSYPGLESHSHHENAKKYLSNGFGGVL 345

Query: 304 SISL-----MNKEQCKKFP---------PMLKYFHHATSLGGIESLVEWRAMTDPY---- 345
           S  +      ++E+ KK P           L+   +  ++G  ++LV       PY    
Sbjct: 346 SFGVKDLPNQSEEEVKKNPFAASGAQVVDSLQLASNLANVGDSKTLV-----IAPYFTTH 400

Query: 346 ------------IEQTLIRVSIGCENADDLIQDLANALETL 374
                       + + LIRVS+G E  DD+I D   + E +
Sbjct: 401 QQLDDDEKLLSGVTKDLIRVSVGTEFIDDIIGDFQQSFEKV 441

>TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa]
           {ON}  YFR055W
          Length = 402

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 86/356 (24%), Positives = 149/356 (41%), Gaps = 25/356 (7%)

Query: 45  ENLDFMEKTPIYSRLAHPNSTRLESIFSEILDGHAVIYS-SGLAAFFAAMIHY--NPKRI 101
           E+L+ +     Y     P    LE  ++E+      + S +GL +   A++    +   I
Sbjct: 46  ESLESLGGRFWYGTAGSPTIANLEDSWTELTGAAGTVLSPTGLGSISLAILSVVKHGDHI 105

Query: 102 FIGQSYHGVRA-IANILTRNFQTKQHTLD-----EIEQFAQPG-DIVHLETPVNPFGTSL 154
            +  S +G  A   N + R F       D     +IE+  +    ++ LE+P +      
Sbjct: 106 LLPISVYGPTANFCNNVLRKFGVNSEFYDPLIGKDIEELIKTNTSLIFLESPCSQTMEIQ 165

Query: 155 DLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVK 214
           D+    K A +     ++D+T+A P      D+ +DI + + TKY GGHSDLL G L   
Sbjct: 166 DVPAIVKVAKKHNVKTVLDNTWATPLFFKAHDYGIDISVEAGTKYVGGHSDLLLG-LTSA 224

Query: 215 EEAVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYD 274
                  LR     +G      +  + LR LRT ++R+ +    A  +  +L++ R++ +
Sbjct: 225 NSRCWPALRSTYDAMGMLPGADDCHLALRGLRTLQLRVKEAERKALILAEWLEA-RNEVE 283

Query: 275 KVLKSITHSSLQKESFVKKQLKGGYGPVFSISL---MNKEQCKKFPPMLKYFHHATSLGG 331
           ++L           S   +   G  G VF+  L    ++   K     ++ F    S GG
Sbjct: 284 RILHP-AFEDCPGHSLWVRDYSGSTG-VFTFILKDQFSRAGLKDMLEKMQIFKLGYSWGG 341

Query: 332 IESLV-------EWRAMTDPYIEQTLIRVSIGCENADDLIQDLANALETLQKESSN 380
            ESL+         R  T  +    L R+ +G E+ DD ++DL    E L+   S+
Sbjct: 342 YESLLIPVNSTSRDRIRTWSHFGYAL-RIQVGLEDIDDQLRDLEMGFERLKSHVSD 396

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 125/293 (42%), Gaps = 17/293 (5%)

Query: 52  KTPIYSRLAHPNSTRLESIFSEILDGHAVIYS-SGLAAFFAAMIHYNPK--RIFIGQS-Y 107
           K   Y     P    LE+ ++ +  G   + S SGL +   A++  +     I +  S Y
Sbjct: 52  KGRFYGTAGSPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVY 111

Query: 108 HGVRAIANILTRNFQTKQHTLD-----EIEQFAQPGD-IVHLETPVNPFGTSLDLEDFAK 161
              R + + L   F  +    D     +IE+  +P   ++ LE+P +      D+     
Sbjct: 112 VPTRMLCDGLLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVS 171

Query: 162 KAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQ 221
            A + G   ++D+T+A P   +     +DI + + TKY GGHSDLL G+    EE     
Sbjct: 172 VAKKHGIKTILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIGLASANEECWP-L 230

Query: 222 LRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSIT 281
           LR     +       +  + LR +RT  +R+ +    A  + ++L  NRD+ +KVL    
Sbjct: 231 LRSTYDAMAMLPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWL-GNRDEVEKVLHPAF 289

Query: 282 HSSLQKESFVKKQLKGGYGPVFSISLMN---KEQCKKFPPMLKYFHHATSLGG 331
                 E +V +  KG  G +FSI L N   +   +K    +K      S GG
Sbjct: 290 EDCPGHEYWV-RDYKGSSG-LFSIVLKNGFTRAGLEKMVEGMKVLQLGFSWGG 340

>TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.354
           YJR130C
          Length = 717

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 129/281 (45%), Gaps = 34/281 (12%)

Query: 126 HTLDEIEQFAQPGD---IVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQ 182
            ++ E+EQ    G+    V +E P NP     DL+     A+  G  +++D T       
Sbjct: 438 ESMKELEQTLHSGEQILAVFIEIPSNPLLKVADLKYLRNLANIYGFYIVIDETLGGFVNI 497

Query: 183 NVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLG------TNVANL 236
           +V  F  DI+  S ++ FGG S++++G +V+  +    Q    +++L         V   
Sbjct: 498 DVLPF-ADIVCSSLSQSFGGDSNVMAGSMVLNPQEKLYQFA--QLFLNQLGEYENYVWCE 554

Query: 237 ESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQ----KESFVK 292
           ++ +L R+ R F  R +  + N+  +++ +    +  DK+ K I + SL     KE++ K
Sbjct: 555 DAIILERNSRDFIPRSITINHNSEYLINEVLLPNEGPDKIFKKIYYPSLTSDETKENYDK 614

Query: 293 KQLK---------GGYGPVFSISLMNKEQCKKF--------PPMLKYFHHATSLGGIESL 335
            + K         GGYG + S++  N +  K+F         P L   H       I S 
Sbjct: 615 LRCKKIPNFEKEEGGYGGIISLTFHNLDTSKRFFDEINITKGPSLSTNHTLACPYTILSY 674

Query: 336 VEWRAMTDPY-IEQTLIRVSIGCENADDLIQDLANALETLQ 375
            +  A  + + +E+ LIR+ IGCE+ +DL +   +A+E  Q
Sbjct: 675 FDNLAQVEKFGVEENLIRIKIGCESKEDLAKVFLHAIEKAQ 715

>TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {ON}
           Anc_4.53 YLR303W
          Length = 442

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 105/449 (23%), Positives = 181/449 (40%), Gaps = 90/449 (20%)

Query: 2   AHLSTALIHS---DDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP-IYS 57
           +H  T  +H+   D  DN     A PI  TT+F +++           L  +EK   +YS
Sbjct: 3   SHFDTVQLHAGQEDPGDNAHRPAAVPIYQTTSFVFEDSH-----HGAQLFGLEKPGYMYS 57

Query: 58  RLAHPNSTRLES-IFSEILDGHAVIYSSGLAA---FFAAMIHYNPKRI----FIGQSYHG 109
           R+ +P    LE  + +      AV  SSG AA       + H     +      G +Y+ 
Sbjct: 58  RVGNPTVDVLEKRLAALEGGAAAVCVSSGQAAQTLAITGLAHCGDNIVSTSYLYGGTYNQ 117

Query: 110 VRAIANILTRN--FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKG 167
            +     L  +  F    +  D  + F +    V++E+  NP     D E     AH+ G
Sbjct: 118 FKVAFKRLGIDVRFVLGDNPEDFEKLFDEKTKAVYIESIGNPKYNVPDFEKIVAVAHKHG 177

Query: 168 ALLLVDSTFAPP-----PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLV---------- 212
             ++VD+TF        P+++     VDI+ HSATK+ GGH   ++GV+V          
Sbjct: 178 IPVVVDNTFGAGGFFCQPIKH----GVDIVTHSATKWIGGHGTTIAGVIVDSGKFPWKDY 233

Query: 213 ----------------------VKEEAVARQLRDDRIY-LGTNVANLESFMLLRSLRTFE 249
                                 +   A    +R + +  LG  +  + +F+LL+ + T  
Sbjct: 234 PEKFPQFSKPSEGYHGMIFNDAMGPLAYIAHVRTELLRDLGPVMEPIAAFLLLQGVETLS 293

Query: 250 MRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYGPVFSIS 306
           +R  +Q +NA K+  +L+ +       +  +++  L    +    KK L  G+G V SI 
Sbjct: 294 LRAERQGQNALKLAQWLEKSPH-----VNWVSYPGLPSHPYHDNAKKYLDNGFGGVLSIG 348

Query: 307 LMNKEQCKKFPPM----------LKYFHHATSLGGIESLV------EWRAMTD-----PY 345
           +   +      P           LK   +  ++G  ++LV        + ++D       
Sbjct: 349 VKPLKDVSDSDPFKKSGAQVVDNLKLALNLANVGDSKTLVIAPYFTTHQQLSDEDKLKSG 408

Query: 346 IEQTLIRVSIGCENADDLIQDLANALETL 374
           + + LIR+SIG E  DD+I D   + E +
Sbjct: 409 VTEDLIRISIGTEFIDDIIADFEQSFEKV 437

>KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 105/454 (23%), Positives = 175/454 (38%), Gaps = 103/454 (22%)

Query: 2   AHLSTALIHS---DDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLD-FMEKTP--I 55
           +H  T  +H+   D  DN     A PI  TT++ +++        +   D F  K P  +
Sbjct: 3   SHFDTVQLHAGQEDPNDNNHRPRAVPIYATTSYVFED-------SKHGADLFGLKVPGYV 55

Query: 56  YSRLAHPNSTRLES-IFSEILDGHAVIYSSGLAA---FFAAMIHYNPKRIFIGQSYHGVR 111
           Y R  +P    LE  + +      A+  +SG AA       + H     +     Y G  
Sbjct: 56  YGRFQNPTQAVLEDRLAALEGGAAALATASGQAAQTLAIQGLAHCGDNIVSTSFLYGGTY 115

Query: 112 AIANILTRNFQTKQHTL--DEIEQFAQPGD----IVHLETPVNPFGTSLDLEDFAKKAHE 165
               +  + F  +   +  D  E F +  D     V+LE+  NP     D E     AH+
Sbjct: 116 NQFKVAFKRFGIEARFVEGDSPEDFEKVFDERTKCVYLESIGNPKYNVPDFEKIVAVAHK 175

Query: 166 KGALLLVDSTFAPP-----PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLV-------- 212
            G  ++VD+TF        PL+    +  DI+ HSATK+ GGH   L G++V        
Sbjct: 176 HGIPVMVDNTFGAGGFFCQPLK----YGADIVTHSATKWIGGHGTTLGGIIVDSGKFPWK 231

Query: 213 -------------------VKEEAVA----------RQLRDDRIYLGTNVANLESFMLLR 243
                              +  EA              LRD    LG+ ++   +F+L++
Sbjct: 232 DYPEKFPQFSKPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGSMISPFAAFLLIQ 287

Query: 244 SLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYG 300
            + T  +R  +  +NA K+  +L+++       +  +++  L   S     KK L  G+G
Sbjct: 288 GVETLSLRGERHGQNALKLAKWLEAS-----PYVSWVSYPGLPSHSHHENAKKYLSNGFG 342

Query: 301 PVFSISLMN-----------KEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTD------ 343
            + S  + +           K    +    LK   +  ++G  ++LV     T       
Sbjct: 343 GMLSFGVKDLPNAATETDPFKLSGAQVVDNLKLASNLANVGDSKTLVIAPFFTTHEQLAD 402

Query: 344 -----PYIEQTLIRVSIGCENADDLIQDLANALE 372
                  + + LIRVS+G E  DD+I+D   A E
Sbjct: 403 EEKLASGVTKDLIRVSVGTEYIDDIIEDFKQAFE 436

>ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR303W (MET17)
          Length = 467

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 107/455 (23%), Positives = 175/455 (38%), Gaps = 103/455 (22%)

Query: 3   HLSTALIHSDDKD---NRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP--IYS 57
           H  T  +H+  +D   N  S  A PI  TT++ +++      ++     F  + P  IYS
Sbjct: 4   HFDTLQLHAGQEDAAENANSPRAVPIYATTSYVFND------SKHGAQLFGLEAPGFIYS 57

Query: 58  RLAHPNSTRLES-IFSEILDGHAVIYSSGLAAFFAA---MIHYNPKRI----FIGQSYHG 109
           R+ +P +  LE  I +      A+  +SG AA   A   + H     +      G SY+ 
Sbjct: 58  RIMNPTNDVLEKRIAALEGGAAALAVASGQAAQLVAIGGLAHAGDNIVSTSYLYGGSYNQ 117

Query: 110 VRAIANILT--RNFQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKG 167
            +     L     F    +  D   +F      V LE+  NP     D E     AH  G
Sbjct: 118 FKVAFKRLGIECRFVEGDNAEDFEARFDSKTKAVFLESIGNPKYNVPDFERIVAVAHRHG 177

Query: 168 ALLLVDSTF-APPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLV-------------- 212
             ++VD+TF A         F  DI+ HSATK+ GGH   + G++V              
Sbjct: 178 IPVVVDNTFGAGGYFCQPIKFGADIVTHSATKWIGGHGTAIGGLVVDSGKFPWKDYPAKF 237

Query: 213 -------------VKEEAVA----------RQLRDDRIYLGTNVANLESFMLLRSLRTFE 249
                        V  EA+             LRD    LG  ++   +F+ L+ L T  
Sbjct: 238 PQFSEPSEGYHGLVLNEALGPLAFVGHARIELLRD----LGPALSPFAAFLFLQGLETLS 293

Query: 250 MRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVK---KQLKGGYGPVFSIS 306
           +R  +  +NA  +  +L+++       +  +++  L+   ++    + L+ GYG V S  
Sbjct: 294 LRAERHGQNALALAKYLETS-----AYVSWVSYPGLESHDYLSNATRYLQNGYGGVLSFG 348

Query: 307 LMN-----------KEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPY---------- 345
           +             K    +F   LK+  +  ++G  ++LV       PY          
Sbjct: 349 VKPLPDTDEEADPFKAAGAQFVDNLKFASNLANVGDSKTLV-----IAPYFTTHQQLSES 403

Query: 346 ------IEQTLIRVSIGCENADDLIQDLANALETL 374
                 + + LIRVS+G E   D+I D   A  T+
Sbjct: 404 EKLASGVTRDLIRVSVGTEYLQDIIADFEQAFSTV 438

>Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON}
           (117344..118678) [1335 nt, 445 aa]
          Length = 444

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 102/452 (22%), Positives = 173/452 (38%), Gaps = 95/452 (21%)

Query: 2   AHLSTALIHSDDKDNRVSDVAP---PINVTTTFRYDNDDLVPWTERENLDFMEKTP--IY 56
           +H  T  +H+  +D   +   P   PI  TT++ +++      ++     F  +TP  IY
Sbjct: 3   SHFDTIQLHAGQEDASTNANNPNAVPIYATTSYVFND------SKHGAQLFGLETPGYIY 56

Query: 57  SRLAHPNSTRLESIFSEILDGHAVI-YSSGLAA---FFAAMIHYNPKRI----FIGQSYH 108
           SR+ +P     E   + +  G A +  SSG AA       + H     +      G +Y+
Sbjct: 57  SRIMNPTVDVFEKRIAALEGGIAALAVSSGQAAQTLAITGLAHAGDNIVSTSYLYGGTYN 116

Query: 109 GVRAIANILTRN--FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEK 166
             +     L  N  F       D  + F +    V+LET  NP     D E   + AH+ 
Sbjct: 117 QFKVAFKRLGINVKFVEGDDPKDFEKLFDEKTKAVYLETIGNPKYNVPDFEKITEVAHKH 176

Query: 167 GALLLVDSTF-APPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLV------------- 212
           G  ++VD+TF A         +  DI+ HSATK+ GGH   ++G ++             
Sbjct: 177 GIPVVVDNTFGAGGYFCQPIKYGCDIVTHSATKWIGGHGTTVAGAIIDSGKFPWKDYPER 236

Query: 213 -------------------VKEEAVARQLRDDRIY-LGTNVANLESFMLLRSLRTFEMRM 252
                                  A    +R + +  LG  +    +F+LL+ + T  +R 
Sbjct: 237 FPQFSKPSEGYHGLVFNDAFGPAAFIGHVRTELLRDLGPCLDAFSAFLLLQGVETLSLRG 296

Query: 253 LKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYGPVFSISLMN 309
            +  EN  K+  +L+ +       +  +++  L   S     KK L  G+G V S  + +
Sbjct: 297 ERHGENTLKLAKWLEKS-----PYVSWVSYPGLPSHSHHENAKKYLSNGFGGVLSFGVKD 351

Query: 310 -----------KEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPY------------- 345
                      K    +    LK   +  ++G  ++LV       PY             
Sbjct: 352 LPNASDEKDPFKASGAQVVDNLKLALNLANVGDSKTLV-----IAPYFTTHQQLNEEEKL 406

Query: 346 ---IEQTLIRVSIGCENADDLIQDLANALETL 374
              + + LIRVS+G E  DD+I D   + E +
Sbjct: 407 ASGVTKDLIRVSVGTEYIDDIIADFQQSFEKV 438

>KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON}
           similar to uniprot|Q12198 Saccharomyces cerevisiae
           YLL058W Hypothetical ORF
          Length = 568

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 116/261 (44%), Gaps = 37/261 (14%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYF 200
           V LETP NP     DL+     A+E G  ++VD T     + +V  +  DI+  S TK F
Sbjct: 320 VFLETPSNPMLNMPDLKQLRNMANEYGFFIVVDDTIGGLNV-DVLPY-ADIVCTSLTKLF 377

Query: 201 GGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL----ESFMLLRSLRTFEMRMLKQS 256
            G S+++ G +++  ++        + + G     L    ++ +L  + R FE R  + +
Sbjct: 378 SGSSNVMGGSIILNPKSALYSCAL-QYFRGGEFEELLWLEDAIILEANSRDFEERTTRTN 436

Query: 257 ENATKIVSFLDSNRDKYDKVLKSITHSSLQ-KESFVK----KQLKGGYGPVFSISLMNKE 311
           EN  K++   +    +  K+ K + + ++  KE+F      +   GGYG +FS+S  N+E
Sbjct: 437 ENTMKLIQ--EVLLPEEGKIFKKVYYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFNEE 494

Query: 312 QCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYI----------------EQTLIRVSI 355
             KKF   L  F   ++            +  PY+                  +L+RVS+
Sbjct: 495 DAKKFYNSLTVFKGPSNGTNF-------TLACPYVHLAHHFELEEVSTFGAHSSLVRVSV 547

Query: 356 GCENADDLIQDLANALETLQK 376
           G EN   L+   ++ +  L+K
Sbjct: 548 GLENTQWLLNAFSSVINLLRK 568

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 126/298 (42%), Gaps = 26/298 (8%)

Query: 91  AAMIHYNP---KRIFIGQSYHGVRAI------ANILTRNFQTKQHTLDEIEQFAQPGDIV 141
           A+++ Y P   K +  G  Y    +I       + L     T   TL EI    +    V
Sbjct: 360 ASVVGYGPPYKKTVMFGFPYTDTLSILSKFNHTHFLGMGDSTAMDTLKEILHSGEQILAV 419

Query: 142 HLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFG 201
            +ETP NP     DL +  + A   G  ++VD T       +V   + D++  S TK F 
Sbjct: 420 FMETPSNPLLKMGDLLELKRLADIYGFYVVVDETAGGFVNIDVLP-HADLVCSSLTKIFS 478

Query: 202 GHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL---ESFMLLRSLRTFEMRMLKQSEN 258
           G S++++G LV+   +   +   +    G     L   ++  L R+ R F  R LK + N
Sbjct: 479 GDSNVMAGSLVLNPNSRLHEFAQEFFRNGEYEDCLWCEDAIYLERNSRDFVTRTLKVNSN 538

Query: 259 ATKIVS--FLDSNRDKYDKVLKSITHSSLQKESF--VKKQLKGGYGPVFSISLMNKEQCK 314
           A  +++   +      + K+      S   K+++  V+ +  GGYG +FS++    EQ K
Sbjct: 539 AEMLLNDVLIPEEGHLFSKIYYPRLTSEETKQNYDTVRCKPNGGYGGLFSLTFYEIEQAK 598

Query: 315 KF---------PPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADDL 363
           KF         P +   F  A     +    E   +    +E  L+RVS+G E+A+ L
Sbjct: 599 KFFNALELCKGPSLGTNFTLACPYAVLAHYAELEKVAQYGVEANLVRVSVGLEDAEHL 656

>Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON}
           YLL058W - Hypothetical ORF [contig 245] FULL
          Length = 571

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 120/268 (44%), Gaps = 43/268 (16%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDI------IMH 194
           V +ETP NP     DL+   K A E G  +++D T        +   NVDI      +  
Sbjct: 317 VFVETPSNPLLNVPDLDKLRKLADEYGFFIVIDDT--------IGGLNVDILPYADIVCT 368

Query: 195 SATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL----ESFMLLRSLRTFEM 250
           S TK F G S+++ G +++  ++       +  +      +L    ++ +L  + R FE 
Sbjct: 369 SLTKLFSGTSNVMGGSVLLNPDSSLYPYAQE-YFQSCEFEDLLWSEDAVVLEANSRDFEA 427

Query: 251 RMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVK-----KQLKGGYGPVFSI 305
           R L+ +EN   +++ +    +   K++K + + ++  E   K     +  +GGYG +FSI
Sbjct: 428 RTLRTNENTVNLLTKVLLPEE--GKLIKKVYYPTVSSEETFKNYERVRNRQGGYGCLFSI 485

Query: 306 SLMNKEQCKKFPPMLKYFHHATS------------LGGIESLVEWRAM-TDPYIEQTLIR 352
           +  N+E  K F   LK F   ++            L     LVE   +  DP     L+R
Sbjct: 486 AFHNEEDAKCFYDSLKVFKGPSNGTNFTLACPYVHLAHHFELVEVAELGADP----NLVR 541

Query: 353 VSIGCENADDLIQDLANALETLQKESSN 380
           VS+G E    L +   NALE  ++ S++
Sbjct: 542 VSVGLEEFQGLREVFLNALEVTKQNSTS 569

>ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 445

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 109/463 (23%), Positives = 183/463 (39%), Gaps = 116/463 (25%)

Query: 2   AHLSTALIHSDDKD-----NRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP-- 54
           +H  T  +H+  +D     NR   V  PI  TT++ +D+      ++  +  F  +TP  
Sbjct: 3   SHFDTIQLHAGQEDPSEHSNRPRAV--PIYSTTSYVFDD------SKHGSQLFGLETPGY 54

Query: 55  IYSRLAHPNSTRLESIFSEILDG-HAVIYSSGLAA---FFAAMIHYNPKRIFIGQSYHGV 110
           IYSR+ +P +   E   + +  G  A+  SSGLAA       + H     +     Y G 
Sbjct: 55  IYSRIMNPTADVFERRIAALEGGVGALAVSSGLAAQTLAITGLAHAGDNIVSTSYLYGGT 114

Query: 111 RAIANILTRNFQTKQHTLDEIE------QFAQPGDIVHLETPVNPFGTSLDLEDFAKKAH 164
                I  + F  +   ++  +      Q  +    V+LET  NP     D E     AH
Sbjct: 115 YNQFKIAFKRFGIESRFIEGDDPSGLEAQIDERTKAVYLETIGNPKYNVPDFEKIVAIAH 174

Query: 165 EKGALLLVDSTFAPP-----PLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLV------- 212
           + G  ++VD+TF        P+++      D+++HSATK+ GGH   + GV+V       
Sbjct: 175 KHGVPVVVDNTFGAGGYYCQPIKH----GADVVVHSATKWIGGHGTTIGGVIVDSGNFPW 230

Query: 213 --------------------VKEEAVARQ----------LRDDRIYLGTNVANLESFMLL 242
                               V  EA+  Q          LRD    LG +++   +F+LL
Sbjct: 231 KEYPKKFPQFSEPSEGYHGLVFNEALGNQAFIGHVRAELLRD----LGPSLSPFAAFLLL 286

Query: 243 RSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGY 299
           + L T  +R  + + NA K+  +L+ +       +  +++  L   S     KK L  G+
Sbjct: 287 QGLETLSLRAERHASNALKLAQWLEKS-----PYVSWVSYPGLPNHSHHANAKKYLTNGF 341

Query: 300 GPVFSISLMN------------KEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPY-- 345
           G V S    +            K    +    L+   +  ++G  ++LV       PY  
Sbjct: 342 GGVLSFGAKDLPDNPEEKENPFKAAGAQISDNLELASNLANVGDCKTLV-----IAPYFT 396

Query: 346 --------------IEQTLIRVSIGCENADDLIQDLANALETL 374
                         + + LIRVS+G E  DD+I D   + + +
Sbjct: 397 THLQLNHEEKLAAGVSKDLIRVSVGTEFIDDIIADFEQSFKKV 439

>Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ADL031W
          Length = 444

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 105/448 (23%), Positives = 174/448 (38%), Gaps = 84/448 (18%)

Query: 2   AHLSTALIHS--DDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLD-FMEKTP--IY 56
           +H  T  +H+  D   N  +  A PI  T+++ + N        +   D F   TP  +Y
Sbjct: 3   SHYDTLQLHAGQDASANSGNPRAVPIYATSSYVFKN-------SQHGADLFGLNTPGYLY 55

Query: 57  SRLAHPNSTRLESIFSEILDGHAVI-YSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIAN 115
           SR+ +P    LE   + +  G   +  +SG AA   A+         I  S H      N
Sbjct: 56  SRMGNPTVDVLEKRLAALEGGRGCVAVASGQAAQAMALGALAQVGDNIVTSSHLYGGTYN 115

Query: 116 ILTRNFQ--------TKQHTLDEIEQ-FAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEK 166
            L   F+        ++    ++ EQ F      +++E+  NP  T  D E   + AH+ 
Sbjct: 116 QLKVAFKRLGVEVRFSEGGEAEDYEQLFDDKTKALYVESIGNPKYTVPDFEKITEVAHKH 175

Query: 167 GALLLVDSTF-APPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRD- 224
           G  ++VD+TF A        +F  DII HSATK+  GH   ++G +V        Q  D 
Sbjct: 176 GIPVVVDNTFGAAGFFCKPIEFGADIITHSATKWINGHGTAIAGAIVDSGNFPWTQYPDK 235

Query: 225 ------------DRIY--------------------LGTNVANLESFMLLRSLRTFEMRM 252
                         +Y                    LG+ ++   +F+ L+ L T  +R 
Sbjct: 236 FPQFSQPAESYHGMVYNDNFGPLAFIAYVRLELLRDLGSTMSPFTAFLSLQGLETLSLRC 295

Query: 253 LKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYGPVFSISL----- 307
            + + N+  +   L+ +   Y   +      S    +  KK L  G G + S  +     
Sbjct: 296 ERHARNSIDLARHLEDS--PYVAWVSYPGLDSHPSRNNAKKYLTNGAGGMLSFGIKPFDK 353

Query: 308 MNKEQ----------CKKFPPMLKYFHHATSLGGIESLV------EWRAMTD-----PYI 346
            N E+            KF   LK   +  ++G  ++LV        + +TD        
Sbjct: 354 TNGEEEASEVDTSVIAAKFVDSLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLKAGA 413

Query: 347 EQTLIRVSIGCENADDLIQDLANALETL 374
           ++ +IRVS+G E  DD+I D   A +T+
Sbjct: 414 DKDVIRVSVGTEYIDDIIADFEQAFKTV 441

>Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {ON}
           YJR130C (REAL)
          Length = 640

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/355 (23%), Positives = 139/355 (39%), Gaps = 60/355 (16%)

Query: 76  DGHAVIYSSGLAAFFAA---------------------MIHYNP---KRIFIGQSYHGVR 111
           D    ++ SG+A+ F A                     ++ Y P   K +  G  Y    
Sbjct: 293 DTDVYLFPSGMASIFTAHRLLLNFDANRLSRSSTRQDKLVGYGPPFKKTVMFGFPYTDTL 352

Query: 112 AIANILTRNF---QTKQHTLDEIEQFAQPGD---IVHLETPVNPFGTSLDLEDFAKKAHE 165
           +I           Q    ++D +++    G+    V +E P NP     DL++  + +  
Sbjct: 353 SILRKFNHTHFLGQGDSTSMDALKKILHSGEQILAVFIEAPSNPLLKMGDLQELKRLSDL 412

Query: 166 KGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEA----VARQ 221
               ++VD T       +V  +  DII  S TK F G S++++G LV+         A++
Sbjct: 413 YSFYIVVDETVGGFVNIDVLPY-ADIICSSLTKIFSGDSNVIAGSLVLNPRGKIYEFAKK 471

Query: 222 LRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENA----TKIVSFLDSNRDKYDKVL 277
                      +   ++  L R+ R F  R +K + N     TK++        +  K+ 
Sbjct: 472 FMKSENGYEDCLWCEDALCLERNSRDFVERTIKVNTNTDILLTKVL------LPQVGKLF 525

Query: 278 KSITHSSLQKESF------VKKQLKGGYGPVFSISLMNKEQCKKF---------PPMLKY 322
           K I + SL  E        V     GGYG +FS++  + E+ KKF         P +   
Sbjct: 526 KKIYYPSLTSEETKRNYDSVMATRDGGYGGLFSLTFFDIEKAKKFFNNLELCKGPSLGTN 585

Query: 323 FHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADDLIQDLANALETLQKE 377
           F  A     I    E   +    +E+ L+RVS+G EN+D L +    A+E   +E
Sbjct: 586 FTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGLENSDVLCRVFQRAIEKAVEE 640

>Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 83/355 (23%), Positives = 139/355 (39%), Gaps = 60/355 (16%)

Query: 76  DGHAVIYSSGLAAFFAA---------------------MIHYNP---KRIFIGQSYHGVR 111
           D    ++ SG+A+ F A                     ++ Y P   K +  G  Y    
Sbjct: 292 DTDVYLFPSGMASIFTAHRLLLNLDANRLSRSSTRQDKLVGYGPPFKKTVMFGFPYTDTL 351

Query: 112 AIANILTRNF---QTKQHTLDEIEQFAQPGD---IVHLETPVNPFGTSLDLEDFAKKAHE 165
           +I           Q    ++D ++     G+    V +E P NP     DL++  + +  
Sbjct: 352 SILRKFNHTHFLGQGDSTSMDALKSILHAGEQILAVFIEAPSNPLLKMGDLQELKRLSDL 411

Query: 166 KGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEA----VARQ 221
               ++VD T       +V  +  DI+  S TK F G S++++G LV+  +      AR+
Sbjct: 412 YSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIFSGDSNVIAGSLVLNPKGKIYEFARK 470

Query: 222 LRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENA----TKIVSFLDSNRDKYDKVL 277
                      +   ++  L R+ R F  R +K + N     TK++        +  K+ 
Sbjct: 471 FMKTEDGYEDCLWCEDALCLERNSRDFVERTIKVNTNTNILLTKVL------LPQVGKLF 524

Query: 278 KSITHSSLQKESF------VKKQLKGGYGPVFSISLMNKEQCKKF---------PPMLKY 322
           K I + SL  E        V     GGYG +FS++  + E+ KKF         P +   
Sbjct: 525 KKIYYPSLTSEETKRNYDSVISTKDGGYGGLFSLTFFSIEEAKKFFNNLELCKGPSLGTN 584

Query: 323 FHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADDLIQDLANALETLQKE 377
           F  A     I    E   +    +E+ L+RVS+G EN+D L +    A+E   +E
Sbjct: 585 FTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGLENSDVLCKVFQRAIEKALEE 639

>TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 121/304 (39%), Gaps = 86/304 (28%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPP-----PLQNVWDFNVDIIMHS 195
           V+LET  NP     D +     AH+ G  ++VD+TF        P++    +  DI+ HS
Sbjct: 151 VYLETIGNPKYNVPDFDKIVAVAHKHGIPVVVDNTFGAGGFFCQPIK----YGADIVTHS 206

Query: 196 ATKYFGGHSDLLSGVLV---------------------------VKEEAVA--------- 219
           ATK+ GGH   ++G ++                           +  EA+          
Sbjct: 207 ATKWIGGHGTTIAGAIIDSGKFPWKEYPEKFPQFSKPSEGYHGMIFNEAMGNLAFIGHVR 266

Query: 220 -RQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLD-SNRDKYDKVL 277
              LRD    LG  ++   SF+LL+ + T  +R  +Q EN   +  +L+ S    +    
Sbjct: 267 TELLRD----LGPCMSPFASFLLLQGVETLSLRAERQGENTLALAKWLEKSAYVSWVSYP 322

Query: 278 KSITHSSLQKESFVKKQLKGGYGPVFSISLMN----KEQCKKFPPM-------LKYFHHA 326
             ++HS  +     KK L+ G+G V S  + +     E+   F          LK   + 
Sbjct: 323 GLVSHSHHEN---AKKYLRNGFGGVLSFGVKDLPGAAEEKDPFKAAGAQAVDNLKLASNL 379

Query: 327 TSLGGIESLVEWRAMTDPY----------------IEQTLIRVSIGCENADDLIQDLANA 370
            ++G  ++LV       PY                + + LIRVS+G E  DD+I D   +
Sbjct: 380 ANVGDSKTLV-----IAPYFTTHQQLSDEEKLASGVTKDLIRVSVGTEFIDDIIADFQQS 434

Query: 371 LETL 374
            E +
Sbjct: 435 FEKI 438

>Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 117/282 (41%), Gaps = 33/282 (11%)

Query: 122 QTKQHTLDEIEQFAQPGD---IVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAP 178
           Q    ++D ++     G+    V +E P NP     DL++  + +      ++VD T   
Sbjct: 365 QGDCTSMDALKNILHSGEQILAVFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGG 424

Query: 179 PPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEA----VARQLRDDRIYLGTNVA 234
               +V  +  DI+  S TK F G S++++G LV+         AR+           + 
Sbjct: 425 FVNIDVLPY-ADIVCSSLTKIFSGDSNVIAGSLVLNPRGKIYEFARKFMSTEDGYEDCLW 483

Query: 235 NLESFMLLRSLRTFEMRMLKQSENA----TKIVSFLDSNRDKYDKVLKSITHSSLQKESF 290
             ++  L R+ R F  R +K + N     TK++        +  K+ K I + SL  E  
Sbjct: 484 CEDALCLERNSRDFVERTIKVNTNTDVLLTKVL------LPQVGKLFKKIYYPSLTSEET 537

Query: 291 ------VKKQLKGGYGPVFSISLMNKEQCKKF---------PPMLKYFHHATSLGGIESL 335
                 V     GGYG +FS++  N E+ KKF         P +   F  A     I   
Sbjct: 538 KKNYDNVMSTKDGGYGGLFSLTFFNIERAKKFFNSLELCKGPSLGTNFTLACPYAIIAHY 597

Query: 336 VEWRAMTDPYIEQTLIRVSIGCENADDLIQDLANALETLQKE 377
            E   +    +E+ L+RVS+G EN+D L +    A+    +E
Sbjct: 598 QELDEIAQYGVEKNLVRVSVGLENSDVLCKVFQQAIGKASEE 639

>YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON}
           STR2Cystathionine gamma-synthase, converts cysteine into
           cystathionine
          Length = 639

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 82/341 (24%), Positives = 132/341 (38%), Gaps = 52/341 (15%)

Query: 81  IYSSGLAAFFAA---------------------MIHYNP---KRIFIGQSYHGVRAI--- 113
           ++ SG+A+ F A                     +I Y P   K +  G  Y    +I   
Sbjct: 297 LFPSGMASIFTAHRLLLNFDAKRLSRSSSRQDKLIGYGPPFKKTVMFGFPYTDTLSILRK 356

Query: 114 ---ANILTRNFQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALL 170
               + L +   T  + L  I    +    V +E P NP     DL++  + +      +
Sbjct: 357 FNHTHFLGQGDSTSMNALKNILHSGEQILAVFIEAPSNPLLKMGDLQELKRLSDLYSFYI 416

Query: 171 LVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEA----VARQLRDDR 226
           +VD T       +V  +  DI+  S TK F G S++++G LV+         AR+     
Sbjct: 417 VVDETVGGFVNIDVLPY-ADIVCSSLTKIFSGDSNVIAGSLVLNPRGKIYEFARKFMKTE 475

Query: 227 IYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQ 286
                 +   ++  L R+ R F  R +K + N   ++  +     +  K+ K I + SL 
Sbjct: 476 DGYEDCLWCEDALCLERNSRDFVERTIKVNTNTDILLKRV--LLPQVGKLFKKIYYPSLT 533

Query: 287 KESF------VKKQLKGGYGPVFSISLMNKEQCKKF---------PPMLKYFHHATSLGG 331
            E        V     GGYG +FS++  N E+ KKF         P +   F  A     
Sbjct: 534 SEDTKRNYDSVMSTKDGGYGGLFSLTFFNIEEAKKFFNNLELCKGPSLGTNFTLACPYAI 593

Query: 332 IESLVEWRAMTDPYIEQTLIRVSIGCENADDLIQDLANALE 372
           I    E   +    +E  L+RVS+G EN+D L      A+E
Sbjct: 594 IAHYQELDEVAQYGVETNLVRVSVGLENSDVLCNVFQRAIE 634

>YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}
           MET17Methionine and cysteine synthase (O-acetyl
           homoserine-O-acetyl serine sulfhydrylase), required for
           sulfur amino acid synthesis
          Length = 444

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 110/456 (24%), Positives = 172/456 (37%), Gaps = 103/456 (22%)

Query: 2   AHLSTALIHSDDK---DNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP--IY 56
           +H  T  +H+  +   DN     A PI  TT++ ++N      ++  +  F  + P  +Y
Sbjct: 3   SHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFEN------SKHGSQLFGLEVPGYVY 56

Query: 57  SRLAHPNSTRLES-IFSEILDGHAVIYSSGLAA---FFAAMIHYNPKRIFIGQSYHGVRA 112
           SR  +P S  LE  I +      A+  SSG AA       + H     +     Y G   
Sbjct: 57  SRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYN 116

Query: 113 IANILTRNFQTKQHTL--DEIEQFAQPGD----IVHLETPVNPFGTSLDLEDFAKKAHEK 166
              I  + F  +   +  D  E+F +  D     V+LET  NP     D E     AH+ 
Sbjct: 117 QFKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKH 176

Query: 167 GALLLVDSTF-APPPLQNVWDFNVDIIMHSATKYF------------------------- 200
           G  ++VD+TF A         +  DI+ HSATK+                          
Sbjct: 177 GIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEK 236

Query: 201 ---------GGHSDLLS---GVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRSLRTF 248
                    G H  + +   G L          LRD    LG  +    SF+LL+ + T 
Sbjct: 237 FPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGPLMNPFASFLLLQGVETL 292

Query: 249 EMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYGPVFSI 305
            +R  +  ENA K+  +L+ +       +  +++  L   S     KK L  G+G V S 
Sbjct: 293 SLRAERHGENALKLAKWLEQS-----PYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSF 347

Query: 306 SLMNKEQC-KKFPPM----------LKYFHHATSLGGIESLVEWRAMTDPY--------- 345
            + +     K+  P           LK   +  ++G  ++LV       PY         
Sbjct: 348 GVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLV-----IAPYFTTHKQLND 402

Query: 346 -------IEQTLIRVSIGCENADDLIQDLANALETL 374
                  + + LIRVS+G E  DD+I D   + ET+
Sbjct: 403 KEKLASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 442

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 124/317 (39%), Gaps = 90/317 (28%)

Query: 132 EQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPP-----PLQNVWD 186
           +QF +    ++LE+  NP     D E     AH+ G  ++VD+TF        P++    
Sbjct: 141 KQFDEKTKALYLESIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGFFCQPIK---- 196

Query: 187 FNVDIIMHSATKYFGGHSDLLSGVLVVKEE------------------------------ 216
           +  DI+ HSATK+ GGH   ++G ++   +                              
Sbjct: 197 WGADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKDYPEKFPQFSKPSEGYHGLVFNDAFG 256

Query: 217 -------AVARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSN 269
                  A    LRD    LG  ++   SF+LL+ L T  +R  + + NA K+  +L+ +
Sbjct: 257 PLAFIGHARTELLRD----LGPALSPFSSFLLLQGLETLSLRGERHAYNALKLAQWLEKS 312

Query: 270 RDKYDKVLKSITHSSLQKESF---VKKQLKGGYGPVFSISLM----NKEQCKKFPPM--- 319
                  +  +++  L+  +     KK L+ G+G V S  +       E+   F      
Sbjct: 313 -----PYVSWVSYPGLESHTHHENAKKYLQNGFGGVLSFGVKPLPNASEESDPFKASGAQ 367

Query: 320 ----LKYFHHATSLGGIESLVEWRAMTDPY----------------IEQTLIRVSIGCEN 359
               LK   +  ++G  ++LV       PY                +   LIRVS+G E 
Sbjct: 368 VVDNLKLASNLANVGDSKTLV-----IAPYFTTHQQLSHEEKLASGVTDDLIRVSVGTEF 422

Query: 360 ADDLIQDLANALETLQK 376
            DD+I D   + E + K
Sbjct: 423 IDDIIADFEQSFEKIFK 439

>ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {ON}
           similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 640

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 118/272 (43%), Gaps = 30/272 (11%)

Query: 128 LDEIEQFAQPGDIV---HLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNV 184
           ++E+++    G+ +    +E P NP     DL +  + A+  G  ++VD T       +V
Sbjct: 374 MEELKKILHSGEQILALFMEAPSNPLLKMGDLIELRELANSFGFYIVVDDTAGGFVNIDV 433

Query: 185 WDFNVDIIMHSATKYFGGHSDLLSGVLVVK--------EEAVARQLRDDRIYLGTNVANL 236
             F  DI+  S TK F G S++++G +V+          E    Q  +D ++        
Sbjct: 434 LPF-ADIVCSSLTKIFSGDSNVIAGSIVLNPQSKLYSFAETFMEQQYEDCLWCE------ 486

Query: 237 ESFMLLRSLRTFEMRMLKQSENATKIVS--FLDSNRDKYDKVL-KSITHSSLQKESFVKK 293
           ++  L R+ R F  R LK ++N  ++++   L      + K+   S+T    +K     +
Sbjct: 487 DALYLERNSRDFVARTLKVNQNTERLLNKVLLPQEGKLFKKIYYPSLTSKETKKNYDAVR 546

Query: 294 QLKGGYGPVFSISLMNKEQCKKF---------PPMLKYFHHATSLGGIESLVEWRAMTDP 344
             +GGYG +FS++  N +  K F         P +   F  A     I    E   +   
Sbjct: 547 GHQGGYGGLFSLTFYNLDSAKTFFNTLQLCKGPSLGTNFTLACPYAIIAHYQELDRVAKY 606

Query: 345 YIEQTLIRVSIGCENADDLIQDLANALETLQK 376
            +E  L+RVS+G E  D+L +    A++   K
Sbjct: 607 GVESNLVRVSVGLEREDELCKVFQTAIDEASK 638

>Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}
           similar to Ashbya gossypii AER164C
          Length = 681

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 110/249 (44%), Gaps = 19/249 (7%)

Query: 128 LDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDF 187
           L  I    +P   V +ETP NP     DL +  K A      +++D T       +V  +
Sbjct: 414 LKAILHGGEPILAVFIETPSNPLLKMGDLLELRKLADAYDFYVIIDDTIGGFINVDVLQY 473

Query: 188 NVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL----ESFMLLR 243
             DI+  S TK F G S++++G LV+   +   +L   R +   +  +L    +S  L R
Sbjct: 474 -ADIVCSSLTKIFSGDSNVMAGSLVLNPSSRLYKLAR-RFFASDDYEDLLWCEDSIYLER 531

Query: 244 SLRTFEMRMLKQSENATKIV--SFLDSNRDKYDKVLKSITHSSLQKESF--VKKQLKGGY 299
           + R    R +K +ENA +++  + L      + K+      SS  K ++  VK Q  GGY
Sbjct: 532 NSRDCVSRSMKINENAERLLKGTLLPLEGTLFKKIYYPSLTSSETKANYDAVKCQPNGGY 591

Query: 300 GPVFSISLMNKEQCKKF---------PPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTL 350
           G +FS++  + E  K F         P +   F  A     +    E   +    +E+ L
Sbjct: 592 GGLFSLTFFDDECAKAFFNSLDLCKGPSLGTNFTLACPYTILAHYGEMDVVAKYGLEKNL 651

Query: 351 IRVSIGCEN 359
           +RVSIG E+
Sbjct: 652 VRVSIGLED 660

>Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 110/460 (23%), Positives = 173/460 (37%), Gaps = 111/460 (24%)

Query: 2   AHLSTALIHSDDK---DNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP--IY 56
           +H  T  +H+  +   DN     A PI  TT++ ++N      ++  +  F  + P  +Y
Sbjct: 3   SHFDTVQLHAGQENAGDNAHRSRAVPIYATTSYVFEN------SKHGSQLFGLEVPGYVY 56

Query: 57  SRLAHPNSTRLES-IFSEILDGHAVIYSSGLAA---FFAAMIHYNPKRIFIGQSYHGVRA 112
           SR  +P S  LE  I +      A+  SSG AA       + H     +     Y G   
Sbjct: 57  SRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYN 116

Query: 113 IANILTRNFQTKQHTL--DEIEQFAQPGD----IVHLETPVNPFGTSLDLEDFAKKAHEK 166
              I  + F  +   +  D  E F +  D     V+LET  NP     D E     AH+ 
Sbjct: 117 QFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKH 176

Query: 167 GALLLVDSTFAP-----PPLQNVWDFNVDIIMHSATKYF--------------------- 200
           G  ++VD+TF        P++    +  DI+ HSATK+                      
Sbjct: 177 GIPVVVDNTFGAGGYFCQPIK----YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKD 232

Query: 201 -------------GGHSDLLS---GVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRS 244
                        G H  + +   G L          LRD    LG  +    SF+LL+ 
Sbjct: 233 YPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGPLMNPFASFLLLQG 288

Query: 245 LRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYGP 301
           + T  +R  +  ENA K+  +L+ +       +  +++  L   S     KK L  G+G 
Sbjct: 289 VETLSLRAERHGENALKLAKWLEES-----PYVSWVSYPGLASHSHHENAKKYLSNGFGG 343

Query: 302 VFSISLMNKEQC-KKFPPM----------LKYFHHATSLGGIESLVEWRAMTDPY----- 345
           V S  + +     K+  P           LK   +  ++G  ++LV       PY     
Sbjct: 344 VLSFGVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLV-----IAPYFTTHK 398

Query: 346 -----------IEQTLIRVSIGCENADDLIQDLANALETL 374
                      + + LIRVS+G E  DD+I D   + ET+
Sbjct: 399 QLNDKEKLASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 110/456 (24%), Positives = 171/456 (37%), Gaps = 103/456 (22%)

Query: 2   AHLSTALIHSDDK---DNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP--IY 56
           +H  T  +H+  +   DN     A PI  TT++ ++N      ++  +  F  + P  +Y
Sbjct: 3   SHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFEN------SKHGSQLFGLEVPGYVY 56

Query: 57  SRLAHPNSTRLES-IFSEILDGHAVIYSSGLAA---FFAAMIHYNPKRIFIGQSYHGVRA 112
           SR  +P S  LE  I +      A+  SSG AA       + H     +     Y G   
Sbjct: 57  SRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYN 116

Query: 113 IANILTRNFQTKQHTL--DEIEQFAQPGD----IVHLETPVNPFGTSLDLEDFAKKAHEK 166
              I  + F  +   +  D  E F +  D     V+LET  NP     D E     AH+ 
Sbjct: 117 QFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKH 176

Query: 167 GALLLVDSTF-APPPLQNVWDFNVDIIMHSATKYF------------------------- 200
           G  ++VD+TF A         +  DI+ HSATK+                          
Sbjct: 177 GIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEK 236

Query: 201 ---------GGHSDLLS---GVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRSLRTF 248
                    G H  + +   G L          LRD    LG  +    SF+LL+ + T 
Sbjct: 237 FPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGPLMNPFASFLLLQGVETL 292

Query: 249 EMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYGPVFSI 305
            +R  +  ENA K+  +L+ +       +  +++  L   S     KK L  G+G V S 
Sbjct: 293 SLRAERHGENALKLAKWLEQS-----PYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSF 347

Query: 306 SLMNKEQC-KKFPPM----------LKYFHHATSLGGIESLVEWRAMTDPY--------- 345
            + +     K+  P           LK   +  ++G  ++LV       PY         
Sbjct: 348 GVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLV-----IAPYFTTHKQLND 402

Query: 346 -------IEQTLIRVSIGCENADDLIQDLANALETL 374
                  + + LIRVS+G E  DD+I D   + ET+
Sbjct: 403 KEKLASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 110/456 (24%), Positives = 171/456 (37%), Gaps = 103/456 (22%)

Query: 2   AHLSTALIHSDDK---DNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP--IY 56
           +H  T  +H+  +   DN     A PI  TT++ ++N      ++  +  F  + P  +Y
Sbjct: 3   SHFDTVQLHAGQENPSDNAHRTRAVPIYATTSYCFEN------SKHGSQLFGLEVPGYVY 56

Query: 57  SRLAHPNSTRLES-IFSEILDGHAVIYSSGLAA---FFAAMIHYNPKRIFIGQSYHGVRA 112
           SR  +P S  LE  I +      A+  SSG AA       + H     +     Y G   
Sbjct: 57  SRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYN 116

Query: 113 IANILTRNFQTKQHTL--DEIEQFAQPGD----IVHLETPVNPFGTSLDLEDFAKKAHEK 166
              I  + F  +   +  D  E F +  D     V+LET  NP     D E     AH+ 
Sbjct: 117 QFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKH 176

Query: 167 GALLLVDSTF-APPPLQNVWDFNVDIIMHSATKYF------------------------- 200
           G  ++VD+TF A         +  DI+ HSATK+                          
Sbjct: 177 GIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEK 236

Query: 201 ---------GGHSDLLS---GVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRSLRTF 248
                    G H  + +   G L          LRD    LG  +    SF+LL+ + T 
Sbjct: 237 FPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRD----LGPLMNPFASFLLLQGVETL 292

Query: 249 EMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYGPVFSI 305
            +R  +  ENA K+  +L+ +       +  +++  L   S     KK L  G+G V S 
Sbjct: 293 SLRAERHGENALKLAKWLEQS-----PYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSF 347

Query: 306 SLMNKEQC-KKFPPM----------LKYFHHATSLGGIESLVEWRAMTDPY--------- 345
            + +     K+  P           LK   +  ++G  ++LV       PY         
Sbjct: 348 GVKDLPNADKETDPFKLSGAQVVDSLKLASNLANVGDAKTLV-----IAPYFTTHKQLND 402

Query: 346 -------IEQTLIRVSIGCENADDLIQDLANALETL 374
                  + + LIRVS+G E  DD+I D   + ET+
Sbjct: 403 TEKLASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative
           protein of unknown function with similarity to Str2p,
           which is a cystathionine gamma-synthase important in
           sulfur metabolism; YLL058W is not an essential gene
          Length = 575

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 124/273 (45%), Gaps = 55/273 (20%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMH------ 194
           V +ETP NP     DL+     A + G  +++D T        +   NVDI+ +      
Sbjct: 321 VFVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDT--------IGGLNVDILPYADIVST 372

Query: 195 SATKYFGGHSDLLSGVLVVKEEA----VARQLRDDRIYLGTNVANL----ESFMLLRSLR 246
           S TK F G S+++ G +V+  ++     AR+      +   N  +L    ++ +L R+ R
Sbjct: 373 SLTKLFNGASNVMGGSVVLNPKSSLYPYAREY-----FRSANFEDLLWCEDAIVLERNSR 427

Query: 247 TFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSL-QKESFVK----KQLKGGYGP 301
            FE R L+ + N   +++  D    +  K+ K I + ++  KE+F      +  +GGYG 
Sbjct: 428 DFEDRTLRANANTGILLN--DLLLPEEGKICKKIYYPTVTSKETFENYESVRNERGGYGC 485

Query: 302 VFSISLMNKEQCKKFPPMLKYFH---------------HATSLGGIESLVEWRAMTDPYI 346
           +FS++  N+   K F   LK F                H      +E + ++ A  DP I
Sbjct: 486 LFSVAFFNEGDAKAFYDSLKVFKGPSNGTNFTLACPYVHLAHHSELEEVSKFGA--DPNI 543

Query: 347 EQTLIRVSIGCENADDLIQDLANALETLQKESS 379
               IRVS+G E+   L++  ++AL+ ++   S
Sbjct: 544 ----IRVSVGLEDIQWLLKVFSSALDVVKSRGS 572

>KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 652

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 127/279 (45%), Gaps = 28/279 (10%)

Query: 125 QHTLDEIEQFAQPGD---IVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPL 181
           Q ++D+++     G+    V +E P NP     DL +  + A+  G  ++VD T      
Sbjct: 378 QKSMDQLKDILHSGEQILAVFMEAPSNPLLKMGDLVELRELANAYGFYIVVDETAGGFVN 437

Query: 182 QNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL----E 237
            +V   + DI+  S TK F G S++++G +V+   +        + +   +  +L    +
Sbjct: 438 IDVLP-HADIVCSSLTKIFSGDSNVMAGSVVLNPRSPLYPFAQ-QFFSSDSFEDLLWCED 495

Query: 238 SFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQL-- 295
           +  L R+ R F  R L  ++N  +++   D    +  K+ K I   SL  E   K+    
Sbjct: 496 AIYLERNSRDFATRTLTVNKNTQRLLE--DVLLPQEGKLFKKIFFPSLTSEE-TKRNYDV 552

Query: 296 ----KGGYGPVFSISLMNKEQCKKF---------PPMLKYFHHATSLGGIESLVEWRAMT 342
               +GGYG +FS++   +EQ + F         P +   F  A     +    E   + 
Sbjct: 553 VLCPQGGYGGLFSLTFYREEQARVFFDVLELCKGPSLGTNFTLACPYAILAHYAELEEVA 612

Query: 343 DPYIEQTLIRVSIGCENADDLIQDLANAL-ETLQKESSN 380
              +E++L+RVS+G E+A+ L    ++A+ E L+  SS+
Sbjct: 613 KYGVERSLVRVSVGLESAESLNHVFSHAIKEALKVASSS 651

>TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa]
           {ON} 
          Length = 556

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 117/262 (44%), Gaps = 37/262 (14%)

Query: 143 LETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNV------DIIMHSA 196
           +ETP NP     DL    K A+E G  +++D T        +   NV      DI+  S 
Sbjct: 304 VETPSNPLLNMPDLTGLRKLANEYGFFIVIDDT--------IGGLNVDILPYADIVCTSL 355

Query: 197 TKYFGGHSDLLSGVLVVKEE----AVARQLRDDRIYLGTNVANLESFMLLR-SLRTFEMR 251
           TK F G S+++ G L++  +    + AR   +   +   ++   E   +L  + R FE R
Sbjct: 356 TKLFNGSSNVMGGSLILNPKSSLYSSARAFVESDGF--EDLLWCEDAKVLEINSRDFEDR 413

Query: 252 MLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVK-----KQLKGGYGPVFSIS 306
            ++ ++N  +++S L    +   KV K I + ++  E   K     +   GGYG +FS++
Sbjct: 414 TVRANKNTERLLSELILVNE--GKVFKKIYYPTVSSEETFKNYEAVRNKLGGYGCMFSMA 471

Query: 307 LMNKEQCKKFPPMLKYFHH---------ATSLGGIESLVEWRAMTDPYIEQTLIRVSIGC 357
             ++E  K F   LK F           A     +    E   ++    +  LIRVS+G 
Sbjct: 472 FYSEEDSKAFYDSLKVFKGPSNGTNFTLACPYVQLAHRFELEEVSKFGADPNLIRVSVGL 531

Query: 358 ENADDLIQDLANALETLQKESS 379
           E++  L+   ++A+  L++  S
Sbjct: 532 EDSQWLLDVFSDAINMLERRRS 553

>KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 444

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 102/443 (23%), Positives = 171/443 (38%), Gaps = 77/443 (17%)

Query: 2   AHLSTALIHSDDKD---NRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP-IYS 57
           +H  T  +H+  +D   N  +  A PI  T+++ +++           L  +EK   +YS
Sbjct: 3   SHFDTLQLHAGQEDATENAHNPRAVPIYATSSYVFNDSQ-----HGAQLFGLEKPGYMYS 57

Query: 58  RLAHPNSTRLESIFSEILDGHAVI-YSSGLAA---FFAAMIHYNPKRIFIGQSYHGVRAI 113
           R+ +P     E   + +  G A +  +SG AA     + + H     +     Y G    
Sbjct: 58  RIVNPTVDVFERRIAALEGGVAALAVASGQAAQALAISGLAHAGDNIVSTSFLYGGTYNQ 117

Query: 114 ANILTR--NFQTKQHTLDEIEQFAQPGD----IVHLETPVNPFGTSLDLEDFAKKAHEKG 167
             +  R    +T+    D+ E F +  D     V+LET  NP     D E     AH+ G
Sbjct: 118 FKVAFRRLGIETRFIEGDKPEDFEKAFDDKTKAVYLETIGNPKYNVPDFEKIVAVAHKHG 177

Query: 168 ALLLVDSTF-APPPLQNVWDFNVDIIMHSATKY--------------------------- 199
             ++VD+TF A         +  DI+ HSATK+                           
Sbjct: 178 IPVVVDNTFGAGGYFAQPIKYGADIVTHSATKWIGGHGTTIGGVIVDSGKFPWKEYPEKF 237

Query: 200 --FGGHSDLLSGVLVVKEEAVARQLRDDRIY----LGTNVANLESFMLLRSLRTFEMRML 253
             F   S+   G+++         +   RI     LG  +    +F LL+ + T  +R  
Sbjct: 238 PQFSKPSEGYHGLVINDALGPLAYIGHVRIELLRDLGPALNPFAAFQLLQGVETLSLRCE 297

Query: 254 KQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYGPVFSISLMN---- 309
           + + NA K+  +L+  +  Y   +     SS       KK L+ G+G V S  + +    
Sbjct: 298 RHATNALKLAQYLE--KSPYVSWVSYPGLSSHSHHENAKKYLQNGFGGVLSFGVKDLPNA 355

Query: 310 -------KEQCKKFPPMLKYFHHATSLGGIESLV------EWRAMTD-----PYIEQTLI 351
                  K    +    LK   +  ++G  ++LV        + +TD       + + LI
Sbjct: 356 HEIEDPFKASGAQVVDSLKIASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVTKDLI 415

Query: 352 RVSIGCENADDLIQDLANALETL 374
           RVS+G E  DD+I D   A E +
Sbjct: 416 RVSVGTEFIDDIIGDFEQAFEKV 438

>TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.354
           YJR130C
          Length = 652

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 126/291 (43%), Gaps = 45/291 (15%)

Query: 122 QTKQHTLDEIEQFAQPGD---IVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAP 178
           Q     ++++++  Q G+    V +E P NP     DL +  + A+  G  ++VD T   
Sbjct: 375 QGDSTAMEDLKKILQSGEQILAVFMEAPSNPLLKMGDLLELRQLANLYGFFIVVDETAGG 434

Query: 179 PPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEA----------VARQLRDDRIY 228
               +V   + D++  S TK F G S+L++G LV+  +           +A++  +D ++
Sbjct: 435 FVNIDVLP-HADVVCSSLTKIFSGDSNLIAGSLVLNPQGKLYDFAQQWLLAQKEYEDTLW 493

Query: 229 LGTNVANLESFMLLRSLRTFEMRMLKQSENA----TKIVSFLDSNRDKYDKVLKSITHSS 284
               +A      L R+ R F  R ++ + N      K++  L+       K+ K I + S
Sbjct: 494 CEDALA------LERNSRDFVQRTIQVNHNTEYLLNKVLIPLEG------KLFKKIYYPS 541

Query: 285 LQKES------FVKKQLKGGYGPVFSISLMNKEQCKKF---------PPMLKYFHHATSL 329
           L           VK  +  GYG +FS++  N  Q + F         P +   F  A   
Sbjct: 542 LTSPETKRHYDAVKCSIDAGYGGLFSLTFFNLAQARVFFDSLQLCKGPSLGTNFTLACPY 601

Query: 330 GGIESLVEWRAMTDPYIEQTLIRVSIGCENADDLIQDLANALETLQKESSN 380
             +    E   +    +E++L+RVS+G EN + L Q   +A+    K S++
Sbjct: 602 AILAHYQELDEVARYGVEKSLVRVSVGLENRESLCQVFQHAIAEALKISTD 652

>AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR130C
           (STR2) and YML082W
          Length = 645

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 129/307 (42%), Gaps = 26/307 (8%)

Query: 91  AAMIHYNP---KRIFIGQSYHGVRAIANIL--TRNFQTKQHT----LDEIEQFAQPGDIV 141
            A++ Y P   K +  G  Y    +I  +   T    +  H     L++I    +P   V
Sbjct: 332 GALVGYGPPYKKTVMFGFPYTDTLSILRVFNHTHFLGSGDHKAMAQLEDILHSGEPILAV 391

Query: 142 HLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFG 201
            +ETP NP     DL+   + A   G  L+VD T       +V   + D++  S TK F 
Sbjct: 392 FIETPSNPLLKMGDLQALRRLADIYGFYLVVDDTLGGFVNIDVLP-HADLVCSSLTKIFS 450

Query: 202 GHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL---ESFMLLRSLRTFEMRMLKQSEN 258
           G S++++G LVV   +          + G+    L   ++  L R+ R    R L+ ++N
Sbjct: 451 GDSNVMAGSLVVNPASRLYDFAQGFFHNGSYEDLLWCEDAIYLERNSRDCASRSLRVNKN 510

Query: 259 ATKIVS--FLDSNRDKYDKVLKSITHSSLQKESF--VKKQLKGGYGPVFSISLMNKEQCK 314
              ++    L      + K+      S   K ++  V+ +  GGYG +FS++   + + K
Sbjct: 511 TELLLEKVLLPHQGSLFKKIFYPTLTSEETKRNYDAVRCKPDGGYGGLFSLTFHEENRAK 570

Query: 315 KF---------PPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENADDLIQ 365
            F         P +   F  A     +    E   + +  +E++L+RVS+G E+ D L +
Sbjct: 571 VFFDTLELCKGPSLGTNFTLACPYTVLAHYAEMDVVAEYGLERSLVRVSVGLEDFDHLRK 630

Query: 366 DLANALE 372
               A++
Sbjct: 631 VFQRAID 637

>Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {ON}
           YLR303W (MET17) - O-Acetylhomoserine-O-Acetylserine
           Sulfhydralase [contig 50] FULL
          Length = 444

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 117/297 (39%), Gaps = 72/297 (24%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTF-APPPLQNVWDFNVDIIMHSATKY 199
           V+LE+  NP     D E     AH+ G  ++VD+TF A       + F  DII HSATK+
Sbjct: 151 VYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFAQPFKFGADIITHSATKW 210

Query: 200 F----------------------------------GGHSDLLS---GVLVVKEEAVARQL 222
                                              G H  + +   G L          L
Sbjct: 211 IGGHGTTIGGVIVDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDALGPLAYIAHVRVELL 270

Query: 223 RDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITH 282
           RD    LG  +    +F LL+ + T  +R  + + NA K+  +L+S+       +  +++
Sbjct: 271 RD----LGPALNPFAAFQLLQGIETLSLRCERHASNALKLAQYLESS-----PYVSWVSY 321

Query: 283 SSLQKESF---VKKQLKGGYGPVFSISLMN----KEQCKKFPP-------MLKYFHHATS 328
             L   S     KK L+ G+G V SI + +     E+   F          LK   +  +
Sbjct: 322 PGLPSHSHHENAKKYLQNGFGGVLSIGVKDLPNASEETDPFAASGAQVVDSLKLASNLAN 381

Query: 329 LGGIESLV------EWRAMTD-----PYIEQTLIRVSIGCENADDLIQDLANALETL 374
           +G  ++LV        + ++D       + + LIR+S+G E  DD+I D   A E +
Sbjct: 382 VGDSKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRISVGTEFIDDIIGDFEQAFEKV 438

>TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa]
           {ON} Anc_4.53 YLR303W
          Length = 446

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 107/457 (23%), Positives = 176/457 (38%), Gaps = 103/457 (22%)

Query: 2   AHLSTALIHS-----DDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP-- 54
           +H  T  +H+     DD  NR   V  PI  TT++ +++      ++  +  F  +TP  
Sbjct: 3   SHFDTVQLHAGQENPDDNANRPRAV--PIYATTSYVFND------SKHGSQLFGLETPGY 54

Query: 55  IYSRLAHPNSTRLES-IFSEILDGHAVIYSSGLAA---FFAAMIHYNPKRIFIGQSYHGV 110
           IYSR+ +P    LE  I +      A+  +SG A+     + + H     +     Y G 
Sbjct: 55  IYSRIMNPTVDVLEKRIAALEGGAAALAVASGQASQALAISGLAHTGDNIVATSFLYGGT 114

Query: 111 RAIANILTR--NFQTKQHTLDEIEQFAQPGD----IVHLETPVNPFGTSLDLEDFAKKAH 164
                +  +    +T+    D  E F +  D     V+LET  NP     D +   + AH
Sbjct: 115 YNQFKVAFKRLGIETRFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFDRIVEVAH 174

Query: 165 EKGALLLVDSTF-APPPLQNVWDFNVDIIMHSATKYF----------------------- 200
           + G  ++VD+TF A         +  DI+ HSATK+                        
Sbjct: 175 KHGIPVVVDNTFGAGGFFAQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYP 234

Query: 201 -----------GGHSDLLS---GVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRSLR 246
                      G H  + +   G L          LRD    LG  +    +F LL+ + 
Sbjct: 235 EKFPQFSIPSEGYHGMIFNDAFGPLAFIGHVRTELLRD----LGPALNPFAAFQLLQGVE 290

Query: 247 TFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYGPVF 303
           T  +R  +  ENA K+ ++L+ +       +  +++  L   S     KK L  G+G V 
Sbjct: 291 TLSLRAERHGENALKLAAWLEQS-----PYVSWVSYPGLPSHSHHENAKKYLTNGFGGVL 345

Query: 304 SIS---LMNKEQCKKFPPM----------LKYFHHATSLGGIESLV-------------E 337
           S     L N  + +   P           LK   +  ++G  ++LV             E
Sbjct: 346 SFGAKDLPNNAEAEAKNPFAAAGAKVVDNLKLASNLANVGDCKTLVIAPYFTTHLQLTHE 405

Query: 338 WRAMTDPYIEQTLIRVSIGCENADDLIQDLANALETL 374
            +A +   + + LIRVS+G E  DD+I D   + E +
Sbjct: 406 EKASSG--VTKDLIRVSVGTEFIDDIINDFQQSFEQV 440

>Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON}
           (179685..181754) [2070 nt, 690 aa]
          Length = 689

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 139/331 (41%), Gaps = 64/331 (19%)

Query: 91  AAMIHYNP---KRIFIGQSYHGVRAIANILTRNFQT------KQHTLDEIEQFAQPGD-- 139
            A I Y P   K +  G S +  +   NIL+    T        ++L ++E     G+  
Sbjct: 369 GASIGYGPPYKKTVLFGFSNNDTK---NILSEFNHTHYFACGDSNSLKDLECTLHSGEQI 425

Query: 140 -IVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATK 198
             V +ETP NP     DL    + A+  G  +++D T       +V  +  DI+  S TK
Sbjct: 426 LAVFVETPSNPLLKMPDLAHLRRLANLYGFYIIIDETMGGFVNIDVLPY-ADIVCSSLTK 484

Query: 199 YFGGHSDLLSGVLVVK--------EEAVARQLRDDRIYLGTNVANLESFMLLRSLRTFEM 250
            F G S++++G +V+          +    QL +   +L       ++  L R+ R F  
Sbjct: 485 IFSGSSNVIAGSMVLNPQEKLYSFAQVFMSQLGEYEDHLWCE----DAIYLERNSRDFIA 540

Query: 251 RMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSL-QKESFVKKQL------------KG 297
           R +K ++N   ++  +   ++   K+ K I + SL   ES V                +G
Sbjct: 541 RTIKTNQNTEFLLKKVLLAQEGPSKLFKKIFYPSLTSAESKVNYDAVRCKSIDKDSDEEG 600

Query: 298 GYGPVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPY------------ 345
           GYG +FS++    EQ K        F +  +L    SL     ++ PY            
Sbjct: 601 GYGGLFSLAFNKIEQAK-------IFFNELNLSKGPSLGTNFTLSCPYTVLMYYDKLDEV 653

Query: 346 ----IEQTLIRVSIGCENADDLIQDLANALE 372
               +E++L+RVSIG E+ D+L +   +A++
Sbjct: 654 AKYEVEESLVRVSIGIESQDELQKAFQHAID 684

>CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303w MET25 O-acetylhomoserine sulfhydrylase
          Length = 442

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 104/452 (23%), Positives = 174/452 (38%), Gaps = 101/452 (22%)

Query: 2   AHLSTALIHSDDK---DNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTP--IY 56
           +H  T  +H+  +   DN     A PI  TT+F +++      ++     F  + P  IY
Sbjct: 3   SHFDTLQLHAGQENPDDNNHRPRAVPIYSTTSFVFND------SQHGAQLFGLEVPGYIY 56

Query: 57  SRLAHPNSTRLES-IFSEILDGHAVIYSSGLAA---FFAAMIHYNPKRIFIGQSYHGVRA 112
           SR  +P +  LE  I +      A+  SSG AA     A + H     +     Y G   
Sbjct: 57  SRFQNPTNNVLEERIAALEGGAAALAVSSGQAAQTLAVAGLAHNGDNIVSTSFLYGGTYN 116

Query: 113 IANILTRNFQTKQHTL--DEIEQFAQPGD----IVHLETPVNPFGTSLDLEDFAKKAHEK 166
              +  +    +   +  D+ E F +  D     V+LE+  NP     D E+    AH+ 
Sbjct: 117 QFKVAFKRLGIEARFVEGDKPEDFEKLFDERTKAVYLESIGNPKYNVPDFENIVAVAHKH 176

Query: 167 GALLLVDSTFAPP-----PLQNVWDFNVDIIMHSATKYF--------------------- 200
           G  ++VD+TF        P++    +  DI+ HSATK+                      
Sbjct: 177 GIPVVVDNTFGAGGFFCQPIK----YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKD 232

Query: 201 -------------GGHSDLLS---GVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLRS 244
                        G H  + +   G L          LRD    LG  ++   +F+LL+ 
Sbjct: 233 YPEKFPQFSKPAEGYHGTVYNETYGNLAYIVHVRTELLRD----LGPGMSPFAAFLLLQG 288

Query: 245 LRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYGP 301
           + T  +R  +  +NA  +  +L+ N       +  +++  L   S     KK L  G+G 
Sbjct: 289 VETLSLRGERHGQNALALAKWLEKNPH-----VAWVSYPGLPSHSHHENAKKYLSNGFGG 343

Query: 302 VFSISLMNKEQC-KKFPPM----------LKYFHHATSLGGIESLV------EWRAMTDP 344
           V S  + +     K+  P           LK   +  ++G  ++LV        + ++DP
Sbjct: 344 VLSFGVKDLPNADKETDPFKLAGAQVVDNLKIASNLANVGDSKTLVIAPYFTTHQQLSDP 403

Query: 345 Y-----IEQTLIRVSIGCENADDLIQDLANAL 371
                 + + LIRVS+G E  DD+I D   + 
Sbjct: 404 EKLASGVTKDLIRVSVGTEFIDDIIADFEQSF 435

>NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa]
           {ON} Anc_4.354
          Length = 659

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 105/244 (43%), Gaps = 26/244 (10%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAP-PPLQNVWDFNVDIIMHSATKY 199
           V +E P NP     DL +  K +   G  ++VD T      L  +  F+ DI+  S TK 
Sbjct: 407 VFIEAPSNPLLQMCDLIELQKLSEIYGFFIVVDETIGGFVNLDGL--FHADIVCSSLTKV 464

Query: 200 FGGHSDLLSGVLVVKEEA----VARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQ 255
           F G S++++G +V+  ++     A+Q  +    +  ++   +   L ++ R F  + L+ 
Sbjct: 465 FNGDSNVIAGSMVLNPKSKIYEFAQQFLNGPDGVTDSIWCEDLIYLEKNSRDFVAKTLRI 524

Query: 256 SENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF------VKKQLKGGYGPVFSISLMN 309
             N T      +  +    K+ K I + S   E        +K +  GGYG VFS++   
Sbjct: 525 --NYTTEYLLDNVFKPHVGKLFKRIYYPSQNSEEIKQNYEAIKCKKDGGYGGVFSVTFFQ 582

Query: 310 KEQCKKFPPMLKYFHHATSLGGIESLV----------EWRAMTDPYIEQTLIRVSIGCEN 359
            +Q K F   LK     T LG   + V          E   + +  +E  LIRV +G EN
Sbjct: 583 LDQAKVFFNNLKLTKQIT-LGNNSTTVCPYTMLKHKDELERVKEYGLEDNLIRVCVGLEN 641

Query: 360 ADDL 363
            + L
Sbjct: 642 KNTL 645

>KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 444

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 101/452 (22%), Positives = 179/452 (39%), Gaps = 96/452 (21%)

Query: 2   AHLSTALIHSDDKDNRVSDV----APPINVTTTFRYDNDDLVPWTERENLDFMEKTP--I 55
           +H  T  +H+  +  + +D     A PI  TT++ +++      ++     F  +TP  I
Sbjct: 3   SHFDTLQLHAGQE--KTADAHNPRAVPIYATTSYVFND------SKHGAQLFGLETPGYI 54

Query: 56  YSRLAHPNSTRLESIFSEILDGHAVIY-SSGLAA---FFAAMIHYNPKRIFIGQSYHGVR 111
           YSR+ +P    LE   + +  G A +  SSG AA       + H     +     Y G  
Sbjct: 55  YSRIMNPTLDVLEKRLAALEGGIAALATSSGQAAQTLAVTGLAHTGDNIVSTSFLYGGTY 114

Query: 112 AIANILTRNFQTKQHTLD-----EIEQ-FAQPGDIVHLETPVNPFGTSLDLEDFAKKAHE 165
               +  +    +   +D     + E+ F +    ++LE+  NP     D E     AH+
Sbjct: 115 NQFKVAFKRLGIEARFVDGDKPEDFEKLFDEKTKALYLESIGNPKYNVPDFEKIVAVAHK 174

Query: 166 KGALLLVDSTFAPP-----PLQNVWDFNVDIIMHSATKY--------------------- 199
            G  ++VD+TF        P++    +  DI+ HSATK+                     
Sbjct: 175 HGIPVVVDNTFGAGGFFCQPIK----YGADIVTHSATKWIGGHGVTVGGVIIDSGKFPWK 230

Query: 200 --------FGGHSDLLSGVL---VVKEEAVARQLRDDRIY-LGTNVANLESFMLLRSLRT 247
                   F   S+   G++        A    +R + +  LG  ++    F+LL+ L T
Sbjct: 231 DYPEKFPQFSQPSEGYHGLIFNDAFGPAAFIGHVRTELLRDLGPVLSPFAGFLLLQGLET 290

Query: 248 FEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF---VKKQLKGGYGPVFS 304
             +R  +   NA K+  +L+S+       +  +++  L   S     KK L+ G+G V S
Sbjct: 291 LSLRGERHGSNALKLAQYLESS-----PYVSWVSYPGLPSHSHHENAKKYLENGFGGVLS 345

Query: 305 ISLMN----KEQCKKFPPM-------LKYFHHATSLGGIESLV------EWRAMTD---- 343
             + +     E+   F          LK   +  ++G  ++LV        + +TD    
Sbjct: 346 FGVKDLPNASEESDPFKASGAQVVDNLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKL 405

Query: 344 -PYIEQTLIRVSIGCENADDLIQDLANALETL 374
              + + LIRVS+G E  DD+I D   +  T+
Sbjct: 406 ASGVTKDLIRVSVGTEFIDDIIADFEASFATV 437

>Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)
          Length = 566

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 123/258 (47%), Gaps = 33/258 (12%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYF 200
           V +ETP NP     +L+D  + A + G  +++D T     + ++  +  DI+  S TK F
Sbjct: 312 VFVETPSNPLLNMPNLKDLRRLADQYGFFIIIDDTIGGINV-DILPY-ADIVCTSLTKLF 369

Query: 201 GGHSDLLSGVLVVKEEA----VARQLRDDRIYLGTNVANL----ESFMLLRSLRTFEMRM 252
            G S+++ G +V+  ++     AR+      +   +  +L    ++ +L R+ R FE R 
Sbjct: 370 NGASNVMGGSIVLNPKSSIYPYAREY-----FKSADFEDLLWCEDAVVLERNSRDFENRT 424

Query: 253 LKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVK-----KQLKGGYGPVFSISL 307
           L  + N  K+++  +    +  K+ K + + ++  E   +     +  +GGYG +FS++ 
Sbjct: 425 LHANANTEKLLN--EVLIPEQGKLCKKVYYPTVTSEETFRNYESVRNERGGYGCLFSVAF 482

Query: 308 MNKEQCKKFPPMLKYFHHATSLGGIESLV----------EWRAMTDPYIEQTLIRVSIGC 357
            N+   K F   LK F    S G   +L           E  A++    +  +IRVS+G 
Sbjct: 483 YNEGDAKAFYDSLKVF-KGPSNGTNFTLACPYVHLAHHSELEAVSKFGADPNIIRVSVGL 541

Query: 358 ENADDLIQDLANALETLQ 375
           E+   L++  +NAL+ ++
Sbjct: 542 EDTQWLLEVFSNALDVVR 559

>KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa]
           {ON} Anc_4.354 YJR130C
          Length = 667

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 130/311 (41%), Gaps = 58/311 (18%)

Query: 106 SYHGVRAIANILTRNFQTKQHTLDEIEQFAQPGD---IVHLETPVNPFGTSLDLEDFAKK 162
           +Y  ++ + N+    + ++   +++++     G+    V +E P  P     +L +  + 
Sbjct: 372 TYKMLKTLNNVYCLPYVSEIDCMNKLKNILHSGEQILAVLIEAPSTPLLKMGNLLELKEL 431

Query: 163 AHEKGALLLVDSTFAPPPLQNVWDFNVDIIMH------SATKYFGGH-SDLLSGVLVVKE 215
           ++  G +++VD T           FNVD ++H      S TK F G   ++++G + +  
Sbjct: 432 SNLFGFIIIVDETVGGF-------FNVDALVHADVVCTSLTKIFSGDVGNVMAGAMALNS 484

Query: 216 EAV----ARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRD 271
            +     A+    D      N+   ++ ++ R+ R F  +MLK +     ++        
Sbjct: 485 NSTIYNFAKDFLIDNNEFEDNLWCEDAIIMERNSRDFIAKMLKINYTTDYLL-------- 536

Query: 272 KYDKVL----------KSITHSSLQ----KESFVKKQLK--GGYGPVFSISLMNKEQCKK 315
             DKVL          K I H  L     K+++ K + K  GGYG VFSI   N EQ K 
Sbjct: 537 --DKVLIPHIGEHNLFKKIYHPRLTSNETKQNYEKIKCKSDGGYGGVFSIDFNNLEQAKL 594

Query: 316 FPPMLKYFHHATSLGGIESL----------VEWRAMTDPYIEQTLIRVSIGCENADDLIQ 365
           F   L       SLG   +L           +   ++   + ++LIRVS+G EN   L Q
Sbjct: 595 FYNCLN-VAKGPSLGTTMTLACPYTILYHYADIEKVSKYGLSESLIRVSVGLENRKQLCQ 653

Query: 366 DLANALETLQK 376
               A++   K
Sbjct: 654 LFQAAIDEAMK 664

>Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W
           (REAL)
          Length = 571

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 116/270 (42%), Gaps = 49/270 (18%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDI------IMH 194
           V +ETP NP     +L++  + A   G  +++D T        +   NVDI      +  
Sbjct: 317 VFVETPSNPLLNMPNLKELRRLADAYGFFIVIDDT--------IGGLNVDILPYADIVCT 368

Query: 195 SATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL----ESFMLLRSLRTFEM 250
           S TK F G S+++ G +V+  ++   Q R    +      +L    ++ +L R+ R FE 
Sbjct: 369 SLTKLFNGASNVMGGSVVLNPKSALYQ-RAREYFKSGEFEDLLWGEDAVVLERNSRDFED 427

Query: 251 RMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVK-----KQLKGGYGPVFSI 305
           R L+ + N  K++   +    +  K  K I + ++  +  +      +  +GGYG +FS+
Sbjct: 428 RTLRANTNTEKLLK--ELLLPEQGKTCKKIYYPTVNSKETINNYESVRNERGGYGCLFSV 485

Query: 306 SLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYI----------------EQT 349
           +  ++   + F   LK F   ++            +  PY+                + +
Sbjct: 486 AFHSEGDAEAFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHSELEEVSKFGADSS 538

Query: 350 LIRVSIGCENADDLIQDLANALETLQKESS 379
           +IRVS+G E    L+   ++AL+ ++   S
Sbjct: 539 IIRVSVGLEETQLLLDVFSSALDVVKSRRS 568

>Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)
          Length = 572

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 118/269 (43%), Gaps = 47/269 (17%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNV------DIIMH 194
           V +ETP NP     DL++  + A   G  ++VD T        +   NV      DI+  
Sbjct: 318 VFVETPSNPLLNMPDLKELRRLADAYGFFIVVDDT--------IGGLNVDVLPYADIVCT 369

Query: 195 SATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL----ESFMLLRSLRTFEM 250
           S TK F G S+ + G +++  ++       +  +      +L    ++ +L  + R F+ 
Sbjct: 370 SLTKLFNGSSNAMGGSIILNPKSSLYSSACE-YFKSAEFEDLLWCEDAVVLEANSRDFQD 428

Query: 251 RMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSL-QKESFVK----KQLKGGYGPVFSI 305
           R L+ + N  K+++  +    +  K+ K I + ++  KE+F      +   GGYG +FS+
Sbjct: 429 RTLRANINTEKLLN--EVLLPEEGKICKKIYYPTVSSKETFNNYESVRNKHGGYGCLFSM 486

Query: 306 SLMNKEQCKKFPPMLKYFH---------------HATSLGGIESLVEWRAMTDPYIEQTL 350
           +  N+   K F   LK F                H      +E + ++ A  DP     L
Sbjct: 487 AFYNEGDAKTFYDTLKVFKGPSNGTNFTLACPYVHLAHHSELEEVSKFGA--DP----NL 540

Query: 351 IRVSIGCENADDLIQDLANALETLQKESS 379
           IRVS+G E+   L+   ++A++ ++   S
Sbjct: 541 IRVSVGLEDTQTLLDVFSSAIDVVRSRHS 569

>Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON}
           YJR130C (STR2) - Cystathionine gamma-synthase [contig
           376] FULL
          Length = 652

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 120/264 (45%), Gaps = 41/264 (15%)

Query: 125 QHTLDEIEQFAQPGD---IVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPL 181
           + +++++++    G+    V +E P NP     +L +  + A   G  +++D T      
Sbjct: 382 EKSMEQLKEILHSGEQILAVFMEAPSNPLLKMGNLIELRELADAYGFYVVIDETAG---- 437

Query: 182 QNVWDFNVDIIMH------SATKYFGGHSDLLSGVLVVKEEA----VARQLRDDRIYLGT 231
                 N+D++ H      S TK F G S++++G LV+  ++     A+Q   D  +   
Sbjct: 438 ---GFVNIDVLPHADMVCSSLTKIFSGDSNVMAGSLVLNRKSPLYSFAQQFFHDGEF--E 492

Query: 232 NVANLESFMLL-RSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF 290
           ++   E  + L R+ R F  R L  ++N  +++  +   ++K  K+ K I + SL     
Sbjct: 493 DLLWCEDVIYLERNSRDFVTRTLTVNKNTAQLLEEVLIPQEK--KLFKKIFYPSLTSPE- 549

Query: 291 VKKQL------KGGYGPVFSISLMNKEQCKKF---------PPMLKYFHHATSLGGIESL 335
            K+        KGGYG +FS++  N++Q + F         P +   F  A     +   
Sbjct: 550 TKRNYDAILCPKGGYGGLFSLTFYNEKQARVFFDTLELCKGPSLGTNFTLACPYAILAHY 609

Query: 336 VEWRAMTDPYIEQTLIRVSIGCEN 359
            E   +    +E++L+RVS+G E+
Sbjct: 610 TELEEVAKFGVERSLVRVSVGLES 633

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 120/275 (43%), Gaps = 25/275 (9%)

Query: 122 QTKQHTLDEIEQFAQPGD---IVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAP 178
           Q     ++E+++    G+    V +E+P NP     DL +  + +   G  +++D T   
Sbjct: 409 QGDSQAMNELKEILHGGEQILAVFIESPSNPLLKMGDLVELKRLSDLYGFYIVIDETVGG 468

Query: 179 PPLQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTN-----V 233
               +V  +  D++  S TK F G S++++G +V+   +   +     ++L        +
Sbjct: 469 FLNIDVLPY-ADVVCSSLTKIFSGDSNVMAGSIVLNPRSRLYEFATTMLHLTEKWYEDLL 527

Query: 234 ANLESFMLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITH----SSLQKES 289
              ++  L R+ R F  R +  +EN   ++  +   +    K+ K + +    ++  K++
Sbjct: 528 WCEDAICLERNSRDFISRSILVNENTESLLEKVILPQQGEGKLFKKVFYPKYTNAETKKN 587

Query: 290 F--VKKQLKG-GYGPVFSISLMNKEQCKKF---------PPMLKYFHHATSLGGIESLVE 337
           +  VK +  G GYG +FS++  N EQ K F         P +   F  A     +    E
Sbjct: 588 YDQVKAKTAGSGYGGLFSVTFYNIEQAKMFFNSLNLCKGPSLGTNFTLACPYTVLAHYQE 647

Query: 338 WRAMTDPYIEQTLIRVSIGCENADDLIQDLANALE 372
              +    +E  L+RVS+G E+   L +    A++
Sbjct: 648 MEEVAKFGLEDNLVRVSVGLESKQHLEKVFQTAID 682

>Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W
           (REAL)
          Length = 688

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 111/239 (46%), Gaps = 22/239 (9%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYF 200
           V +ETP NP     +L +  + +   G  +++D T       +   F  D++  S TK F
Sbjct: 434 VFIETPSNPLLKMGNLVELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADLVCSSLTKTF 492

Query: 201 GGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL----ESFMLLRSLRTFEMRMLKQS 256
            G S+++ G +V+  ++   +     + L     +L    ++  L R+ R F  R ++ +
Sbjct: 493 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 552

Query: 257 ENATKIVSFLDSNRDKYDKVLKSITHSSL-QKESF-----VKKQLKGGYGPVFSISLMNK 310
            N   ++  +       + + K I + +L  KE+      V+ + +GGYG +FS++  ++
Sbjct: 553 YNTEYLLDKIIKPHVGENALFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHDE 612

Query: 311 EQCKKFPPMLKYFHHATSLGGIESLV---------EWRAMTDPY-IEQTLIRVSIGCEN 359
           +  + F   L+  +   SLG   +LV            AM + + +E+ L+R+S+G EN
Sbjct: 613 DHAEAFYDNLQ-LNKGPSLGTNFTLVFPYTLMTYYHEMAMAEKFGVERNLLRISVGLEN 670

>CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar to
           uniprot|P47164 Saccharomyces cerevisiae YJR130c STR2
          Length = 569

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 74/258 (28%), Positives = 110/258 (42%), Gaps = 42/258 (16%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYF 200
           V LE P NP     D+    + + + G  ++VD T +     ++  +  DI+  S TK F
Sbjct: 318 VFLEAPSNPLLKMCDMSKLKQLSQQYGFFIVVDETVSGFVNIDILSY-CDIVCSSLTKIF 376

Query: 201 GGHSDLLSGVLVVKEEAVARQLRDDRI-YLGTNVAN------LESFMLLRSLRTFEMRML 253
            G S++++G LVV     A +L D  I +L     N       +S  L R+ R F  R  
Sbjct: 377 SGDSNVIAGSLVVNP---ASKLHDFAIDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRAQ 433

Query: 254 KQSENATKIVSFLDSNRDK------YDKVLKSITHSSLQKESFVKKQLKGGYGPVFSISL 307
           K ++ A  +VS +    +       Y   L S   S L  +S   K   GGYG + SI  
Sbjct: 434 KINKIAEDLVSTVLLEEEGQLLEKIYYPSLTS-PESKLNYDSV--KCNNGGYGGLISIVF 490

Query: 308 MNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIE----------QTLIRVSIGC 357
             ++Q K F   L   +   SLG   +LV   A+   Y E          + L+R+S+G 
Sbjct: 491 KREDQAKVFYDNLS-LNKGPSLGTNFTLVCPYAILAHYAELDEVAKYGVVKNLVRISVGL 549

Query: 358 ENADDLIQDLANALETLQ 375
           E           +LETLQ
Sbjct: 550 E-----------SLETLQ 556

>Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W
           (REAL)
          Length = 649

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 123/269 (45%), Gaps = 25/269 (9%)

Query: 127 TLDEIEQFAQPGD---IVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQN 183
           ++DE+ +    G+    V +ETP NP     +L +  + +   G  +++D T       +
Sbjct: 378 SMDELTKILHSGEQILAVFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNID 437

Query: 184 VWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL----ESF 239
              F  DI+  S TK F G S+++ G +V+  ++   +     + L     +L    ++ 
Sbjct: 438 GLPF-ADIVCSSLTKTFSGDSNVIGGSMVLNPQSRVYEFATRFMRLEDEYEDLLWCEDAI 496

Query: 240 MLLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSL-QKESF-----VKK 293
            L R+ R F  R ++ + +   ++  +       +++ K I + +L  KE+      V+ 
Sbjct: 497 YLERNSRDFIARTVRINYSTEYLLDKILKPHVGGNELFKKIYYPNLTSKETLTNYDMVRC 556

Query: 294 QLKGGYGPVFSISLMNKEQCKKFPPMLKYFHHATSLG---------GIESLVEWRAMTDP 344
           + +GGYG +FS++  ++     F   L+  +   SLG          + +  +  AM + 
Sbjct: 557 KKEGGYGGLFSLTFHDEHHAAAFYDNLQ-LNKGPSLGTNFTLAFPYTLMTYYQELAMAEK 615

Query: 345 Y-IEQTLIRVSIGCENADDLIQDLANALE 372
           + +E+ L+R+S+G E+   L +    A++
Sbjct: 616 FGVERNLLRISVGLESQSTLGKIFQEAID 644

>YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative
           protein predicted to have carbon-sulfur lyase activity;
           transcriptionally regulated by Upc2p via an upstream
           sterol response element; green fluorescent protein
           (GFP)-fusion protein localizes to the nucleus and the
           cytoplasm; YML082W is not an essential gene
          Length = 649

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 113/252 (44%), Gaps = 22/252 (8%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYF 200
           V +ETP NP     +L +  + +   G  +++D T       +   F  DI+  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 201 GGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL----ESFMLLRSLRTFEMRMLKQS 256
            G S+++ G +V+  ++   +     + L     +L    ++  L R+ R F  R ++ +
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFASRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 513

Query: 257 ENATKIVSFLDSNRDKYDKVLKSITHSSL-QKESF-----VKKQLKGGYGPVFSISLMNK 310
            +   ++  +       +K+ K I + +L  KE+      V+ + +GGYG +FS++  ++
Sbjct: 514 YSTEYLLDKILKPHVGENKLFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHDE 573

Query: 311 EQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPY----------IEQTLIRVSIGCENA 360
           +    F   LK  +   SLG   +L     +   Y          +E+ L+R+S+G E+ 
Sbjct: 574 DHAAAFYDNLK-LNKGPSLGTNFTLAFPYTLMTYYHELDMAEKFGVERNLLRISVGLESQ 632

Query: 361 DDLIQDLANALE 372
             L +    A++
Sbjct: 633 SILGKIFQEAID 644

>NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {ON}
           Anc_4.354
          Length = 696

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 112/260 (43%), Gaps = 34/260 (13%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYF 200
           V +E P NP     DL +  + +   G  ++VD T A   +      + DII  S TK F
Sbjct: 438 VFIEAPSNPLLKMGDLIELKRLSDMYGFFIIVDETIAGF-VNIDAIIHADIICSSLTKVF 496

Query: 201 GGHSDLLSGVLVVKEEA----VARQL------------RDDRIYLGTNVANLESFMLLRS 244
            G S++++G +V+   +     A++              +D +YL  N  +     L ++
Sbjct: 497 TGDSNVIAGSMVLNPMSKIYDFAKRFLSFPDGFEDCLWCEDILYLEKNSRDF----LSKT 552

Query: 245 LRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESF--VKKQLKGGYGPV 302
            R         +   +  V   ++N   + K+    T S   K  +  +K +  GGYG V
Sbjct: 553 TRINNTTEYLVNTVLSPYVGKKEANGKLFKKIYYPTTTSKETKMCYDAIKCKTYGGYGGV 612

Query: 303 FSISLMNKEQCKKFPPMLKYFHHATSLGGIESLV----------EWRAMTDPYIEQTLIR 352
           FSI+  + E+ K F   LK      SLG   + V          E   +++  +++TLIR
Sbjct: 613 FSITFHDIEKAKLFFNNLK-LSKTISLGSNYTTVCPYTVLKHGDELEKVSEYGLDETLIR 671

Query: 353 VSIGCENADDLIQDLANALE 372
           V +G EN   L ++ + A+E
Sbjct: 672 VCVGLENKTSLKENFSRAIE 691

>Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C
           (REAL)
          Length = 699

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 113/256 (44%), Gaps = 22/256 (8%)

Query: 141 VHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYF 200
           V +ETP NP     +L +  + +   G  +++D T       +   F  DI+  S TK F
Sbjct: 445 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCGSLTKTF 503

Query: 201 GGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANL----ESFMLLRSLRTFEMRMLKQS 256
            G S+++ G +V+  ++   +     + L     +L    ++  L R+ R F  R ++ +
Sbjct: 504 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 563

Query: 257 ENATKIVSFLDSNRDKYDKVLKSITHSSL-QKESF-----VKKQLKGGYGPVFSISLMNK 310
            +   ++  +       + + K I + SL  KE+      V+ + +GGYG +FS++  ++
Sbjct: 564 YSTEYLLDKILKAHVGENGLFKKIYYPSLTSKETLINYDMVRCKKEGGYGGLFSLTFHDE 623

Query: 311 EQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPY----------IEQTLIRVSIGCENA 360
           +    F   L+  +   SLG   +L     +   Y          +E+ L+R+S+G E+ 
Sbjct: 624 DHAAAFYNNLQ-LNKGPSLGTNFTLAFPYTLMTYYHELTMAEKFGVERNLLRISVGLESQ 682

Query: 361 DDLIQDLANALETLQK 376
             L +    A++   K
Sbjct: 683 STLGKIFQEAIDKTLK 698

>Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 87

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 38/72 (52%), Gaps = 11/72 (15%)

Query: 316 FPPMLKYFHHATSLGGIESLVEWRA-MTDPYIEQT----------LIRVSIGCENADDLI 364
           F    + F  A SLGGIESL+E  A MT   I +           LIR+S+G E+ DDL+
Sbjct: 16  FTSTTRLFTLAESLGGIESLLEVPAVMTHGGIPKDQREASGVYDDLIRLSVGIEDTDDLL 75

Query: 365 QDLANALETLQK 376
            D+ NAL    K
Sbjct: 76  DDIKNALTLASK 87

>KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.354
           YJR130C
          Length = 631

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 63/297 (21%), Positives = 125/297 (42%), Gaps = 29/297 (9%)

Query: 95  HYNPKRIFIGQSYHGVRAIANILTRNF---QTKQHTLDEIEQFAQPGD---IVHLETPVN 148
            ++ K + +G   H    +   L++++   +     L ++++    G+    V  ETP N
Sbjct: 342 QHSKKTVVLGVPCHDTYEMVTTLSKSYFIPENGTDGLSKLKEILHSGEQILAVITETPTN 401

Query: 149 PFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQNVWDFNVDIIMHSATKYFGGHSDLLS 208
                 +L +  + +   G  ++VD +       +   +  DI+  S  K F G  D++S
Sbjct: 402 GLLDVTNLVELKQLSELFGFYIVVDESVGGFVNVDALVY-CDIVCSSLVKMFSGTEDVVS 460

Query: 209 GVLVVKEEA---------VARQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENA 259
           G +VV  ++         +A +     +    ++  LE     ++ R F  +  K+   A
Sbjct: 461 GSMVVNPQSKLYDFAQTFMASEHEPSSVLWCEDIIQLE-----QNSRDFVSKS-KRINTA 514

Query: 260 TKIVSFLDSNRDKYDKVLKSITHSSLQKES---FVKKQLKGGYGPVFSISLMNKEQCKKF 316
           TK +   D    +   +   + H S+   +    +K +  GGYG VF++     E+ + F
Sbjct: 515 TKRL-LRDVILPQRGTIFTEVHHPSITDRAQYNLIKGKQDGGYGGVFAVQFSTLERARSF 573

Query: 317 PPMLKYFHHATSLGGIESLVEWRAMTDPY--IEQTLIRVSIGCENADDLIQDLANAL 371
              L        LGG  ++     + + Y  +++TLIRVS+G E+ D L +    A+
Sbjct: 574 YDRLNVC-KGPGLGGDYTVACPWQLLNQYDEVDKTLIRVSVGLEDYDVLKRAFEEAI 629

>Smik_2.359 Chr2 complement(641781..643805) [2025 bp, 674 aa] {ON}
           YBR216C (REAL)
          Length = 674

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 77  GHAVIYSSGLAAFFAAMIHYNPKRIFI-GQSYHGVRAIANILTRNFQTKQHTLDEIEQFA 135
           G  +I    + +F+A  IH  PK+  + G        + ++  R+ Q K+  +DE E  A
Sbjct: 90  GSNMIVQGVMKSFYAISIHGEPKKCLLTGLELLSSIPVEDVSKRDQQNKEEFIDEKENTA 149

Query: 136 QPGDIVHLETPVN 148
            PG+ + +++ +N
Sbjct: 150 TPGEAIQIDSDLN 162

>TBLA0A10490 Chr1 (2583135..2583986) [852 bp, 283 aa] {ON} Anc_5.263
           YKL154W
          Length = 283

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 166 KGALLLVDSTFAPPPLQNVWDFNVDI-IMHSATKYFGGHSDLL 207
           KG + LVDST  P  L +   F  DI ++   TKYF    D+L
Sbjct: 131 KGLIFLVDSTIDPKNLTDTAQFLYDILVITENTKYFNNGVDIL 173

>NDAI0C03870 Chr3 complement(879232..879993) [762 bp, 253 aa] {ON}
           Anc_5.263 YKL154W
          Length = 253

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 3/108 (2%)

Query: 94  IHYNPKRIFI--GQSYHGVRAIANILTRNFQTKQHTLDEIEQFAQPGDIVHLETPVNPFG 151
           I  N K IF+  G S  G  ++  +L+ N Q    T  ++ +     + +++      F 
Sbjct: 41  IISNKKPIFVIAGPSNSGKTSLFTLLSNNKQRPTVTSLDVSKLENLDNRINVIEFPGHFK 100

Query: 152 TSLDLEDFAKKAHE-KGALLLVDSTFAPPPLQNVWDFNVDIIMHSATK 198
               L DF KK  +  G + +VDST  P  L    +F +D+++ + +K
Sbjct: 101 LRYKLIDFLKKNPKIAGVIYVVDSTVDPKELTKTAEFLLDVLLITESK 148

>Kwal_26.7194 s26 (258018..258476) [459 bp, 152 aa] {ON} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 152

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 16/111 (14%)

Query: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63
            +T  +H+    +    V  PI+++TTF+  +    P  E E          YSR  +PN
Sbjct: 8   FATKAVHAGTHTDVHGSVIEPISLSTTFK-QHSPAQPVGEYE----------YSRSQNPN 56

Query: 64  STRLESIFSEILDG-HAVIYSSGLAAFFAAMIHYNPK---RIFIGQSYHGV 110
              LE   + + +  HA+ +SSG +A  A ++   P+    + IG  Y G 
Sbjct: 57  RKNLEDAVAALENAKHALAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGT 106

>TPHA0I00540 Chr9 (107264..108934) [1671 bp, 556 aa] {ON} Anc_8.810
           YMR258C
          Length = 556

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 14/68 (20%)

Query: 323 FHHATSLGGIESLVEWRAMTDPYIEQ----TLIR---VSIGCEN--ADDL---IQDLANA 370
           F H  S  G ES+++   +T  Y+++    +LI+   +SIGCEN   D L    +DL+N 
Sbjct: 247 FSHMHSKTGYESIIQ--PLTIEYLDKVFDLSLIKSLDISIGCENDGCDCLSKFYKDLSNK 304

Query: 371 LETLQKES 378
           L  LQK S
Sbjct: 305 LLNLQKLS 312

>Ecym_4126 Chr4 complement(259120..264510) [5391 bp, 1796 aa] {ON}
           similar to Ashbya gossypii AGR188W
          Length = 1796

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 16/93 (17%)

Query: 214 KEEAVA--RQLRDDRIYLGTNVANLESFMLLRSLRTFEMRMLKQSENAT----------- 260
           + E+V+  R L  D+I LG N  N+ S +   SL   E   LK+ EN++           
Sbjct: 815 RNESVSGERALEADKISLGENATNIGSRVSSPSLNIAENSPLKEHENSSPKLCNPFAKQQ 874

Query: 261 ---KIVSFLDSNRDKYDKVLKSITHSSLQKESF 290
               I+S +D+N      +  + THS+  K S+
Sbjct: 875 KTPPIISEVDNNPSSGANLDTASTHSTSAKASY 907

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,682,603
Number of extensions: 1764596
Number of successful extensions: 5942
Number of sequences better than 10.0: 134
Number of HSP's gapped: 5885
Number of HSP's successfully gapped: 154
Length of query: 380
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 269
Effective length of database: 40,753,473
Effective search space: 10962684237
Effective search space used: 10962684237
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)