Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B043302.153ON1271276724e-92
SAKL0E10934g2.153ON113963642e-45
Smik_8.1942.153ON1291253626e-45
Skud_8.1772.153ON1301253574e-44
KLLA0F24024g2.153ON122913549e-44
Ecym_82052.153ON1141113539e-44
NCAS0B070002.153ON1081063521e-43
Suva_15.3132.153ON1321023531e-43
YHR116W (COX23)2.153ON151933473e-42
CAGL0I02728g2.153ON111923408e-42
KLTH0B05148g2.153ON1111113373e-41
Kwal_33.147762.153ON111963234e-39
Kpol_505.202.153ON112933217e-39
ZYRO0G06534g2.153ON112883209e-39
TDEL0B051502.153ON119963201e-38
TPHA0F018702.153ON180903121e-36
KNAG0H035202.153ON109933042e-36
ABR130W2.153ON111923008e-36
KAFR0F007302.153ON108952922e-34
TBLA0B012402.153ON119821906e-19
Suva_10.665.205ON7226640.72
ZYRO0D11924g5.502ON52849680.83
KLTH0H02552g6.284ON7738640.90
KNAG0C016501.298ON55131634.2
Kpol_1043.715.703ON58544624.8
Ecym_82875.205ON5826585.4
SAKL0H08426g8.604ON81620617.9
Smik_12.545.205ON6926578.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B04330
         (127 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2....   263   4e-92
SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly ...   144   2e-45
Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W (...   144   6e-45
Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W (...   142   4e-44
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...   140   9e-44
Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...   140   9e-44
NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2....   140   1e-43
Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W...   140   1e-43
YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}  COX23Mitoch...   138   3e-42
CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {O...   135   8e-42
KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar...   134   3e-41
Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {O...   129   4e-39
Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON} (55992..56...   128   7e-39
ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {O...   127   9e-39
TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON...   127   1e-38
TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.15...   124   1e-36
KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.15...   121   2e-36
ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic hom...   120   8e-36
KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON...   117   2e-34
TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON...    78   6e-19
Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}...    29   0.72 
ZYRO0D11924g Chr4 (1010361..1011947) [1587 bp, 528 aa] {ON} simi...    31   0.83 
KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa...    29   0.90 
KNAG0C01650 Chr3 complement(329328..330983) [1656 bp, 551 aa] {O...    29   4.2  
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...    28   4.8  
Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to ...    27   5.4  
SAKL0H08426g Chr8 complement(726923..729373) [2451 bp, 816 aa] {...    28   7.9  
Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}...    27   8.6  

>NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2.153
           YHR116W
          Length = 127

 Score =  263 bits (672), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 127/127 (100%), Positives = 127/127 (100%)

Query: 1   MSTTSEANKTSGKVTPITSQTESRTPPRKEQQNTTKDTVNFTPDEKDTSTFKYYPDDPEE 60
           MSTTSEANKTSGKVTPITSQTESRTPPRKEQQNTTKDTVNFTPDEKDTSTFKYYPDDPEE
Sbjct: 1   MSTTSEANKTSGKVTPITSQTESRTPPRKEQQNTTKDTVNFTPDEKDTSTFKYYPDDPEE 60

Query: 61  GMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRNNFDRDKCHEYFDAYRECKKQWLMARRN 120
           GMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRNNFDRDKCHEYFDAYRECKKQWLMARRN
Sbjct: 61  GMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRNNFDRDKCHEYFDAYRECKKQWLMARRN 120

Query: 121 NRSQWQK 127
           NRSQWQK
Sbjct: 121 NRSQWQK 127

>SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly
           similar to gnl|GLV|CAGL0I02728g Candida glabrata
           CAGL0I02728g and similar to YHR116W uniprot|P38824
           Saccharomyces cerevisiae YHR116W COX23 Mitochondrial
           intermembrane space protein that functions in
           mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 113

 Score =  144 bits (364), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 65/96 (67%), Positives = 78/96 (81%)

Query: 31  QQNTTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCL 90
           Q  T K+ VNFTP   DTS+FK+YPD+PE  +NK++F  KD S Y+DPCQESS+MSFKCL
Sbjct: 18  QLETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCL 77

Query: 91  DRNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126
           + NN+DRD C EYFDAYRECKKQWL +RR NRSQW+
Sbjct: 78  EMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113

>Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W
           (REAL)
          Length = 129

 Score =  144 bits (362), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 88/125 (70%), Gaps = 1/125 (0%)

Query: 3   TTSEANKTSGKVTPITSQTESRTPPRKEQQNTTKDT-VNFTPDEKDTSTFKYYPDDPEEG 61
           T+   N  + K+    SQ  S + P   +   T  T VN+ P   D S+F+YYPDDPE  
Sbjct: 5   TSDTTNINTTKIIDKDSQPSSSSVPATSKGPVTDRTKVNYVPKSDDPSSFQYYPDDPENP 64

Query: 62  MNKYKFMMKDTSEYYDPCQESSQMSFKCLDRNNFDRDKCHEYFDAYRECKKQWLMARRNN 121
           +NKYKF +K  S+YYDPC+ESS++SF+CL+RN++DR KC EYFDAYRECKKQWL ARRNN
Sbjct: 65  VNKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRNN 124

Query: 122 RSQWQ 126
           R QW+
Sbjct: 125 RQQWE 129

>Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W
           (REAL)
          Length = 130

 Score =  142 bits (357), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 67/125 (53%), Positives = 87/125 (69%), Gaps = 2/125 (1%)

Query: 2   STTSEANKTSGKVTPITSQTESRTPPRKEQQNTTKDTVNFTPDEKDTSTFKYYPDDPEEG 61
           +T +E +  S  +    S   +   PR    + TK  VN+ P   D S+F+YYPDDPE  
Sbjct: 8   ATNAETDNGSSSINLEPSPPLAEPAPRGPITDRTK--VNYVPKNNDPSSFQYYPDDPENP 65

Query: 62  MNKYKFMMKDTSEYYDPCQESSQMSFKCLDRNNFDRDKCHEYFDAYRECKKQWLMARRNN 121
           +NKYKF +K  S+YYDPC+ESS++SF+CL+RN++DR KC EYFDAYRECKKQWL ARR N
Sbjct: 66  INKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKN 125

Query: 122 RSQWQ 126
           R QW+
Sbjct: 126 RQQWE 130

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score =  140 bits (354), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 75/91 (82%)

Query: 36  KDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRNNF 95
           K  VNFTP++ D +T+K+YPDDPE  +N+Y+F +K  SEYYDPCQESS+MSFKCL+ NN+
Sbjct: 32  KTKVNFTPEKTDVNTYKFYPDDPESTLNRYRFAVKGASEYYDPCQESSKMSFKCLELNNY 91

Query: 96  DRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126
           DRD CH+YFDAYRECKKQWL ARR  R  W+
Sbjct: 92  DRDLCHDYFDAYRECKKQWLKARREKREFWE 122

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score =  140 bits (353), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (72%), Gaps = 1/111 (0%)

Query: 16  PITSQTESRTPPRKEQQNTTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEY 75
           P      S++PP K    T K  VNFTP   DTSTF++YPDDPE  +N++KF  K  S Y
Sbjct: 5   PPKDHIPSQSPP-KGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMY 63

Query: 76  YDPCQESSQMSFKCLDRNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126
           YDPC+ESS+MSFKCL+ NN+DR  CH+YFDAYRECKKQWL ARR + S+WQ
Sbjct: 64  YDPCEESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114

>NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2.153
           YHR116W
          Length = 108

 Score =  140 bits (352), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (74%)

Query: 22  ESRTPPRKEQQNTTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQE 81
           E   P  K   +  K  VNFTPDEK+  ++KY+PDDP +G+NKYKF+MK  SEYYDPCQE
Sbjct: 3   EQEQPEEKGNNSNRKQDVNFTPDEKNPGSYKYFPDDPVQGLNKYKFIMKGDSEYYDPCQE 62

Query: 82  SSQMSFKCLDRNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQK 127
            S+MS KCL+RN FD+ +C EYFDAYR+CKK W+  RR NR QW+K
Sbjct: 63  CSEMSRKCLERNPFDKSQCQEYFDAYRDCKKMWMKTRRENRKQWEK 108

>Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W
           (REAL)
          Length = 132

 Score =  140 bits (353), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 79/102 (77%)

Query: 25  TPPRKEQQNTTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQ 84
           T P +    T +  VN+ P   D S+F+YYPDDPE  +NKYKF +K  S+YYDPC+ESS+
Sbjct: 31  TQPARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSK 90

Query: 85  MSFKCLDRNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126
           +SF+CL+RN++DR KC +YFDAYRECKKQWL ARRNNR QW+
Sbjct: 91  LSFQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132

>YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}
           COX23Mitochondrial intermembrane space protein that
           functions in mitochondrial copper homeostasis, essential
           for functional cytochrome oxidase expression; homologous
           to Cox17p; contains twin cysteine-x9-cysteine motifs
          Length = 151

 Score =  138 bits (347), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 60/93 (64%), Positives = 75/93 (80%)

Query: 34  TTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRN 93
           T +  VN+ P   D S+F+YYPDDPE  +NKYKF +K  S+YYDPC+ESS++SF+CL+RN
Sbjct: 59  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 118

Query: 94  NFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126
           ++DR KC EYFDAYRECKKQWL ARR NR QW+
Sbjct: 119 DYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151

>CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116w
          Length = 111

 Score =  135 bits (340), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (82%)

Query: 34  TTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRN 93
           T KD V++ P   DT+ ++YYPD+PE  +NKY+F MKD S+YYDPCQES++MSFKCL+ N
Sbjct: 19  TDKDKVDYAPKGVDTTEYRYYPDNPESTLNKYRFAMKDHSQYYDPCQESAKMSFKCLELN 78

Query: 94  NFDRDKCHEYFDAYRECKKQWLMARRNNRSQW 125
           ++DRD+C EYFDAYRECKKQWL ARR +R+ W
Sbjct: 79  DYDRDQCKEYFDAYRECKKQWLEARRKDRTNW 110

>KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar to
           uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 111

 Score =  134 bits (337), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 78/111 (70%), Gaps = 4/111 (3%)

Query: 16  PITSQTESRTPPRKEQQNTTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEY 75
           P T+  E+  P    Q    K  V++ P   ++ +FK+YPD+PE   NKY+F  KD S++
Sbjct: 5   PKTAPAENADP----QLQVDKTKVDYAPKNTESGSFKFYPDNPESSFNKYRFAAKDASQF 60

Query: 76  YDPCQESSQMSFKCLDRNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126
           YDPCQESS+MS KCL+ NN+DR  C EYFDAYRECKKQWL ARR NRSQW+
Sbjct: 61  YDPCQESSKMSMKCLELNNYDRSMCQEYFDAYRECKKQWLQARRRNRSQWE 111

>Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {ON}
           YHR116W - Hypothetical ORF [contig 101] FULL
          Length = 111

 Score =  129 bits (323), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (73%)

Query: 31  QQNTTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCL 90
           Q    K  +++ P +    ++K+YPD+PE   NK++F  KD S++YDPCQESS+MS KCL
Sbjct: 16  QLQVDKSKIDYAPQDAKAGSYKFYPDNPESSFNKFRFAAKDVSQFYDPCQESSKMSMKCL 75

Query: 91  DRNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126
           + N++DR  C EYFDAYRECKKQWL ARR NRSQW+
Sbjct: 76  ELNDYDRSMCQEYFDAYRECKKQWLQARRKNRSQWE 111

>Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON}
           (55992..56330) [339 nt, 113 aa]
          Length = 112

 Score =  128 bits (321), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 1/93 (1%)

Query: 34  TTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRN 93
           T K  V+F  ++ D    K+YPD+PE  + KY+F+ K+TS+YYDPCQES+QMSF CLDRN
Sbjct: 21  TDKSKVDFA-NKDDKKDLKFYPDNPESTLAKYRFITKETSQYYDPCQESAQMSFNCLDRN 79

Query: 94  NFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126
           N+D+ KC  YFDAYRECKKQWL ARR +RSQW+
Sbjct: 80  NYDKSKCRAYFDAYRECKKQWLRARRQDRSQWE 112

>ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116W COX23 Mitochondrial intermembrane space protein
           that functions in mitochondrial
          Length = 112

 Score =  127 bits (320), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 55/88 (62%), Positives = 69/88 (78%)

Query: 39  VNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRNNFDRD 98
           V++ P       F+YYPD PE  +++Y+F +KD S+Y+DPCQESS+MSF CLDRNN+DR+
Sbjct: 25  VDYAPQGDSPDKFQYYPDKPESSLSRYRFAVKDASQYFDPCQESSRMSFNCLDRNNYDRE 84

Query: 99  KCHEYFDAYRECKKQWLMARRNNRSQWQ 126
            C EYFDAYRECKKQWL ARR NRS W+
Sbjct: 85  MCKEYFDAYRECKKQWLRARRENRSLWE 112

>TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score =  127 bits (320), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 74/96 (77%), Gaps = 2/96 (2%)

Query: 33  NTTKDT--VNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCL 90
              KD+  V++ P  +D S F+YYP++PE G+N+  F +K  S+YYDPCQES+QMS  CL
Sbjct: 24  GAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCL 83

Query: 91  DRNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126
           DRN++++D C EYFDAYRECKKQWL +RR +RSQW+
Sbjct: 84  DRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119

>TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.153
           YHR116W
          Length = 180

 Score =  124 bits (312), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 59/90 (65%), Positives = 73/90 (81%), Gaps = 2/90 (2%)

Query: 34  TTKDTVNFT-PD-EKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLD 91
           T K++V+FT PD   + + FK+YPD+PE    KY+FM KD+S+YYDPC ES++MSFKCLD
Sbjct: 84  TNKESVDFTKPDITLNENRFKFYPDNPESSFAKYRFMSKDSSQYYDPCDESAKMSFKCLD 143

Query: 92  RNNFDRDKCHEYFDAYRECKKQWLMARRNN 121
            N++DRDKC  YFDAYRECKKQWL ARRNN
Sbjct: 144 MNDYDRDKCRAYFDAYRECKKQWLRARRNN 173

>KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.153
           YHR116W
          Length = 109

 Score =  121 bits (304), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%)

Query: 34  TTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRN 93
           + K+TV+F P   +   F+Y+PD P+   +KYKF  K  S++YDPCQESS+MSF CL++N
Sbjct: 17  SGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCLEQN 76

Query: 94  NFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126
           ++DR KC  YFDAYRECKKQWL ARR N+SQW+
Sbjct: 77  DYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109

>ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR116W
          Length = 111

 Score =  120 bits (300), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 55/92 (59%), Positives = 68/92 (73%), Gaps = 1/92 (1%)

Query: 34  TTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRN 93
           T +  VNFTP   D S+F++YPD+ E  + +Y+   K  S+Y DPCQES+ MS KCL+RN
Sbjct: 20  TDRAAVNFTP-STDASSFQFYPDNLESPLARYRXAAKGPSQYXDPCQESANMSMKCLERN 78

Query: 94  NFDRDKCHEYFDAYRECKKQWLMARRNNRSQW 125
           N+DRD C EYFDAYRECKKQWL ARR + SQW
Sbjct: 79  NYDRDLCREYFDAYRECKKQWLSARRKDNSQW 110

>KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON}
           Anc_2.153 YHR116W
          Length = 108

 Score =  117 bits (292), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 55/95 (57%), Positives = 72/95 (75%), Gaps = 2/95 (2%)

Query: 34  TTKDTVNFTPDEKDTST--FKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLD 91
           T K  VNF  ++  T+T  FKYYPDDPE   ++ +F  K  ++YYDPCQES+Q+SFKCL+
Sbjct: 14  TDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFKCLE 73

Query: 92  RNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126
            NN+DR  C +YFDAYRECKKQWL AR+ +RS+W+
Sbjct: 74  LNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108

>TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score = 77.8 bits (190), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 55/82 (67%), Gaps = 2/82 (2%)

Query: 39  VNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCL-DRNNFDR 97
           V+  PD   T TF+Y+PD P   M ++ F  K++S++YDPC ES+QMS +C+ D  +  +
Sbjct: 35  VHHDPDNHVT-TFQYFPDKPTSTMTRFNFADKESSKFYDPCHESAQMSVRCMTDHPDDHK 93

Query: 98  DKCHEYFDAYRECKKQWLMARR 119
             C E+F AYR+CKK W+ A++
Sbjct: 94  TVCAEFFAAYRDCKKAWIDAKK 115

>Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}
           YLL009C (REAL)
          Length = 72

 Score = 29.3 bits (64), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 89  CLDRNNFDRDKCHEYFDAYRECKKQW 114
           C+  N  D DKC E+ D Y+EC K +
Sbjct: 39  CILFNGQDSDKCKEFIDKYKECMKGY 64

>ZYRO0D11924g Chr4 (1010361..1011947) [1587 bp, 528 aa] {ON}
          similar to uniprot|Q12412 Saccharomyces cerevisiae
          YOR161C PNS1
          Length = 528

 Score = 30.8 bits (68), Expect = 0.83,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 5/49 (10%)

Query: 26 PPRKEQQNTTKDTVNFTPDEKDTSTFKYY-----PDDPEEGMNKYKFMM 69
          PP++E  +T ++ V  TP EK       Y     PDD +   N + F +
Sbjct: 31 PPQQEMTDTKQEKVEQTPSEKSNEIAITYEAVFPPDDEKARFNDWPFAL 79

>KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa]
           {ON} similar to uniprot|Q3E7A9 Saccharomyces cerevisiae
           YMR194C-B
          Length = 77

 Score = 29.3 bits (64), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 18/38 (47%)

Query: 77  DPCQESSQMSFKCLDRNNFDRDKCHEYFDAYRECKKQW 114
           DPC+  +     CL +  FD  KC    D+  EC  ++
Sbjct: 3   DPCKPQACAIQGCLTKTGFDESKCSHLIDSLYECCSKF 40

>KNAG0C01650 Chr3 complement(329328..330983) [1656 bp, 551 aa] {ON}
           Anc_1.298 YBR286W
          Length = 551

 Score = 28.9 bits (63), Expect = 4.2,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 27  PRKEQQNTTKDTVNFTPDEKDTSTFKYYPDD 57
           P +E  N T   ++  P  +DT  FKY  DD
Sbjct: 518 PEREVANNTVTAISRAPAHRDTPLFKYRADD 548

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 24/44 (54%)

Query: 34  TTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYD 77
           T+KD + +T   K T  FK+   D +  ++ + F +K   +YY+
Sbjct: 213 TSKDDIKYTSSSKPTKYFKFTISDFQHNLDVFIFGVKGVEKYYN 256

>Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to
           Ashbya gossypii AAL161W
          Length = 58

 Score = 26.9 bits (58), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 13/26 (50%)

Query: 89  CLDRNNFDRDKCHEYFDAYRECKKQW 114
           CL  N  +  KC E  D YR C K +
Sbjct: 29  CLLFNGLESTKCKELVDKYRSCMKGY 54

>SAKL0H08426g Chr8 complement(726923..729373) [2451 bp, 816 aa] {ON}
           weakly similar to uniprot|Q08581 Saccharomyces
           cerevisiae YOR195W SLK19 Kinetochore-associated protein
           required for normal segregation of chromosomes in
           meiosis and mitosis component of the FEAR regulatory
           network which promotes Cdc14p release from the nucleolus
           during anaphase potential Cdc28p substrate
          Length = 816

 Score = 28.1 bits (61), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 10  TSGKVTPITSQTESRTPPRK 29
           TSGK T +T Q+ES+ PP K
Sbjct: 141 TSGKNTVLTEQSESQEPPLK 160

>Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}
           YLL009C (REAL)
          Length = 69

 Score = 26.6 bits (57), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 89  CLDRNNFDRDKCHEYFDAYRECKKQW 114
           C+  N  D +KC E+ + Y+EC K +
Sbjct: 36  CILFNGQDSEKCKEFIEKYKECMKGY 61

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.124    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,306,720
Number of extensions: 746111
Number of successful extensions: 3096
Number of sequences better than 10.0: 119
Number of HSP's gapped: 3087
Number of HSP's successfully gapped: 124
Length of query: 127
Length of database: 53,481,399
Length adjustment: 96
Effective length of query: 31
Effective length of database: 42,473,463
Effective search space: 1316677353
Effective search space used: 1316677353
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)