Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0B035602.284ON75675635400.0
NCAS0B062602.284ON72376417220.0
Suva_9.1042.284ON80582515630.0
YIL095W (PRK1)2.284ON81081715500.0
Smik_9.842.284ON80881515440.0
Skud_9.782.284ON80982715290.0
TDEL0G021502.284ON66131113351e-175
KAFR0J013702.284ON78036613281e-172
SAKL0E07722g2.284ON79131113101e-169
KAFR0H033302.284ON36931212651e-168
CAGL0G02607g2.284ON68831112951e-168
NCAS0G038102.284ON66131112911e-168
TPHA0C033802.284ON69731512901e-167
Kwal_27.115422.284ON79135112911e-166
Kpol_1003.352.284ON71331112801e-166
NDAI0G006402.284ON62131112681e-165
KLLA0E08405g2.284ON77731112801e-165
KLTH0G10318g2.284ON79031112701e-163
TBLA0B059302.284ON71731112401e-160
ZYRO0A01848g2.284ON70431112371e-159
Skud_14.3092.284ON63930912201e-158
YNL020C (ARK1)2.284ON63830912151e-157
KNAG0H020202.284ON59231112101e-157
Smik_14.3112.284ON63734312141e-157
ADL217W2.284ON75031512091e-155
Ecym_33232.284ON74836012071e-154
Kpol_1039.332.284ON70131111971e-154
Suva_14.3272.284ON63230811901e-153
KNAG0A054302.284ON78831511761e-149
TBLA0B069402.284ON144331511781e-143
CAGL0J03432g2.284ON62231110851e-138
TPHA0D015402.284ON70730310401e-130
CAGL0H10208g3.273ON10273208221e-95
SAKL0D03234g3.273ON8583077982e-93
KAFR0A010403.273ON9123207899e-92
Kpol_1052.223.273ON11013127943e-91
KNAG0J008203.273ON10913227943e-91
TBLA0E025903.273ON10613187759e-89
Kpol_251.43.273ON8383117631e-88
NCAS0A105903.273ON10953187751e-88
TDEL0D035203.273ON10493167722e-88
KNAG0H012203.273ON9133237652e-88
KLTH0C07260g3.273ON9013087643e-88
NDAI0A057003.273ON11573267744e-88
KAFR0C004303.273ON9493227602e-87
Ecym_26503.273ON8943077573e-87
KLLA0F18612g3.273ON8143177514e-87
Kwal_27.109453.273ON9353087513e-86
Suva_4.2973.273ON11073197583e-86
TPHA0A040303.273ON10543297564e-86
ZYRO0E06864g3.273ON11153197576e-86
YBR059C (AKL1)3.273ON11083197551e-85
Skud_2.1793.273ON10903197488e-85
Smik_2.1913.273ON11083197452e-84
TBLA0I019303.273ON13613137487e-84
CAGL0K11990g3.273ON9913147315e-83
AGR027C3.273ON9613077281e-82
TPHA0M011203.273ON7883147102e-81
SAKL0A03344g6.262ON3643562452e-21
Kwal_56.242746.262ON3463392343e-20
TDEL0A067506.262ON3723482336e-20
KLTH0H03080g6.262ON3463332282e-19
Smik_13.1596.31ON7052752244e-18
Kpol_1023.266.31ON7392732235e-18
CAGL0M02299g8.668ON8931972245e-18
SAKL0H06754g8.668ON8842002228e-18
NCAS0C041008.141ON9053312201e-17
Kpol_1037.206.31ON7042742192e-17
Skud_16.426.262ON3643332132e-17
Skud_13.1546.31ON7052752182e-17
YMR001C (CDC5)6.31ON7052752173e-17
KNAG0F001701.24ON5432132153e-17
Suva_13.1636.31ON7052752164e-17
Suva_16.706.262ON3643392096e-17
KNAG0D048107.86ON14402442157e-17
NDAI0C026806.31ON7502752147e-17
KAFR0A050906.31ON6682432137e-17
YJL095W (BCK1)1.271ON14782682158e-17
NCAS0C016708.668ON8961972148e-17
ZYRO0E07876g6.262ON3693372089e-17
KLLA0F11319g8.668ON8431952139e-17
Suva_16.1608.668ON9181962131e-16
KNAG0E008506.31ON7112762121e-16
YPL236C (ENV7)6.262ON3643292061e-16
ZYRO0D05500g7.86ON12622452131e-16
TPHA0G016308.668ON8712012121e-16
Smik_10.1471.271ON14782772121e-16
TDEL0G043806.31ON7222742112e-16
ACL006W6.31ON7082822102e-16
NDAI0E023908.668ON8831952112e-16
NCAS0D021006.31ON7262742093e-16
KAFR0G026906.31ON7132742083e-16
TPHA0J004206.31ON7072742084e-16
Kwal_26.71547.86ON12132442084e-16
Skud_10.1191.271ON14812682084e-16
KNAG0D008306.262ON3873152025e-16
CAGL0J11638g6.31ON7462812066e-16
ZYRO0C07480g6.31ON7742742067e-16
Smik_6.4416.262ON3643332017e-16
TDEL0A027202.496ON9152332067e-16
Ecym_30356.31ON7402842058e-16
CAGL0K08514g2.479ON14892412069e-16
ACR133C8.668ON8511992041e-15
TDEL0H036407.86ON12372482041e-15
Suva_6.1691.271ON14842712051e-15
ABL034W2.479ON14253172051e-15
KLTH0F16676g5.406ON8782542041e-15
Kpol_1072.198.668ON8961962031e-15
KAFR0G012001.24ON5072782011e-15
ZYRO0F18062g1.24ON4711972011e-15
ZYRO0F07194g8.668ON9381982031e-15
NCAS0A002801.24ON5352832012e-15
KAFR0D012207.86ON10551982022e-15
KAFR0H025108.668ON8791992022e-15
Skud_16.1328.668ON9241962022e-15
NDAI0K021002.496ON9092352012e-15
YPL150W8.668ON9011962003e-15
TBLA0A047207.86ON12622462013e-15
TBLA0B004906.31ON7872751994e-15
Smik_1.793.177ON9742752004e-15
TPHA0E038501.24ON4821931974e-15
Skud_1.723.177ON9742831995e-15
Kwal_26.73551.271ON14462562005e-15
Ecym_21536.262ON3633501936e-15
KLLA0F07623g7.86ON12292471996e-15
KLLA0E21693g5.406ON10162641986e-15
YAR019C (CDC15)3.177ON9742751978e-15
KNAG0B053502.496ON8362351978e-15
TDEL0A025502.479ON13691991971e-14
NDAI0F045201.24ON4891981931e-14
SAKL0B09856g7.86ON12742441961e-14
Kwal_55.215455.406ON8652021951e-14
NCAS0C041208.140ON9152661951e-14
TDEL0C067801.24ON4682861931e-14
KLTH0D11044g8.668ON8491981951e-14
Kpol_1040.207.86ON12972441952e-14
Ecym_26407.86ON13252441952e-14
TPHA0F024306.31ON7982761932e-14
NDAI0G054701.271ON15552681943e-14
TPHA0H026307.86ON13672471933e-14
KLTH0C10912g6.31ON6972761913e-14
Sklu_YGOB_Anc_2.4962.496ON6192301904e-14
Smik_6.3478.668ON9171961914e-14
Kwal_26.87518.668ON8481981914e-14
TDEL0A061408.668ON8611961914e-14
SAKL0C00946g1.24ON5642261904e-14
TPHA0G032902.496ON9731761914e-14
Kpol_1055.242.496ON9372281915e-14
CAGL0K02673g2.496ON9152861915e-14
KNAG0J016708.668ON10091981915e-14
NDAI0J012508.279ON11761941915e-14
Smik_8.422.496ON9391761906e-14
Kpol_1065.36.222ON3762781856e-14
YDR523C (SPS1)1.24ON4902001876e-14
SAKL0E01584g6.31ON6952751897e-14
Suva_15.653.92ON10802641897e-14
KNAG0H031408.279ON9362001897e-14
Smik_15.1227.86ON11012471898e-14
CAGL0I07513g3.92ON10763711899e-14
ACR281C7.86ON12592441899e-14
KLLA0C06138g6.31ON7082741889e-14
NCAS0A094701.271ON15152681891e-13
Suva_11.1232.479ON15262191891e-13
YOL100W (PKH2)3.92ON10812641881e-13
Kwal_56.224766.31ON6972741871e-13
KLTH0D03454g1.271ON14332901881e-13
KAFR0C014403.92ON10952711881e-13
Kwal_33.131121.24ON5052791851e-13
YOL045W (PSK2)7.86ON11012471881e-13
CAGL0H06259g7.86ON13362441881e-13
NDAI0E012908.654ON7292341871e-13
Smik_4.8031.24ON4902001851e-13
NDAI0D027502.479ON15151971881e-13
Kpol_463.81.271ON14472861881e-13
Skud_15.1127.86ON11012471871e-13
Skud_8.392.496ON9231761871e-13
Ecym_73922.479ON14342011872e-13
KAFR0D049505.406ON10082021862e-13
YHL007C (STE20)2.496ON9391761862e-13
Kpol_2002.241.24ON4872761832e-13
Kpol_1044.37.86ON9321791852e-13
KNAG0L005207.86ON3682761812e-13
KLTH0D02486g7.86ON12232441862e-13
TBLA0H016605.406ON9962141852e-13
Suva_8.472.496ON9801761853e-13
Ecym_10301.24ON4401931823e-13
KLTH0G05214g5.591ON6531951843e-13
Ecym_55055.406ON10031951853e-13
KLTH0D05566g2.479ON11281991853e-13
TBLA0I011502.479ON17451991853e-13
Kpol_431.92.479ON15521991853e-13
TBLA0E022907.86ON13002371843e-13
KLTH0D10714g8.654ON8722921843e-13
KAFR0K007007.86ON13812441843e-13
CAGL0F00913g7.86ON12062001843e-13
NCAS0A057702.479ON14612091843e-13
ZYRO0G03366g2.479ON16161991844e-13
KNAG0K023703.60ON8832381834e-13
ZYRO0B01166g2.496ON9631751835e-13
Suva_1.863.177ON9742831825e-13
KNAG0D002106.371ON8332001825e-13
CAGL0L11550g5.406ON10722021825e-13
Skud_4.7971.24ON4851961805e-13
KNAG0F029006.31ON6492631815e-13
NDAI0F013406.262ON4061541786e-13
Suva_2.7031.24ON4851961806e-13
Skud_11.1262.479ON15182181826e-13
CAGL0G04609g3.92ON9652981816e-13
KLTH0F00946g1.24ON5122271796e-13
SAKL0D05522g1.271ON14742901826e-13
Kwal_26.78612.496ON9552301817e-13
TBLA0B082503.92ON13471961817e-13
KLLA0A07403g3.60ON8792011817e-13
Suva_15.2975.406ON10742021817e-13
KAFR0B028008.279ON10952161818e-13
Suva_15.1247.86ON11062471808e-13
NDAI0H024707.86ON14112561818e-13
YKL101W (HSL1)2.479ON15182191819e-13
Kwal_26.77882.479ON12671991819e-13
KLLA0F13552g2.479ON12672011819e-13
TPHA0L005007.86ON9591821809e-13
ZYRO0D06776g8.279ON12042131809e-13
Ecym_52513.177ON8932801809e-13
NCAS0B044906.222ON3492031759e-13
KLLA0B13607g2.496ON9891761809e-13
Skud_8.1635.406ON10762011809e-13
TBLA0A035705.406ON9752001809e-13
KAFR0D032002.479ON14482561801e-12
TPHA0H016305.406ON10362821801e-12
NCAS0A050502.496ON8931761791e-12
TPHA0P012703.60ON8851811791e-12
TBLA0B085203.60ON9341811791e-12
KAFR0A014201.271ON13982801791e-12
AFR724C1.24ON4401931761e-12
KLLA0F14190g1.271ON13382641791e-12
KNAG0B017801.271ON15802191791e-12
KLLA0C12485g3.92ON9252701791e-12
KLTH0D06006g2.496ON9542301781e-12
Smik_15.573.92ON10812971781e-12
KAFR0D033902.496ON7982321782e-12
NCAS0F015807.86ON13822471782e-12
NDAI0C017005.406ON10202021782e-12
CAGL0L03520g1.271ON14472841782e-12
Kpol_1031.105.406ON11272001782e-12
TBLA0C029401.271ON16432951782e-12
ACL104C5.406ON9472011772e-12
Smik_11.1392.479ON15342191772e-12
CAGL0M10153g2.496ON8671801772e-12
KAFR0A017602.496ON8851761772e-12
Ecym_24058.668ON8551981762e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0B03560
         (756 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...  1368   0.0  
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   667   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   606   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   601   0.0  
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   599   0.0  
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   593   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   518   e-175
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   516   e-172
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   509   e-169
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   491   e-168
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   503   e-168
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   501   e-168
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   501   e-167
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   501   e-166
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   497   e-166
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    493   e-165
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   497   e-165
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   493   e-163
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   482   e-160
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   481   e-159
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   474   e-158
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   472   e-157
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   470   e-157
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   472   e-157
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   470   e-155
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   469   e-154
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   465   e-154
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   462   e-153
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   457   e-149
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   458   e-143
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   422   e-138
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   405   e-130
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   321   1e-95
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   311   2e-93
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   308   9e-92
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   310   3e-91
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   310   3e-91
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   303   9e-89
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   298   1e-88
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   303   1e-88
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   301   2e-88
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   299   2e-88
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   298   3e-88
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   302   4e-88
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   297   2e-87
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   296   3e-87
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   293   4e-87
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   293   3e-86
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   296   3e-86
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   295   4e-86
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   296   6e-86
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   295   1e-85
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   292   8e-85
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   291   2e-84
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   292   7e-84
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   286   5e-83
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   285   1e-82
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   278   2e-81
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    99   2e-21
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    95   3e-20
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    94   6e-20
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    92   2e-19
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    91   4e-18
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    91   5e-18
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    91   5e-18
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    90   8e-18
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     89   1e-17
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    89   2e-17
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    87   2e-17
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    89   2e-17
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    88   3e-17
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    87   3e-17
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    88   4e-17
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    85   6e-17
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    87   7e-17
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    87   7e-17
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             87   7e-17
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    87   8e-17
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    87   8e-17
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    85   9e-17
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    87   9e-17
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    87   1e-16
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    86   1e-16
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    84   1e-16
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    87   1e-16
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    86   1e-16
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    86   1e-16
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    86   2e-16
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    86   2e-16
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    86   2e-16
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      85   3e-16
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    85   3e-16
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    85   4e-16
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    85   4e-16
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    85   4e-16
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    82   5e-16
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    84   6e-16
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    84   7e-16
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    82   7e-16
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    84   7e-16
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    84   8e-16
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    84   9e-16
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    83   1e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    83   1e-15
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    84   1e-15
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    84   1e-15
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    83   1e-15
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    83   1e-15
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    82   1e-15
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    82   1e-15
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    83   1e-15
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        82   2e-15
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    82   2e-15
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    82   2e-15
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    82   2e-15
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    82   2e-15
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    82   3e-15
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    82   3e-15
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    81   4e-15
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    82   4e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    80   4e-15
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    81   5e-15
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    82   5e-15
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    79   6e-15
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    81   6e-15
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    81   6e-15
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    80   8e-15
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    80   8e-15
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    80   1e-14
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    79   1e-14
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    80   1e-14
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    80   1e-14
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    80   1e-14
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    79   1e-14
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    80   1e-14
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    80   2e-14
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    80   2e-14
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    79   2e-14
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    79   3e-14
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    79   3e-14
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    78   3e-14
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    78   4e-14
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    78   4e-14
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    78   4e-14
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    78   4e-14
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    78   4e-14
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    78   4e-14
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    78   5e-14
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    78   5e-14
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    78   5e-14
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    78   5e-14
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    78   6e-14
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    76   6e-14
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    77   6e-14
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    77   7e-14
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    77   7e-14
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    77   7e-14
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    77   8e-14
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    77   9e-14
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    77   9e-14
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    77   9e-14
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    77   1e-13
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    77   1e-13
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    77   1e-13
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    77   1e-13
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    77   1e-13
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    77   1e-13
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    76   1e-13
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    77   1e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    77   1e-13
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    77   1e-13
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    76   1e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    77   1e-13
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    77   1e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    77   1e-13
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    77   1e-13
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    77   2e-13
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    76   2e-13
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    76   2e-13
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    75   2e-13
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    76   2e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    74   2e-13
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    76   2e-13
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    76   2e-13
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    76   3e-13
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    75   3e-13
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    75   3e-13
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    76   3e-13
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    76   3e-13
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    76   3e-13
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    76   3e-13
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    75   3e-13
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    75   3e-13
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    75   3e-13
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    75   3e-13
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    75   3e-13
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    75   4e-13
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    75   4e-13
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    75   5e-13
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    75   5e-13
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    75   5e-13
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    75   5e-13
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    74   5e-13
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               74   5e-13
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    73   6e-13
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    74   6e-13
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    75   6e-13
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    74   6e-13
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    74   6e-13
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    75   6e-13
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    74   7e-13
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    74   7e-13
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    74   7e-13
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    74   7e-13
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    74   8e-13
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    74   8e-13
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    74   8e-13
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    74   9e-13
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    74   9e-13
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    74   9e-13
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    74   9e-13
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    74   9e-13
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    74   9e-13
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     72   9e-13
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    74   9e-13
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    74   9e-13
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    74   9e-13
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    74   1e-12
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    74   1e-12
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    74   1e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    74   1e-12
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    74   1e-12
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    74   1e-12
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    72   1e-12
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    74   1e-12
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    74   1e-12
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    74   1e-12
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    73   1e-12
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    73   1e-12
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    73   2e-12
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    73   2e-12
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    73   2e-12
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    73   2e-12
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    73   2e-12
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    73   2e-12
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    73   2e-12
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    73   2e-12
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    73   2e-12
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    73   2e-12
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    72   2e-12
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    73   2e-12
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    72   2e-12
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    72   3e-12
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    72   3e-12
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    72   3e-12
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    72   3e-12
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    72   3e-12
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    72   3e-12
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    72   3e-12
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    72   4e-12
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    72   4e-12
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    72   4e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    71   4e-12
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    72   4e-12
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    71   4e-12
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    72   4e-12
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    72   5e-12
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    71   5e-12
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       72   5e-12
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    72   5e-12
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    71   5e-12
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    72   5e-12
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    71   5e-12
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    71   6e-12
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     71   6e-12
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    71   6e-12
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    71   6e-12
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    71   6e-12
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    71   6e-12
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    71   7e-12
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    71   7e-12
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    71   7e-12
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    71   7e-12
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    71   8e-12
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    71   8e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    71   8e-12
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    71   8e-12
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    71   8e-12
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    70   9e-12
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    71   9e-12
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    70   9e-12
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    71   9e-12
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    71   9e-12
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    70   1e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    70   1e-11
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    70   1e-11
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    70   1e-11
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     70   1e-11
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    70   1e-11
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    70   1e-11
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    70   1e-11
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    70   1e-11
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    70   1e-11
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    70   1e-11
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    70   2e-11
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    70   2e-11
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    70   2e-11
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    70   2e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    70   2e-11
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    70   2e-11
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    70   2e-11
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    70   2e-11
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    70   2e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    70   2e-11
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    70   2e-11
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    70   2e-11
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    69   2e-11
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    70   2e-11
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    70   2e-11
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    70   2e-11
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    70   2e-11
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    70   2e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    69   2e-11
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    69   2e-11
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    69   2e-11
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    69   3e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    68   3e-11
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    68   3e-11
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    69   3e-11
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    69   3e-11
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    68   3e-11
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    68   3e-11
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    69   3e-11
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    69   3e-11
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    69   3e-11
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    69   4e-11
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    69   4e-11
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    68   4e-11
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    69   4e-11
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    69   4e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    69   4e-11
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    69   4e-11
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    68   4e-11
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    69   4e-11
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              69   4e-11
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    69   5e-11
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    68   5e-11
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    68   5e-11
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    68   5e-11
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    68   5e-11
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    69   5e-11
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    68   5e-11
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    68   5e-11
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    68   5e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    68   6e-11
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    67   6e-11
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    68   6e-11
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    68   6e-11
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    68   6e-11
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              68   6e-11
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    68   7e-11
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    68   7e-11
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    67   7e-11
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    68   7e-11
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     68   7e-11
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    67   8e-11
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    67   8e-11
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    68   8e-11
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    68   8e-11
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    67   9e-11
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    67   9e-11
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    67   1e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    67   1e-10
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    67   1e-10
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    67   1e-10
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    66   1e-10
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    67   1e-10
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    67   1e-10
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    66   1e-10
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     67   1e-10
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    66   1e-10
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    67   1e-10
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    67   1e-10
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    67   1e-10
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    67   1e-10
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    66   1e-10
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    67   1e-10
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    66   1e-10
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    66   1e-10
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    67   1e-10
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    67   1e-10
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    66   1e-10
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    67   1e-10
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    67   1e-10
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     67   1e-10
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    65   1e-10
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    67   1e-10
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    67   1e-10
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    67   1e-10
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               66   2e-10
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    67   2e-10
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    66   2e-10
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    67   2e-10
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    67   2e-10
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    66   2e-10
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    67   2e-10
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    66   2e-10
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    67   2e-10
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    66   2e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    66   2e-10
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    66   2e-10
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    66   2e-10
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    66   2e-10
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    66   2e-10
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    66   2e-10
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    65   2e-10
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    66   2e-10
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    66   2e-10
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    66   2e-10
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    66   2e-10
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    66   3e-10
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    66   3e-10
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    66   3e-10
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    66   3e-10
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    65   3e-10
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    66   3e-10
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    65   3e-10
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    65   3e-10
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    66   3e-10
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    65   3e-10
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    64   3e-10
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    66   3e-10
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    66   3e-10
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    65   3e-10
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    65   4e-10
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    64   4e-10
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       64   4e-10
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    64   4e-10
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    65   4e-10
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    64   4e-10
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    65   4e-10
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    65   4e-10
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    65   4e-10
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    65   4e-10
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    65   4e-10
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    65   4e-10
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    65   4e-10
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    64   4e-10
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    65   4e-10
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    65   4e-10
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    65   5e-10
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    65   5e-10
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    65   5e-10
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    65   5e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    65   5e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    65   5e-10
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    64   5e-10
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    65   5e-10
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    65   5e-10
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    65   5e-10
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    65   5e-10
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    65   6e-10
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    65   6e-10
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    64   6e-10
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    64   6e-10
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    65   6e-10
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    65   6e-10
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    64   6e-10
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    65   6e-10
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    64   6e-10
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    65   6e-10
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    64   6e-10
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    65   6e-10
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    65   6e-10
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    65   6e-10
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    64   7e-10
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    65   7e-10
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    64   7e-10
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    65   7e-10
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    65   7e-10
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    64   7e-10
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    64   7e-10
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    64   8e-10
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    64   8e-10
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               64   8e-10
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    64   8e-10
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    64   9e-10
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    63   9e-10
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    64   9e-10
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    64   9e-10
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    64   9e-10
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    63   1e-09
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    63   1e-09
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               64   1e-09
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    64   1e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    63   1e-09
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    63   1e-09
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    63   1e-09
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    64   1e-09
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     63   1e-09
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    64   1e-09
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    64   1e-09
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    64   1e-09
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    64   1e-09
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    64   1e-09
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    64   1e-09
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    63   1e-09
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     64   1e-09
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    64   1e-09
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    63   1e-09
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    64   1e-09
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    64   1e-09
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    62   1e-09
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    62   1e-09
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    64   2e-09
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    64   2e-09
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    64   2e-09
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    63   2e-09
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    64   2e-09
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    64   2e-09
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    63   2e-09
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    63   2e-09
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    63   2e-09
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    63   2e-09
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    62   2e-09
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    63   2e-09
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    62   2e-09
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    64   2e-09
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    62   2e-09
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    62   2e-09
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    63   2e-09
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    63   2e-09
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    62   2e-09
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    63   2e-09
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    63   2e-09
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    63   2e-09
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    62   2e-09
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    62   2e-09
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    63   2e-09
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    62   3e-09
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    62   3e-09
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    62   3e-09
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               62   3e-09
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    63   3e-09
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    62   3e-09
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    63   3e-09
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    62   3e-09
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    62   3e-09
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    61   3e-09
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    62   3e-09
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    62   3e-09
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    61   3e-09
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    62   3e-09
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    62   4e-09
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    62   4e-09
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    62   4e-09
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    62   4e-09
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    62   4e-09
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    62   4e-09
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    61   4e-09
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    61   4e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    61   4e-09
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    62   4e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    62   4e-09
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    61   4e-09
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    62   4e-09
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    62   4e-09
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    61   4e-09
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    62   4e-09
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    61   4e-09
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    62   4e-09
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    62   4e-09
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    62   5e-09
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     62   5e-09
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    61   5e-09
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    62   5e-09
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    62   5e-09
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    62   5e-09
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    62   5e-09
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    62   5e-09
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    61   6e-09
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    62   6e-09
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    61   6e-09
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    61   6e-09
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    61   6e-09
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    62   6e-09
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    61   6e-09
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    61   6e-09
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    62   6e-09
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    62   6e-09
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    62   6e-09
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    62   6e-09
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    61   7e-09
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    61   7e-09
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    59   7e-09
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    60   7e-09
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    61   7e-09
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     60   7e-09
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    61   8e-09
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    60   8e-09
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    61   8e-09
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    61   8e-09
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    60   8e-09
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    61   8e-09
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    61   8e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    61   8e-09
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    60   8e-09
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    61   8e-09
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    61   9e-09
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    60   9e-09
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    60   9e-09
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    61   9e-09
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    60   9e-09
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    61   9e-09
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    60   9e-09
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    60   1e-08
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    60   1e-08
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    60   1e-08
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    61   1e-08
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    60   1e-08
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    60   1e-08
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    60   1e-08
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    60   1e-08
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    60   1e-08
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    60   1e-08
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    60   1e-08
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    61   1e-08
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              60   1e-08
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    60   1e-08
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    61   1e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    60   1e-08
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    60   1e-08
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    60   1e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    60   1e-08
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    60   1e-08
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    60   1e-08
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    60   1e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    60   1e-08
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    60   1e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    60   1e-08
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    59   1e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    60   1e-08
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    60   1e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    60   1e-08
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              60   1e-08
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    60   2e-08
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    59   2e-08
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    60   2e-08
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    60   2e-08
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               60   2e-08
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    60   2e-08
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    59   2e-08
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    60   2e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    59   2e-08
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    60   2e-08
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    59   2e-08
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    60   2e-08
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    60   2e-08
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    60   2e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    60   2e-08
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    59   2e-08
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    59   2e-08
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    59   2e-08
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    59   2e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    60   2e-08
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    59   2e-08
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    60   2e-08
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    59   2e-08
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    60   2e-08
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    60   2e-08
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    59   2e-08
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    59   2e-08
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    59   2e-08
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    60   2e-08
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    60   2e-08
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    59   2e-08
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    59   2e-08
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    60   2e-08
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    59   2e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    60   2e-08
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    59   2e-08
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    60   2e-08
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    59   2e-08
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    59   2e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    59   2e-08
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    59   2e-08
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    59   3e-08
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    59   3e-08
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    59   3e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    59   3e-08
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    59   3e-08
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    58   3e-08
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    59   3e-08
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    59   3e-08
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    59   3e-08
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    59   3e-08
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               59   3e-08
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    59   3e-08
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    59   3e-08
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    59   3e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    59   3e-08
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    59   3e-08
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    59   3e-08
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    59   3e-08
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              58   3e-08
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    59   3e-08
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    59   3e-08
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    59   3e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    59   3e-08
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    59   3e-08
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    59   3e-08
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    59   4e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    58   4e-08
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    59   4e-08
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    59   4e-08
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    58   4e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    58   4e-08
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    58   4e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    59   4e-08
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    59   4e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    58   4e-08
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    58   5e-08
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    59   5e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    59   5e-08
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    59   5e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    58   5e-08
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    58   5e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    58   5e-08
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    57   5e-08
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    58   5e-08
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    58   5e-08
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    58   5e-08
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    58   6e-08
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    58   6e-08
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    59   6e-08
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    58   6e-08
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    58   6e-08
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    59   6e-08
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    58   6e-08
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    59   6e-08
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              58   6e-08
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    57   6e-08
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    58   6e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              58   6e-08
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    58   6e-08
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    58   7e-08
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    58   7e-08
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    57   7e-08
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    58   7e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    57   7e-08
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    58   7e-08
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    58   7e-08
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    57   7e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    58   7e-08
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     58   7e-08
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    58   7e-08
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    58   7e-08
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    57   7e-08
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    58   8e-08
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    58   8e-08
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    57   8e-08
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    57   8e-08
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    57   8e-08
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     57   8e-08
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    57   8e-08
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    58   8e-08
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     58   9e-08
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    57   9e-08
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    58   9e-08
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    57   9e-08
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    57   9e-08
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    57   9e-08
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    58   9e-08
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    56   9e-08
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    58   9e-08
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    58   9e-08
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    57   9e-08
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    58   9e-08
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    57   1e-07
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    57   1e-07
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    57   1e-07
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    58   1e-07
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    58   1e-07
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    57   1e-07
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    57   1e-07
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               57   1e-07
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    57   1e-07
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    56   1e-07
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    57   1e-07
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    57   1e-07
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    57   1e-07
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    57   1e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    57   1e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    57   1e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    57   1e-07
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    57   1e-07
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    57   1e-07
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    57   1e-07
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    57   1e-07
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    57   1e-07
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    57   1e-07
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    57   1e-07
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    57   1e-07
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    57   1e-07
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    57   1e-07
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    57   1e-07
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    57   1e-07
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    57   1e-07
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    57   1e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    57   1e-07
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    57   1e-07
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    57   1e-07
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    56   1e-07
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    57   1e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    56   1e-07
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    57   1e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    57   2e-07
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    57   2e-07
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      57   2e-07
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    57   2e-07
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    57   2e-07
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    57   2e-07
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    57   2e-07
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    57   2e-07
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    57   2e-07
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    56   2e-07
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    57   2e-07
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    57   2e-07
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    57   2e-07
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    57   2e-07
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    57   2e-07
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               57   2e-07
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    56   2e-07
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    55   2e-07
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    56   2e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    57   2e-07
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    57   2e-07
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    56   2e-07
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    56   2e-07
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    56   2e-07
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    56   2e-07
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               56   2e-07
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    56   2e-07
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    56   2e-07
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               56   2e-07
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    55   2e-07
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    56   2e-07
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    56   2e-07
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    56   2e-07
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    56   2e-07
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    55   2e-07
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    57   2e-07
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    56   2e-07
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    57   2e-07
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    56   2e-07
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    56   2e-07
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    56   2e-07
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    56   2e-07
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    55   2e-07
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    56   2e-07
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    56   3e-07
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    56   3e-07
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    56   3e-07
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    56   3e-07
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    55   3e-07
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    56   3e-07
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    55   3e-07
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    56   3e-07
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    56   3e-07
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    56   3e-07
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    56   3e-07
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    55   3e-07
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     55   3e-07
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    55   3e-07
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    56   3e-07
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    55   3e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    55   3e-07
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    55   3e-07
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    55   3e-07
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    55   3e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    55   3e-07
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    56   3e-07
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    55   3e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    56   3e-07
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    55   4e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    56   4e-07
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    56   4e-07
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    54   4e-07
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    54   4e-07
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    55   4e-07
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    55   4e-07
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    55   4e-07
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    56   4e-07
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    55   4e-07
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     55   4e-07
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    56   4e-07
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    55   4e-07
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    55   4e-07
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    55   4e-07
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    55   4e-07
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    55   4e-07
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    55   4e-07
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    55   4e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    55   5e-07
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    55   5e-07
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    55   5e-07
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    55   5e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    55   5e-07
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    55   5e-07
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    55   5e-07
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    55   5e-07
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    55   5e-07
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    55   5e-07
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    55   5e-07
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     55   5e-07
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    55   5e-07
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    55   5e-07
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    55   5e-07
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    55   5e-07
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    55   6e-07
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    54   6e-07
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    55   6e-07
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    55   6e-07
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    55   6e-07
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    55   6e-07
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    55   6e-07
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    55   6e-07
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    55   7e-07
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    55   7e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    55   7e-07
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    54   7e-07
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    54   7e-07
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    55   7e-07
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    55   7e-07
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    54   7e-07
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    55   7e-07
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    55   7e-07
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    54   8e-07
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    54   8e-07
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    54   8e-07
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    54   8e-07
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    55   8e-07
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    55   8e-07
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    54   8e-07
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    54   8e-07
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    54   8e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    53   8e-07
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    54   8e-07
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    54   9e-07
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    54   9e-07
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    54   9e-07
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    54   9e-07
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    54   9e-07
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    54   9e-07
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    53   9e-07
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              54   9e-07
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    54   9e-07
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    54   9e-07
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    53   9e-07
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    55   9e-07
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    54   1e-06
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    55   1e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    54   1e-06
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    54   1e-06
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    54   1e-06
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    54   1e-06
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    54   1e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    54   1e-06
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    54   1e-06
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    54   1e-06
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    54   1e-06
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    54   1e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    54   1e-06
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     54   1e-06
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    53   1e-06
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    54   1e-06
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    53   1e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    54   1e-06
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    54   1e-06
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    54   1e-06
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    54   1e-06
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     53   1e-06
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    54   1e-06
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    54   1e-06
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    54   1e-06
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    54   1e-06
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    54   1e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    54   1e-06
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    54   1e-06
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    54   1e-06
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    54   1e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    54   1e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    54   1e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    54   1e-06
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    53   1e-06
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    54   1e-06
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    54   1e-06
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    54   1e-06
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    53   1e-06
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    54   2e-06
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    54   2e-06
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    53   2e-06
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    54   2e-06
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     54   2e-06
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    54   2e-06
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    54   2e-06
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    53   2e-06
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    53   2e-06
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    53   2e-06
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    53   2e-06
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    54   2e-06
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    53   2e-06
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    53   2e-06
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    53   2e-06
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    53   2e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    53   2e-06
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    51   2e-06
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    54   2e-06
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    53   2e-06
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    53   2e-06
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    53   2e-06
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    53   2e-06
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    53   2e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    53   2e-06
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    53   2e-06
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    53   3e-06
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    53   3e-06
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    53   3e-06
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    53   3e-06
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    53   3e-06
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    52   3e-06
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    53   3e-06
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    52   3e-06
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    52   3e-06
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    52   3e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    52   3e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    52   3e-06
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    52   3e-06
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    52   3e-06
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    53   3e-06
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    52   3e-06
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    53   3e-06
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    52   3e-06
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    52   3e-06
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    52   3e-06
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    52   3e-06
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    52   3e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    52   3e-06
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    52   4e-06
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    52   4e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    52   4e-06
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    52   4e-06
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    52   4e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    53   4e-06
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    52   4e-06
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    52   4e-06
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    52   4e-06
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    52   4e-06
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    52   4e-06
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    52   4e-06
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              52   4e-06
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    52   4e-06
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    52   4e-06
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    52   4e-06
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    52   4e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    52   4e-06
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    52   4e-06
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    52   4e-06
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    52   4e-06
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    52   5e-06
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    52   5e-06
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    52   5e-06
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    52   5e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    52   5e-06
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    52   5e-06
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    52   5e-06
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               52   5e-06
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    51   5e-06
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    52   5e-06
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    51   5e-06
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    51   5e-06
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    52   6e-06
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    52   6e-06
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    52   6e-06
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    52   6e-06
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    51   6e-06
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    52   6e-06
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    52   6e-06
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    52   6e-06
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    52   6e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    52   6e-06
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    51   6e-06
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    52   6e-06
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    52   6e-06
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    51   6e-06
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    52   6e-06
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    51   6e-06
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    52   7e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    52   7e-06
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    51   7e-06
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    52   7e-06
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    51   7e-06
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    51   7e-06
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    51   7e-06
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    51   8e-06
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    51   8e-06
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    51   8e-06
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    51   8e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    51   8e-06
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    51   8e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    51   8e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    51   9e-06
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    50   9e-06
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    50   9e-06
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    51   9e-06
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    50   9e-06
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    51   1e-05
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    51   1e-05
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    51   1e-05
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    51   1e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    51   1e-05
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    50   1e-05
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    51   1e-05
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    51   1e-05
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    50   1e-05
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    50   1e-05
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    50   1e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    51   1e-05
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    50   1e-05
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    50   1e-05
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    51   1e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    51   1e-05
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    50   1e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    51   1e-05
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    51   1e-05
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    50   1e-05
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    51   1e-05
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    51   1e-05
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    50   1e-05
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    50   1e-05
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    50   1e-05
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    50   1e-05
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    50   1e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    50   1e-05
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    50   1e-05
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    50   1e-05
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    50   1e-05
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    50   1e-05
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    50   1e-05
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    50   1e-05
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    50   1e-05
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    51   1e-05
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    50   2e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    50   2e-05
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    50   2e-05
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    50   2e-05
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    50   2e-05
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    50   2e-05
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    50   2e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    50   2e-05
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    50   2e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    50   2e-05
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    50   2e-05
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    50   2e-05
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    50   2e-05
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    50   2e-05
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    49   2e-05
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    50   2e-05
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    50   2e-05
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    50   2e-05
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    49   2e-05
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    50   2e-05
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    50   2e-05
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    50   2e-05
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    49   2e-05
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    50   2e-05
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    50   2e-05
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    50   2e-05
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    49   2e-05
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    50   2e-05
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    49   2e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    50   2e-05
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    50   2e-05
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    50   2e-05
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    50   2e-05
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    49   2e-05
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    50   2e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    49   2e-05
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    50   2e-05
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    49   3e-05
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    50   3e-05
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    50   3e-05
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    50   3e-05
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    49   3e-05
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    50   3e-05
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    49   3e-05
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    49   3e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    49   3e-05
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    50   3e-05
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    49   3e-05
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    49   3e-05
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    50   3e-05
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    49   3e-05
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    49   3e-05
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    49   3e-05
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    49   3e-05
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    49   3e-05
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    49   3e-05
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    50   3e-05
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    49   3e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    49   3e-05
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    50   3e-05
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    49   3e-05
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    50   3e-05
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    49   3e-05
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    49   3e-05
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     49   3e-05
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    49   3e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    49   3e-05
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    49   4e-05
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    48   4e-05
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    49   4e-05
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    49   4e-05
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    49   4e-05
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    49   4e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    49   4e-05
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    49   4e-05
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    49   4e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    49   4e-05
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    49   4e-05
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    49   4e-05
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    49   4e-05
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    49   4e-05
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    49   4e-05
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    49   4e-05
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    49   4e-05
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              49   4e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    49   4e-05
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    48   4e-05
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    49   4e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    48   5e-05
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    49   5e-05
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    49   5e-05
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    49   5e-05
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    49   5e-05
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    49   5e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    49   5e-05
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    49   5e-05
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    48   5e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    48   5e-05
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    48   5e-05
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    49   5e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    49   5e-05
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    48   5e-05
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    49   5e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    48   5e-05
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    49   5e-05
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    49   5e-05
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    49   5e-05
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    49   5e-05
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    49   5e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    48   6e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    48   6e-05
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    49   6e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    49   6e-05
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    49   6e-05
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    48   6e-05
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    49   6e-05
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               48   6e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    49   6e-05
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    48   6e-05
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    48   6e-05
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    48   6e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    49   7e-05
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    48   7e-05
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    48   7e-05
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    48   7e-05
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    48   7e-05
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    48   7e-05
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    48   8e-05
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    48   8e-05
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    48   8e-05
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    48   8e-05
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    47   8e-05
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    48   8e-05
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    47   8e-05
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    48   8e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    47   8e-05
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    48   8e-05
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       48   8e-05
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    47   9e-05
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    48   9e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    47   9e-05
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    48   9e-05
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    48   9e-05
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    48   9e-05
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    48   9e-05
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     47   9e-05
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             48   1e-04
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    48   1e-04
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    47   1e-04
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    48   1e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               48   1e-04
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    48   1e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    47   1e-04
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    47   1e-04
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    48   1e-04
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    48   1e-04
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    48   1e-04
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    48   1e-04
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    47   1e-04
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    48   1e-04
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    48   1e-04
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    48   1e-04
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    47   1e-04
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    47   1e-04
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    48   1e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    48   1e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    48   1e-04
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    47   1e-04
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    47   1e-04
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    47   1e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    47   1e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    47   1e-04
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    47   1e-04
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    47   1e-04
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    47   1e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    47   1e-04
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    47   1e-04
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    47   1e-04
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    47   1e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    47   1e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    47   1e-04
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    47   1e-04
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    47   1e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    47   1e-04
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    47   1e-04
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    47   1e-04
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    47   1e-04
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    47   1e-04
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    47   1e-04
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    47   1e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    47   1e-04
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    47   2e-04
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    47   2e-04
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    47   2e-04
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    47   2e-04
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    47   2e-04
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     47   2e-04
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    47   2e-04
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    46   2e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    47   2e-04
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    47   2e-04
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    46   2e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    47   2e-04
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    47   2e-04
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    47   2e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    47   2e-04
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    47   2e-04
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    47   2e-04
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    47   2e-04
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    47   2e-04
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    46   2e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    47   2e-04
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    46   2e-04
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    47   2e-04
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    46   2e-04
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    46   2e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      47   2e-04
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    47   2e-04
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    46   2e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    47   2e-04
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    47   2e-04
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    47   2e-04
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    46   2e-04
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    46   2e-04
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    46   2e-04
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    46   2e-04
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    46   3e-04
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    45   3e-04
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    46   3e-04
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    46   3e-04
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    46   3e-04
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    46   3e-04
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    46   3e-04
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    46   3e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    46   3e-04
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    46   3e-04
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    46   3e-04
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    45   3e-04
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    46   3e-04
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    46   3e-04
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    46   3e-04
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    46   3e-04
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    46   3e-04
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    46   3e-04
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    46   3e-04
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    46   3e-04
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    46   3e-04
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    46   3e-04
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    46   3e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    46   3e-04
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    45   3e-04
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    45   4e-04
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    46   4e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    46   4e-04
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    46   4e-04
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     46   4e-04
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    45   4e-04
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    45   4e-04
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    45   4e-04
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    45   4e-04
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    45   4e-04
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    45   4e-04
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    45   4e-04
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    45   4e-04
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    45   4e-04
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    45   4e-04
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    45   4e-04
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    45   5e-04
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    45   5e-04
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    45   5e-04
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    45   5e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    45   5e-04
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    45   5e-04
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      45   5e-04
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    45   6e-04
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    45   6e-04
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    45   6e-04
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    45   6e-04
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    45   6e-04
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    45   6e-04
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    45   6e-04
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    45   6e-04
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    45   6e-04
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    45   6e-04
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    45   6e-04
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    45   6e-04
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    45   7e-04
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    45   7e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    45   7e-04
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    45   7e-04
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    45   7e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    45   7e-04
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    45   7e-04
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    45   7e-04
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    45   7e-04
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    44   7e-04
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    45   7e-04
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    45   8e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    44   8e-04
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    45   8e-04
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    44   8e-04
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     45   9e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    45   9e-04
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    44   0.001
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    44   0.001
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    44   0.001
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    45   0.001
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    44   0.001
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    44   0.001
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    44   0.001
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    44   0.001
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    44   0.001
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    44   0.001
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    44   0.001
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    42   0.001
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     44   0.001
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    44   0.001
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    44   0.001
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    44   0.001
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    44   0.001
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    44   0.001
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    44   0.001
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    44   0.001
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    44   0.001
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    44   0.001
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    44   0.001
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    43   0.001
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    44   0.001
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    44   0.001
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    44   0.001
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    44   0.001
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    44   0.002
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    44   0.002
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    44   0.002
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               44   0.002
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    44   0.002
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    44   0.002
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    44   0.002
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    44   0.002
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    44   0.002
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    44   0.002
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    43   0.002
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               44   0.002
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    44   0.002
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    43   0.002
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    44   0.002
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    43   0.002
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    44   0.002
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    43   0.002
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    44   0.002
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    44   0.002
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    44   0.002
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    44   0.002
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    44   0.002
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    44   0.002
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    44   0.002
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    43   0.002
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    43   0.002
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    44   0.002
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               43   0.002
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    43   0.002
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    43   0.002
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     43   0.002
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    43   0.002
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    43   0.002
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    43   0.002
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    44   0.002
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    43   0.003
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 43   0.003
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    43   0.003
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    42   0.003
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    43   0.003
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    42   0.003
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    43   0.003
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    43   0.003
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    43   0.003
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    43   0.003
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    42   0.003
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    43   0.003
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    43   0.003
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    43   0.003
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    43   0.003
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    43   0.003
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    43   0.003
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    43   0.003
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    43   0.003
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    43   0.003
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    43   0.003
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    43   0.003
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    42   0.003
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    43   0.004
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    42   0.004
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    42   0.004
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    42   0.004
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    42   0.004
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    42   0.004
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    42   0.004
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    42   0.004
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    42   0.004
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    42   0.004
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    42   0.004
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    42   0.004
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    42   0.004
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    42   0.005
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    42   0.005
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    42   0.005
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    42   0.005
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    42   0.005
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    42   0.005
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    42   0.005
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       42   0.006
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    42   0.006
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    42   0.006
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    42   0.006
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    42   0.006
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    42   0.006
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    42   0.006
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    42   0.006
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    42   0.006
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    42   0.006
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    42   0.006
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    42   0.006
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    42   0.006
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    42   0.007
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    42   0.007
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    42   0.007
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    41   0.007
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    42   0.007
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    42   0.007
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    42   0.007
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    42   0.007
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    41   0.007
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    42   0.008
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      42   0.008
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    42   0.008
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    41   0.008
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    42   0.009
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    41   0.009
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    41   0.009
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    41   0.010
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    41   0.010
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    41   0.010
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    41   0.010
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    41   0.011
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    40   0.011
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    41   0.011
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    40   0.012
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    41   0.012
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    40   0.012
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    41   0.012
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    40   0.013
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    41   0.013
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    41   0.013
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    41   0.013
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    40   0.013
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    40   0.014
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    40   0.014
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    41   0.014
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    41   0.015
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    40   0.015
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    40   0.015
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    41   0.016
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    40   0.016
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    40   0.016
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    40   0.016
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    40   0.016
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    40   0.017
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    40   0.018
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    40   0.018
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    40   0.018
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    40   0.018
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    40   0.018
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    40   0.019
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    40   0.019
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    40   0.020
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    40   0.021
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    40   0.023
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    39   0.025
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    40   0.028
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    40   0.028
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    40   0.028
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     39   0.028
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    39   0.030
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    40   0.032
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    40   0.034
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    39   0.039
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    39   0.040
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    39   0.043
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    39   0.044
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    39   0.046
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    39   0.046
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    39   0.047
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    39   0.048
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    39   0.048
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    39   0.048
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    39   0.053
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    39   0.053
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    39   0.053
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    39   0.057
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    39   0.057
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    38   0.059
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    38   0.062
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    39   0.065
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    39   0.066
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    38   0.071
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    38   0.072
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    38   0.073
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    39   0.073
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    38   0.077
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    38   0.086
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      38   0.091
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    38   0.093
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    38   0.093
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    38   0.094
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    38   0.094
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    38   0.096
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    38   0.10 
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    38   0.11 
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    38   0.11 
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    38   0.12 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    38   0.13 
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    37   0.14 
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    37   0.14 
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    37   0.15 
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    37   0.15 
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    37   0.16 
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    37   0.16 
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    37   0.16 
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    37   0.18 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    37   0.19 
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    37   0.19 
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    37   0.19 
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    37   0.23 
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    37   0.24 
NCAS0I00830 Chr9 complement(153427..153933) [507 bp, 168 aa] {ON...    35   0.25 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    37   0.26 
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    37   0.27 
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    36   0.28 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    37   0.29 
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    37   0.30 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    36   0.30 
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    36   0.32 
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    36   0.34 
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    36   0.35 
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    36   0.41 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    35   0.47 
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    36   0.48 
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    36   0.51 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    35   0.53 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    35   0.54 
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    35   0.55 
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    35   0.56 
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    35   0.62 
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    35   0.62 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    35   0.67 
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    35   0.81 
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    35   0.96 
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    35   1.1  
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    34   1.1  
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    35   1.1  
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    34   1.3  
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    34   1.4  
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    34   1.4  
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    34   1.6  
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    34   1.8  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    33   2.8  
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    33   2.8  
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    33   2.9  
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    33   3.1  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    33   3.3  
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    33   3.5  
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    33   3.5  
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    33   3.5  
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    33   4.4  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    33   4.6  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    32   4.8  
Suva_7.573 Chr7 complement(1000603..1001496) [894 bp, 297 aa] {O...    32   7.6  
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    32   8.0  
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    31   9.7  

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score = 1368 bits (3540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/756 (89%), Positives = 674/756 (89%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 GVPCPIQNFYLXXXXXXXXXXXXXXXTTVPKIATAQPIQQLNARTQTMPIINTKANTSLV 360
           GVPCPIQNFYL               TTVPKIATAQPIQQLNARTQTMPIINTKANTSLV
Sbjct: 301 GVPCPIQNFYLIRAQQLANQIQLQRQTTVPKIATAQPIQQLNARTQTMPIINTKANTSLV 360

Query: 361 TPITVPVLSENTRLPALELDIKVPQFSPSLDKDMYMKLHPFQKSGTLLTPSKTASVXXXX 420
           TPITVPVLSENTRLPALELDIKVPQFSPSLDKDMYMKLHPFQKSGTLLTPSKTASV    
Sbjct: 361 TPITVPVLSENTRLPALELDIKVPQFSPSLDKDMYMKLHPFQKSGTLLTPSKTASVSPIR 420

Query: 421 XXXXXXXXXDNTNYDIQRRRTSQYDHDQNQSNYMGXXXXXXXXXXXXXXXXFEGNLQGNN 480
                    DNTNYDIQRRRTSQYDHDQNQSNYMG                FEGNLQGNN
Sbjct: 421 RYISRSPSRDNTNYDIQRRRTSQYDHDQNQSNYMGRSLSRTSSIKSTSALSFEGNLQGNN 480

Query: 481 TGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFTGSMRAPSLDXX 540
           TGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFTGSMRAPSLD  
Sbjct: 481 TGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFTGSMRAPSLDNN 540

Query: 541 XXXXXXXXXXXXXXXXXXYGRHNIITNPIKEEDSRNMTKAKLAKRHTMPPGMLYDLENLE 600
                             YGRHNIITNPIKEEDSRNMTKAKLAKRHTMPPGMLYDLENLE
Sbjct: 541 TNNSMHNNSNNNTSRNSSYGRHNIITNPIKEEDSRNMTKAKLAKRHTMPPGMLYDLENLE 600

Query: 601 IENEGYHASEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESEQPMERNNIDTHHTNAVSH 660
           IENEGYHASEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESEQPMERNNIDTHHTNAVSH
Sbjct: 601 IENEGYHASEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESEQPMERNNIDTHHTNAVSH 660

Query: 661 SMIPRNLNSREKDSLRYSSVVINPLEDIGSSPKKAXXXXXXXXXXXXXXXXXXTYLSKMF 720
           SMIPRNLNSREKDSLRYSSVVINPLEDIGSSPKKA                  TYLSKMF
Sbjct: 661 SMIPRNLNSREKDSLRYSSVVINPLEDIGSSPKKAPPLPFKPHHLRPKPPPKPTYLSKMF 720

Query: 721 SKERISSTATEQLVTLDVDTLERDFRKRFPSTLENR 756
           SKERISSTATEQLVTLDVDTLERDFRKRFPSTLENR
Sbjct: 721 SKERISSTATEQLVTLDVDTLERDFRKRFPSTLENR 756

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/764 (49%), Positives = 474/764 (62%), Gaps = 52/764 (6%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQPNIP YP GTLLTVG+H   I KYLTSGGFAQIY  EI+P++ Y+ S  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K+GLNTLRAEVDAMKLLKNNRHVVSYIDS+A +S    G+YEV LLMEYC+GGGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL+E EILNILSQT QGV+ MHALQP L+HRDIKIENVL S  GEFK+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VC YIRPPRN QEL+YVQHD+LKNTTAQYR PEMLDLYRGLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE AILHS++QYPAFPIY+D+LKNLIR  L E+P+KRPNIC+LLEEIS IQ
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 GVPCPIQNFYLXXXXXXXXXXXXXXXTTVPKIAT--AQPIQQLNARTQTMPIINTKANTS 358
           G+PCPI NFYL               T   + A   +Q    ++ ++  +P+ +++++T 
Sbjct: 301 GIPCPINNFYLSRTINVQASLMNPIITPTQQTALKHSQSSATISDQSYAVPLASSRSST- 359

Query: 359 LVTPITVPVLSENTRLPALELDIKVPQFSPSLDKDMYMKLHPFQKSGTLLTPSKTASVXX 418
             T    P+L          ++ ++P  S   D D+Y ++HPFQKS TL TPS+++S   
Sbjct: 360 --TTGNKPIL----------IETEIPDMSQGSD-DVYSRIHPFQKSQTLRTPSRSSS--- 403

Query: 419 XXXXXXXXXXXDNTNYDIQRRRTSQYDHDQNQSNYMGXXXXXXXXXXXXXXXXFEGNLQG 478
                        ++        S Y   + Q+                        L+ 
Sbjct: 404 PIKYTGTLLQKSTSSNSNTSGNKSHYVDSETQTFSTSSRRLSRSSSVRSASSRSSDQLKE 463

Query: 479 NNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFTGSM--RAPS 536
           + TG S  Q FT+ +KRVVTGESRN SPIRSRQ+TGGS+RSAF A+R   TG+   R  S
Sbjct: 464 HRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGGSIRSAFDALRSGITGNTNSRVSS 523

Query: 537 LDXXXXXXXXXXXXXXXXXXXXYGRHNIITNPIKEEDSRNMTKAKLAKRHTMPPGMLYDL 596
           L                                 +E ++   + K A R ++PP +  D 
Sbjct: 524 LASSVRNVSSSSKHSKHSDA-------------DDEPNKIKIRMKKAHRRSVPPNLYSDF 570

Query: 597 ENLEIENEGYHASEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESEQPMERNNIDT---- 652
                 NE     + Y S+SP K     T R++IQ RV+ LL   E+  E + I T    
Sbjct: 571 ----YANE--DTPKLYSSNSPVKLKSLSTQRESIQNRVKALLETFEE--EPSTIKTASGY 622

Query: 653 -HHTNA--VSHSMIPRNLNSREKDSLRYSSVVINPLEDIGSSPKKAXXXXXXXXXXXXXX 709
             +T++  ++  +  R        + RYSSV+INP+ +  S                   
Sbjct: 623 GKYTDSEFITSPVPERGGRIPTPTNKRYSSVIINPVTEPISI---RPSPPPKPKHLRPIP 679

Query: 710 XXXXTYLSKMFSKERISSTATEQLVTLDVDTLERDFRKRFPSTL 753
               T LSK++  ERISSTATE++V LDV++LE+DF++RFPS +
Sbjct: 680 PPKPTRLSKIYPDERISSTATERIVNLDVESLEKDFKRRFPSRI 723

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/825 (44%), Positives = 463/825 (56%), Gaps = 92/825 (11%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MN P I LY  GT+LTVG+H A I KYLTSGGFAQ+Y+ EI+P D YS +N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K GLNTLRAEVDAMKLLKNN+HVVSYIDS+A KS  N  +YEV +LMEYCE GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEYCERGGLIDF 119

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RL+NRL E+EIL+I+ QT QG+A MHALQP L+HRDIKIENVL S  G +K+CDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPP+N QE +YVQHDIL NTTAQYR PEM+DLYRGLPIDEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEKTGE AILH+++QYP+FP YSDRLKNLIR+ML E P++RPNIC++LEE+S +Q
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GVPCPIQNFYLXXXXXXXXX----XXXXXXTTVPKIATAQPIQQLNARTQTMPIINTKAN 356
             PCPI+NFYL                   T   ++ + Q  Q + A    +P+ N K  
Sbjct: 300 NRPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQLVSPQSFQNIQAMPNIVPLSNIKTT 359

Query: 357 TSLVTPITVPVLSENTRLPALELDIKV------PQFSPSLDKD------------MYMKL 398
            +L +      ++ N ++ A+ L ++       P FS  L K              Y +L
Sbjct: 360 PNLDSASN--FVNNNNKMEAM-LQLRTQKLETGPNFSIPLTKTKSVPLSDDFTSLYYKEL 416

Query: 399 HPFQKSGTLLTPSKTASVXXXXXXXXXXXXXDNTNYD---IQRRRTSQYDHDQNQSNYMG 455
           HPFQK  T  +   + S               N NYD      R  +  D +    + + 
Sbjct: 417 HPFQKPHTFKSVEGSQSPQRKSIPFSPTPVNSN-NYDRVSTINRPNNYVDSETQTLDSIA 475

Query: 456 XXXXXXXXXXXXXXXXF--EGNLQGNNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDT 513
                           F  E  +  N TG    +  ++K+KRV+TGESRN SPI+SRQ+T
Sbjct: 476 TLKLKPSPTISNKTTGFSKESTVPENVTGGKIVRSLSSKLKRVITGESRNGSPIKSRQNT 535

Query: 514 GGSVRSAFGAIRGAFTGS----MRAPSLDXXXXXXXXXXXXXXXXXXXXYGRHNIITNPI 569
           G S+RSAFG +R  FTGS     R+ S D                       ++      
Sbjct: 536 GDSIRSAFGMLRHGFTGSSINNSRSTSFDNNNANSVNRRLTSSSSNPSSSNLNSDTKR-- 593

Query: 570 KEEDSRNMTKAKLAKRHTMPPGMLYDLENLEIENEGYHASEYYRSHSPTKPF-------- 621
           KEE  +   K KL  R +MPP +L D +  E  N    + +YYRSHSP K          
Sbjct: 594 KEELDK---KRKLEHRRSMPPSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQTTPTTTT 650

Query: 622 ------------VTKTTRDNIQQRVQNLLSESEQPMERNNIDTHHTNAVSHSMIPRNLNS 669
                       + +  +++IQ+RV NLL+ SE  +             S S   +  ++
Sbjct: 651 RPSLKSSNSDINIDQEKKESIQRRVHNLLNNSEDSLSYK----------SASGYGKYTDT 700

Query: 670 REKDSLRYSSVVINPLED-------------IGSSPKKAXXXXXXXXXXXXXXXXXXTYL 716
             + + R SSV I P+ +               +S K                     + 
Sbjct: 701 EAESTNRQSSVRITPITEERFNNYHSSNTMNDHTSSKDKPKSRPPRPPPKPLHLRTKIHN 760

Query: 717 SKMFSK--------ERISSTATEQLVTLDVDTLERDFRKRFPSTL 753
           ++  S         ERISS ATE +V ++VD LE DFRKRFPS +
Sbjct: 761 TRCSSNLQSRKPPMERISSEATETIVDVNVDELEADFRKRFPSKV 805

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/817 (43%), Positives = 456/817 (55%), Gaps = 71/817 (8%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MN P I LY  GT+LTVG+H A I KYLTSGGFAQ+Y  EI+P D YS +N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K GLNTLRAEVDAMKLL+NN+HVVSYIDS+A +S  N  +YEV +LME+CE GGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSV-NGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E+EIL I+SQT QG+  MHALQP L+HRDIKIENVL S +G +K+CDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPPRN QE +YVQHDIL NTTAQYR PEM+DLYRGLPIDEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK+GE  ILH+++QYP+FP YSDRLKNLIR+ML E P++RPNIC++LEE+S +Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GVPCPIQNFYLXXXXXXXXXXXXX----XXTTVP--KIATAQPIQQLNARTQTMPIINTK 354
             PCPI+NFYL                   T VP  K    Q +Q +N     MP+ +  
Sbjct: 300 NKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPTQKFIPVQSLQSINQPPNMMPVTHVS 359

Query: 355 ANTSLVT-PITVP-------------VLSENTRLPALELDIKVPQFSPSLDKDMYMKLHP 400
              +L T PI++               +  ++ L +  +  K    S       Y +LHP
Sbjct: 360 TTPNLGTFPISINDNNKTEVTAHAGLQVGSHSNLTSPLMKTKSVPLSDEFASLYYKELHP 419

Query: 401 FQKSGTLLTPSKTASVXXXXXXXXXXXXXDNTNYD---IQRRRTSQYDHDQNQSNYMGXX 457
           FQKS T  +     S              +N  +D      R  +  D +    + M   
Sbjct: 420 FQKSQTFKSVESFQSPQRKSMPPLSLTPVNNDIFDRVSAINRPNNYVDSETQTIDNMAVP 479

Query: 458 XXXXXXXXXXXXXXFEGNLQG--NNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGG 515
                             +    N  G    +  ++K+K+V+TGESR  SPI+SRQ+TG 
Sbjct: 480 NLKLSPTITSKSLSSTKEIAAPDNINGSKIVRSLSSKLKKVITGESRGNSPIKSRQNTGD 539

Query: 516 SVRSAFGAIRGAFTG----SMRAPSLDXXXXXXXXXXXXX--XXXXXXXYGRHNIITNPI 569
           S+RSAFG +R  FTG    + R+ S D                      + + N  T   
Sbjct: 540 SIRSAFGKLRHGFTGNSVNNSRSASFDNNNVNGNGNNTNRRLVSSSTSSFPKFNSDTKR- 598

Query: 570 KEEDSRNMTKAKLAKRHTMPPGMLYDLENLEIENEGYHASEYYRSHSPTKPF-------- 621
           KEE  +N    +L KR +MPP +L D +  E  N    + +YYRSHSP K          
Sbjct: 599 KEESDKNQ---RLEKRRSMPPSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQASAKTTS 655

Query: 622 ------------VTKTTRDNIQQRVQNLLSESEQPM---------ERNNIDTHHTNAVSH 660
                       + +  +++IQ+RV NLL  S+ P+         +  +I T  +N   H
Sbjct: 656 KPTLIPDNGNVNINQEKKESIQRRVHNLLKSSDDPVTYKSASGYGKYTDIGTETSN--RH 713

Query: 661 SMIPRNLNSREKDSLRYSSVVINPLEDIGSSPKKAXXXXXXXXXXXXXXXXXXTYLSKMF 720
           S +     + EK        V++         K                       S++ 
Sbjct: 714 SSVRITPITEEKFKKTLKDGVLDIKTKSNGKDKSRPPRPPPKPLHLRTEIQKIRNFSRLQ 773

Query: 721 SK----ERISSTATEQLVTLDVDTLERDFRKRFPSTL 753
           SK    ERISS ATE +V ++VD LE DFRKRFPS +
Sbjct: 774 SKKLPIERISSEATETIVDVNVDDLEADFRKRFPSKV 810

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/815 (44%), Positives = 454/815 (55%), Gaps = 69/815 (8%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MN P I LY  GT+LTVG+H A I KYLTSGGFAQ+Y  EI+P D Y+ +N+ACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K GLNTLRAEVDAMKLLKNN+HVVSYIDS+A KS  N  +YEV +LME+CE GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEFCERGGLIDF 119

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E+EIL I+SQT QG+A MHALQP L+HRDIKIENVL S NG +K+CDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPPRN QE +YVQHDIL NTTAQYR PEM+DLYRGLPIDEKSDIWALG+FLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK+GE  ILH+++QYP FP YSDRLKNLIR+ML E P+KRPNIC++LEE+S +Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 301 GVPCPIQNFYLXXXXXXXXXXXXXXXTT--VP--KIATAQPIQQLNARTQTMPIINTKAN 356
             PCPI+NFYL               +   VP  K   AQ +Q +   +  +P+ + +  
Sbjct: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRTT 359

Query: 357 TSLVT---------------PITVPVLSENTRLPALELDIKVPQFSPSLDKDMYMKLHPF 401
            +L T                I++  + ++     L+    VP  S       Y +LHPF
Sbjct: 360 PNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVP-LSDDFASLYYRELHPF 418

Query: 402 QKSGTLLTPSKTASVXXXXXXXXXXXXXDNTNYDI--QRRRTSQYDHDQNQSN---YMGX 456
           QKS T  +     S              ++   D      R + Y   + Q+     M  
Sbjct: 419 QKSQTFKSVENFQSPQRRSMPPSSLPPANSIILDKTPTMNRPNNYVDSETQTTDIITMSG 478

Query: 457 XXXXXXXXXXXXXXXFEGNLQGNNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGS 516
                           E     N +G +  +  ++K+K+V+TGESR +SPI+SRQ+TG S
Sbjct: 479 SKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDS 538

Query: 517 VRSAFGAIRGAFTGSM----RAPSLDXXXXXXXXXXXXXXXXXXXXYGRHNIITNPIKEE 572
            RSA G +R  FTGS     R+ S D                          + NP  + 
Sbjct: 539 TRSALGMLRHGFTGSSMNNNRSASFDSNNGSSNNNSVNRRLGSSST--SSLSVFNPDTKR 596

Query: 573 DSRNMTKAKLAKRHTMPPGMLYDLENLEIENEGYHASEYYRSHSP--------------- 617
                 K KL  R +MP  +L D +  E  N    + +YYRSHSP               
Sbjct: 597 QEEIDKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPI 656

Query: 618 TKPF-----VTKTTRDNIQQRVQNLLSESEQPM---------ERNNIDTHHTNAVSHSMI 663
           TKP      + +  +++IQ+RV NLL  SE P+         +  + DT  +N  S   I
Sbjct: 657 TKPVIGDININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSVRI 716

Query: 664 ----PRNLNSREKDSLRYSSVVINPLEDIGSSPKKAXXXXXXXXXXXXXXXXXXTYL-SK 718
                    SR K+ L  +    N   D   S                      + L S 
Sbjct: 717 TPITEEKFKSRNKNGLSNNKTKDN---DRHKSRPPRPPPKPLHLRAEIQKVRSSSRLHSG 773

Query: 719 MFSKERISSTATEQLVTLDVDTLERDFRKRFPSTL 753
             S ERISS ATE +V ++VD LE DFRKRFPS +
Sbjct: 774 ELSSERISSDATETIVEVNVDDLEADFRKRFPSKV 808

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/827 (43%), Positives = 462/827 (55%), Gaps = 92/827 (11%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MN P I LY  GT+LTVG+H A I KYLTSGGFAQ+Y  EI+P D YS +N ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K GLNTLRAEVDAMKLLKNN+HVVSYIDS+A KS  N  +YEV +LME+CE GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQ+RL E+EIL I+SQT QG+A MH LQP L+HRDIKIENVL S +G +K+CDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPPRN QE +YVQHDIL NTTAQYR PEM+DLYR  PIDEKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK+GE AILHS++QYP+FP YSDRLK LI +ML E P++RPNIC++LEE+S +Q
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 301 GVPCPIQNFYLXXXXXXXXXXXXX----XXTTVPKIATAQPIQQLNARTQTMPIINTKAN 356
             PCPI+NFYL                    +  ++  AQ +Q +      +P+ + +  
Sbjct: 300 NEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTT 359

Query: 357 TSLVTPITVPVLSENT--------RLPALELDIKVPQF---SPSLDKDM----YMKLHPF 401
            +L T +T  + + N           P  +L++  P     S  L  D     Y +LHPF
Sbjct: 360 PNLGT-LTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPLSDDFASLYYRELHPF 418

Query: 402 QKSGTLLTPSKTASVXXXXXXXXXXXXXDNTNYDIQRRRTSQYDHDQNQSNYMGXXXXXX 461
           QKS T  +     S              ++ N D  R  TS  D   N  + +       
Sbjct: 419 QKSQTFKSVESFQSPQRKLSTPSSSSPVNSKNND--RASTSTVDRPNNYVDSVTQTIDNM 476

Query: 462 XXXXXXXXXXF---------EGNLQGNNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQD 512
                               E  +  N TG S  +  ++K+K+V+TGESR++SPI+SRQ+
Sbjct: 477 AALNLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQN 536

Query: 513 TGGSVRSAFGAIRGAFTGSM----RAPSLDXXXXXXXXXXXXXXXXXXXXYGRH-NIITN 567
           TG S+RSAFG +R   TGS     R  S D                       + N  T 
Sbjct: 537 TGDSIRSAFGMLRHGLTGSSVSNNRTISFDSNNGNGNGNSVNRRLASSSSSSSNFNFDT- 595

Query: 568 PIKEEDSRNMTKAKLAKRHTMPPGMLYDLENLEIENEGYHASEYYRSHSPTKPF------ 621
             K +D  +  K KL  R +MPP +L D +  E  N    + +YYRSHSP K        
Sbjct: 596 --KRQDDLD-KKQKLENRRSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKT 652

Query: 622 --------------VTKTTRDNIQQRVQNLLSESEQPMERNNIDTHHTNAVSHSMIPRNL 667
                         V +  +++IQ+RV NLL+ SE P+        H +A  +    +  
Sbjct: 653 ASRTTLKSDSSDIDVKQVNKESIQRRVHNLLNNSEDPLA-------HKSASGYG---KYT 702

Query: 668 NSREKDSLRYSSVVINPLEDI-------GSSPKKAXXXXXXXXXXXXXXXXXXTYL---- 716
           +   + S R+SSV I P+ +          + K                     +L    
Sbjct: 703 DVNAEASNRHSSVRITPITEGKFNKYYNSGTLKGETSRNDKHKSRPPRPPPKPLHLRTEI 762

Query: 717 --SKMFSK--------ERISSTATEQLVTLDVDTLERDFRKRFPSTL 753
             ++ FS+        ERISS ATE +V ++VD LE DFRKRFPS +
Sbjct: 763 QNTRNFSRLQSRQPQMERISSEATETIVDVNVDDLEADFRKRFPSKV 809

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  518 bits (1335), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 234/311 (75%), Positives = 267/311 (85%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP IP Y  GT+LTVG+H A +  YLTSGGFAQ+Y+ EI P D +  SNVACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LNTLRAEVDAMKLL+NN+HVVSYIDS+A KS+F NGSYEV LLMEYC GGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E EILNI+SQ  QG+A MHALQP L+HRDIKIENVL S  G++K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPP+N QE +YVQHD+LKNTTAQYR PEM+DLYRG PIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE AILHS+FQ+PA PIYSDRLK LIR ML ENP +RPN+C++LE++S +Q
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 GVPCPIQNFYL 311
           G+ CP++NFYL
Sbjct: 301 GIQCPVRNFYL 311

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  516 bits (1328), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 242/366 (66%), Positives = 289/366 (78%), Gaps = 4/366 (1%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MN P I  +P+G +LTVG+H A + KYLTSGG+AQ+Y VEI+P D Y  SN+ACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LNTLRAEVDAMKLLKNNRHVVSYIDS+A KSA  NG+YEV +LME+CE GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MNSRLQ+RL+EAEIL I+S T+QG+A MH LQP LLHRDIKIENVL S N E+K+CDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG +RPP+NQQE ++V HDI+KNTTAQYR PEMLDL +GLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKT-GENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSI 299
           YYTTPFEK  GE AIL ++FQYP++P+YSDRLKNLIRVMLS+NP+ RPN+C++LEE+S +
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QGVPCPIQNFYLXXXXXXXXXXXXXXXTTVPKIAT-AQPIQQLNART--QTMPIINTKAN 356
           QG+PCPI+NFYL                 V    T +QP  Q+N  +   T+P    K N
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKFN 360

Query: 357 TSLVTP 362
            + + P
Sbjct: 361 QTTIPP 366

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 94/334 (28%), Positives = 145/334 (43%), Gaps = 40/334 (11%)

Query: 431 NTNYDIQRRRTSQYDHDQN----QSNYMGXXXXXXXXXXXXXXXXFEGNLQGNNTGDSFA 486
           N NYD+ +R T+  D +      QS ++                 + G +Q N TG S  
Sbjct: 475 NDNYDVSKRPTNYVDEETQTYTGQSTFL--RRTSSNRSNRSISSQYSG-VQENTTGSSLV 531

Query: 487 QKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFTGS---MRAPSLDXXXXX 543
           +K + K+K V+TGES     I+SRQ+TG S+RSA  +IR  FTG+    R+ S D     
Sbjct: 532 RKLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSASYDNGKRL 586

Query: 544 XXXXXXXXXXXXXXXYGRHNIITNPIKEEDSRNMTKAKLAKRHTMPPGMLYDLENLEIEN 603
                             H+ I   ++++DS      ++ + +++    L D+E  E   
Sbjct: 587 SSVNLHM-----------HSAI---LEQDDSDEF---EMPRYNSVSSNTLKDVEEHERRT 629

Query: 604 EGYHASEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESEQPMERNNIDTHHTNAVSHSMI 663
               + EYYRS SP +  V +  +++IQ+RVQ+LL  +E+    N   T  T +      
Sbjct: 630 VNTSSREYYRSQSPVRMSVNREMKNSIQKRVQDLLKNAEE----NTTATVRTASGYGKYT 685

Query: 664 PRNLNSREKDSLRYSSVVIN----PLEDIGSSPKKAXXXXXXXXXXXXXXXXXXTYLSKM 719
             N N  E    +      N     L  +    KK                      S+ 
Sbjct: 686 DYNKNKDEISPTKSRVAQFNQSTAALASLSGKRKKPPVPYKRDSLKPTPPAKPAFLSSRP 745

Query: 720 FSKERISSTATEQLVTLDVDTLERDFRKRFPSTL 753
            +  R+SS AT+ LV L VD +E+D R+RFPST+
Sbjct: 746 VASSRVSSNATDMLVDLSVDDIEKDIRRRFPSTV 779

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  509 bits (1310), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 233/311 (74%), Positives = 269/311 (86%), Gaps = 1/311 (0%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           M+QP +  YP+GT+LTVG+H+A I KYLTSGGFA IY+ EI+P D  S S++ACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LN+LRAEVDAMKLLK ++ VVSYIDS+A KS+ NNGSYEV LLMEYC  GGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E E+L I+SQ +QGVA MHALQP L+HRDIKIENVL S +G FK+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPP+N QEL+YVQHDILKNTTAQYR PEM+DLYRGLP+DEKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE AILHSKFQ+PA+P YSD+LKNLI  +L ENP +RPNIC+LL E+S IQ
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 GVPCPIQNFYL 311
           GVPCP++NFYL
Sbjct: 300 GVPCPVKNFYL 310

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 126/298 (42%), Gaps = 32/298 (10%)

Query: 480 NTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFTGSMRAPSLDX 539
           +TG SF ++  +K+KR+++ E RN SPIRSRQ+TGGS RSAF  +R       R  S + 
Sbjct: 502 STGGSFTRRIGDKLKRIISNEPRNTSPIRSRQNTGGSTRSAFSTLR-------RGTSSNF 554

Query: 540 XXXXXXXXXXXXXXXXXXXYGRHNIITNP--IKEEDSRNMTKAKLAKRHTMPPGMLYDLE 597
                               G    +++   I+E+ + N  + K   R      +  DL 
Sbjct: 555 SSDRSKRNSVDFSVRRLGSGGNKVRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLN 614

Query: 598 NLEIENEGYHASEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESE-QPMERNNIDTH--- 653
             E    G  +  Y ++HSP K    + +R++IQ+RV +LL  S+  P+ +   D     
Sbjct: 615 KYE-GKAGSVSRGYNQAHSPIKMSANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFS 673

Query: 654 ---HTNAVSHSMIPRNLNSREK-----------DSLRYSSVVINPLEDIGSSPKKAXXXX 699
                +A  H++  + ++               D+   S+ V++P     +  ++     
Sbjct: 674 SFPQDHAADHTISDKVIDVHNVTSSPVVQKATLDTTHQSNTVVSPTRKHFTRTREKPVPP 733

Query: 700 XXXXXXXXXXXXXXTYLS----KMFSKERISSTATEQLVTLDVDTLERDFRKRFPSTL 753
                          +L      +  K R S+ A      +D+D LE DF+KR+PS +
Sbjct: 734 PKPVRLRPKPPPKPFHLKVKNLVIPKKGRYSNRANTLSDEVDIDDLEEDFKKRYPSAI 791

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  491 bits (1265), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/312 (73%), Positives = 265/312 (84%), Gaps = 1/312 (0%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP I  Y  GT+L VG+H+  I KY+TSGGFAQIY VEI+P D++  SN+ACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LNTLRAEVDAMKLL+NN+HVVSYIDS+A KS FNNGSYEV LLMEYCE GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL+E+E+L+I SQ AQG+A MHALQP LLHRDIKIENVL S + ++K+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPP N QEL YVQHD+LKNTTAQYR PEM+D YRGLPIDEKSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEKT-GENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSI 299
           YYTTPFEK  GE AIL ++++YP FPIYS+RLK+LI  ML ENP +RPNI +++EEIS +
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QGVPCPIQNFYL 311
           Q VPCPI NFYL
Sbjct: 301 QNVPCPIVNFYL 312

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  503 bits (1295), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 234/311 (75%), Positives = 265/311 (85%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP +     GT LTVGTH   I KYLTSGGFAQIYAVEI  +  ++ SNVACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LN LRAEVDAMKLL NN+HVVSYIDS+A +S  N+G+YEV LLMEYCEGGGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL+E EIL+I+SQT QG+A MHAL P LLHRDIKIENVL S  G +K+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPPRNQQEL YVQHDI+KNTTAQYRCPEMLDLYRGLPIDEK+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE AILH++FQ+P+FP YSDRLKNLI+ ML E+P+ RPN+C++LEE+S +Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 GVPCPIQNFYL 311
            VPCPI+NFYL
Sbjct: 301 NVPCPIRNFYL 311

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 25/31 (80%)

Query: 723 ERISSTATEQLVTLDVDTLERDFRKRFPSTL 753
           +RI+S AT+ L+ L+VD LE DF++RFPS +
Sbjct: 658 DRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  501 bits (1291), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/311 (73%), Positives = 259/311 (83%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP IPLY  GTLLTVG+H+  + KYLTSGGFAQIY V+I+P D ++ +NVACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LNTLRAEVD MKLL+NN HVVSYIDS+A K   N GSYEV LLMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQ RL E EILNI+SQ  QG+A MHAL P LLHRDIKIENVL +  GE+K+CDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPP N QE+SYVQHDI+KNTTAQYR PEM+DLYRGLPIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE AILH+ FQ+P +P YSDRLK LI  ML E P++RPN  ++LEE+SS+Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 GVPCPIQNFYL 311
            V CPI NFYL
Sbjct: 301 NVQCPIPNFYL 311

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  501 bits (1290), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 232/315 (73%), Positives = 265/315 (84%), Gaps = 4/315 (1%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP IPLY  G +L VG+H+A I KYLTSGGFAQ+Y VEI+P D +S SN+ACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKS----AFNNGSYEVLLLMEYCEGGG 116
           P K+ LN  RAEV+AMKLL+NN++VVSYIDS+A KS       NGSYEV LLMEYC G G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLC 176
           LIDFMN+RLQNRL E EILNI+S  +QGVA MHALQP LLHRDIKIENVL S   EFKLC
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFL 236
           DFGSVCG IRPP NQ EL +VQHDILKNTTAQYR PEML L + +PI+EKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           YK+CYYTTPFEK GENAILHS++QYPA+P YSD LKNLIRVML  +P+KRPNIC+++EE+
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SSIQGVPCPIQNFYL 311
           S +QGVPCP++NFYL
Sbjct: 301 SRLQGVPCPLKNFYL 315

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  501 bits (1291), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 232/351 (66%), Positives = 270/351 (76%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP+  +Y  GT LTVG+H+A I KYLTSGGFA IY+ EI+P D  S  NVACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LN LRAEVDAMKLL+ N+HVVSYIDS+A KS   +GSYEV LLMEYC  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL+E E+L I+S   QG+A MHAL P L+HRDIKIENVL S +  FK+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPP+N QE SYVQ+DILKNTTAQYR PEM+DLYRG PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK G+ AILHS+FQ+PA+P YSDRLKNLI VMLSENP +RPNIC++LEE+S IQ
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 GVPCPIQNFYLXXXXXXXXXXXXXXXTTVPKIATAQPIQQLNARTQTMPII 351
            VPCP++NFYL                T P +     + Q     +  P++
Sbjct: 301 NVPCPLRNFYLLRSMQQQQQQHQQQQQTFPSVEVHHSLSQPRMDLKNGPVL 351

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 89/164 (54%), Gaps = 9/164 (5%)

Query: 480 NTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAF-TGSMRAPSLD 538
           +TG SF++ F  ++K+V TGE R+ SPI+SRQ+TG SV+SAF  +R  F +GS +   L 
Sbjct: 509 STGGSFSRTFGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLS 568

Query: 539 XXXXXXXXXXXXXXXXXXXXYGRHNIITNPIKEEDSRNMTKAKLAKRHTMPPGMLYDLEN 598
                               Y      ++ I+EE+S  +       R      ++ DL++
Sbjct: 569 ----KKNTVDVTTNGSSSNGYKFRVTSSDSIEEENSGFIYS---HSRKASSTSIVSDLDS 621

Query: 599 LEIENEGYHASEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESE 642
           L+ ++ G +A +YYRSHSP K   +   R +IQ+RVQNLL  S+
Sbjct: 622 LQ-DDSGTNAKKYYRSHSPVKLSGSSDARSSIQKRVQNLLKSSQ 664

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  497 bits (1280), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 225/311 (72%), Positives = 264/311 (84%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP+IP YP G  L VG H A I KYLTSGG+AQ+Y  +I+P D+ + S++ CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K+ LNT RAEVDAMKLL+N  HVVSYIDSNA KS  +NG+YEVLLLME+C  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E EILNI+SQ  QGVA MH+L+P LLHRDIKIENVL S +GE+KLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPP +QQE ++VQHDILKNTTAQYR PEM+DL R LPIDEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE AILHS+++Y A+P YSD LKNLIR+ML+  P++RPNIC++LEE+S +Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 GVPCPIQNFYL 311
           G+PCPI+NFYL
Sbjct: 301 GIPCPIKNFYL 311

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  493 bits (1268), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/311 (72%), Positives = 263/311 (84%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP + +Y  GTLL+VG+H+A I KYLTSGGFAQ+Y  EI+P+D +  S++ CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LNTLRAEVDAMKLL+NN HVVSYIDS+A K   N GSYEV LLMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E EIL+I+SQ +QGVA MHALQP LLHRDIKIENVL +  G +KLCDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPP N QE +YVQHDI+KNTTAQYR PEM++L +GLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEKTGENAILH+ FQ+P FP YSDR+K+LIR+ L+  P++RPNI +LLEE+S IQ
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 GVPCPIQNFYL 311
            VPCPI +FYL
Sbjct: 301 NVPCPIPDFYL 311

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  497 bits (1280), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/311 (72%), Positives = 261/311 (83%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP I  Y +GT+L VG+H+  + KYL SGGFA +Y+VEI+P D     NVACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K+ LNTLRAEVD+MK L+ N+ +VSYIDS+A KS  N G YEV LLMEYC GGGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E EILNI+SQ +QGVA MHALQP L+HRDIKIENVL S N EFKLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IR PRN +E +YVQ+DI+KNTTAQYRCPEM+DLYRGLPIDEKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE+AIL SKF++PA+P YSDR+KNLI VML  +P KRPNIC+++EE+S IQ
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 GVPCPIQNFYL 311
           G+PCPI+NFYL
Sbjct: 301 GIPCPIKNFYL 311

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 7/66 (10%)

Query: 480 NTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGA-----FTG--SM 532
           +TG S  +K  +K+K+V+TGE R  S IRS Q+TG SV+SAF A+R       FTG  S 
Sbjct: 520 STGGSLTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSS 579

Query: 533 RAPSLD 538
           R  SL+
Sbjct: 580 RKSSLE 585

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  493 bits (1270), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 225/311 (72%), Positives = 257/311 (82%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQ    +Y  GT LTVG+HRA I KYLTSGGFA IY  EI P D  S + +ACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LN LRAEVDAMKLL+ N+HVVSYIDS+A KS  ++GSYEV LLMEYC GGGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E E+L I S   QG+A MHALQP L+HRDIKIENVL S +  FK+CDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPP+N QE +YVQHDILKNTTAQYR PEM+DLYRG PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE AILHS+FQ+P++P YSD LK+LI  MLSENPT+RPNIC++LEE+S IQ
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 GVPCPIQNFYL 311
           G PCP++NFY+
Sbjct: 301 GTPCPLRNFYV 311

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 129/302 (42%), Gaps = 45/302 (14%)

Query: 480 NTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFT-GSMRAP--- 535
           +TG S  ++F  K+K V TGE R+ SPI+SRQ+TG SVRSAF  +R  F+ GS ++    
Sbjct: 506 HTGGSATRRFGQKLK-VFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPN 564

Query: 536 ---SLDXXXXXXXXXXXXXXXXXXXXYGRHNIITNPIKEEDSRNMTKAKLAKRHTMPPGM 592
              SLD                        N+         S + +              
Sbjct: 565 KRNSLDISSTSSHSNGFKFRVSSSESIEEENVYPRFSHSRSSSSASIVS----------- 613

Query: 593 LYDLENLEIENEGYHASEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESE-QPMERN--- 648
             DL+ L+ ++ G  A  YY+SHSP K   T+ +R +IQ+RVQ+LL  S+  P+++    
Sbjct: 614 --DLDQLQQDDTG--AKNYYKSHSPVKVSATQGSRSSIQKRVQDLLKNSQDSPVKKTAHG 669

Query: 649 -----------NIDTHHTNAVSHSMIPRNLNSREK---DSLRYSSVVINPLEDIGSSPKK 694
                       + +  TN      + ++  S  K    + R SSVVI   + +    ++
Sbjct: 670 YGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAKRNSSVVIKAGQQVSKDAEE 729

Query: 695 AXXXXXXXXXXXXXXXXXXTYLSKMFSKERISSTATEQLV---TLDVDTLERDFRKRFPS 751
                                 +    KE   ++A E  V    +++D LE+DF++RFPS
Sbjct: 730 VPSSRKPAPPKPKRPKKPSHLKADKIIKE-AETSAYEHSVDISDIEIDELEKDFKRRFPS 788

Query: 752 TL 753
            +
Sbjct: 789 AV 790

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  482 bits (1240), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 216/311 (69%), Positives = 259/311 (83%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP+I  Y  GT L VG H+  I KYLTSGGFAQIY V++ P +  +  N+ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P KSGLNTLRAEV+AM+LLK   HVV YIDSNA +S  N+G+YEVL LME+C GGGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E E+LNI++Q  QG+  MH+L P L+HRDIKIENVL S NGE+K+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPP+N +E ++VQ DI+KNTTAQYRCPEMLDLYRG PI+EKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFE  GE AILH+++QYP +P+YS RLKNLIR+ML E P +RPN+C++LEE+SS+Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 GVPCPIQNFYL 311
           G+PCP+ NFYL
Sbjct: 301 GIPCPLPNFYL 311

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  481 bits (1237), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 217/311 (69%), Positives = 257/311 (82%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MN P IP Y  GT+L+VGTH A I KY+ SGGFAQ+Y+ E+ P DT + +N  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K+GLN LRAEV+AMKLLK ++HVV YIDS+A +S   NG+YEV LLME+C  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E EILNI+SQ  QG+A MHALQP L+HRDIKIENVL S +GE+K+CDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPPRN QE ++VQHDILKNTTAQYR PEM+DLYR   IDEKSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK G+ AILHS++Q+ A PIYSDRLKNLI  MLS+ P +RPNIC++LEE+S +Q
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 GVPCPIQNFYL 311
           GV  P++NFYL
Sbjct: 301 GVSSPMRNFYL 311

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  474 bits (1220), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 219/309 (70%), Positives = 256/309 (82%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP I  Y  GT LTVG+H+  I KYLTSGGFAQ+Y+  I+P D +S SN+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LNTLRAEVDAM+LL+NNR+VVSYIDS+A K+  +NGSYEV +LMEYCE GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E EIL I+SQ  QGVA MHALQP L+HRDIKIENVL S N E+KLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPPRN QELSYVQ DI KNTTAQYR PEM+D++RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE AIL   F++P +P YS++L++LIR +L +NP +RPN+ +LL+ IS +Q
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 GVPCPIQNF 309
            VPCPI + 
Sbjct: 301 NVPCPISDI 309

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  472 bits (1215), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 221/309 (71%), Positives = 254/309 (82%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP I  Y  GT LTVG+H+  I KYLTSGGFAQ+Y+  I P D +S S+VACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LNTLRAEVDAM+LLKNNR+VVSYIDS+A K+  +NGSYEV +LMEYCE GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E EIL I+SQ  QGVA MHALQP L+HRDIKIENVL S N E+KLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPPRN QELSYVQ DILKNTTAQYR PEM+D +RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK G+ AIL  KF++P +P YS++LK LIR +L ++P  RPN+ +LL+ IS +Q
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 GVPCPIQNF 309
            VPCPI + 
Sbjct: 301 NVPCPINDI 309

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  470 bits (1210), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 214/311 (68%), Positives = 258/311 (82%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQPNI  YP GT LTVG+H+  I KYLT+GGFAQIY   I+P+D +S +N+ACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LN LRAEVDAMKLL+NNR VVSYIDS+A KS+F NG+YEV LLMEYCE GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           +NSRLQNRL E+E++NI+   +QGVA MHALQP L+HRDIKIENVL S N EFKLCDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           V G IRPP N QEL+ VQ+DI++NTTAQYR PEM+D+ RG PIDEKSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK+GE  IL S++++PAFP YSDRL++LI  +L+  P  RPNI ++++E+S ++
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 GVPCPIQNFYL 311
            + CPI NFYL
Sbjct: 301 NISCPIINFYL 311

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  472 bits (1214), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 227/343 (66%), Positives = 267/343 (77%), Gaps = 5/343 (1%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP I  Y  GT LTVG+H+  I KYLTSGGFAQ+Y+V I+P D ++ +NVACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LNTLRAEVDAM+LLKNNR+VVSYIDS+A K+   NGSYEV +LMEYCE GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E EIL I+SQ  QGVA MHALQP L+HRDIKIENVL S N E+KLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IR PRN QELSYVQ DILKNTTAQYR PEM+D++RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE AIL  KF++P +P YS++LK+LIR +L +NP  RP++ +LL+ IS +Q
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 GVPCPIQNFYLXXXXXXXXXXXXXXXTTVPKIATAQPIQQLNA 343
            VPCPI +                  T + +++  Q IQ LN+
Sbjct: 301 NVPCPINDI-----QTVQAPSSHLNLTELHQLSATQNIQSLNS 338

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  470 bits (1209), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 220/315 (69%), Positives = 259/315 (82%), Gaps = 9/315 (2%)

Query: 1   MNQ-PNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEI---TPVDTYSKSNVACLK 56
           MNQ P   L P G +LTVG+H   I +YLTSGGFAQIY+ E+    P+    + ++ACLK
Sbjct: 1   MNQVPQDCLQP-GIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPI----QGSLACLK 55

Query: 57  RVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGG 116
           RV VP K  LNTLRAEVDAMK+LK +RHVVSYIDS+A KS  ++G+YEV LLMEYC  GG
Sbjct: 56  RVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGG 115

Query: 117 LIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLC 176
           LIDFMNSRLQ RLSE E+L I+S  AQG+  MHAL P L+HRDIKIENVL SG+G+FK+C
Sbjct: 116 LIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVC 175

Query: 177 DFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFL 236
           DFGSV G IRPP+N  E +YVQHDILKNTTAQYR PEM+DLYR LP+DEKSDIWALGVFL
Sbjct: 176 DFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFL 235

Query: 237 YKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           YK+CY+TTPFEK GENAIL +KFQ+P++P Y+DRLKNLI VMLSE+P +RPNIC++LEE+
Sbjct: 236 YKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295

Query: 297 SSIQGVPCPIQNFYL 311
           S IQGVPCP+ NFYL
Sbjct: 296 SRIQGVPCPLPNFYL 310

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  469 bits (1207), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 223/360 (61%), Positives = 271/360 (75%), Gaps = 8/360 (2%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQ     +  GT+LTVG+H+  + KYLTSGGFAQIY  E+   D+  K +VACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LNTLRAEVDAMKLL+ N+H+VSYIDS+A KS  NNGSYEV+LLMEYC  GGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQ+RL E E+L I++Q  QG+  MHALQP L+HRDIKIENVL + NG+ K+CDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPP+N  ELSYVQHDILKNTTAQYR PEM+DLYRG  +DEKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEKTGE AIL + FQ+P++P YS+RLKNLI VML+ENP  RPN C++LEE+  IQ
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 GVPCPIQNFYLXXXXXXXXXXXXXXXTTVPKIATAQPIQQLNARTQTMPIINTKANTSLV 360
           G PCP++NFYL                   + + +QP+  +N +   +PI+  +   S++
Sbjct: 300 GQPCPVKNFYLERSLKQQIPSQL-------RHSVSQPMIAMNPQQAKIPIVIPQVQNSVL 352

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  465 bits (1197), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/311 (66%), Positives = 259/311 (83%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQ  +PLY   T++TVG+H A I KYL SGG+AQ+Y+  +TPVD    +N+ACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K  LN LRAEVDA+K+L+N ++VVSYIDS+A K + + GSYEV +LMEYC GG LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           +N+RL+NRL E EIL+I++Q A GVA MH LQP L+HRDIKIEN+L S NGE+K+CDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPPR+ +E+ Y+QHDI+KNTTAQYR PEMLDL +G  I+EKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE AIL S+FQYPA+P+YSD LKN+IRV+LS +P KRPNIC+L+EE+S +Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 GVPCPIQNFYL 311
           G+  P++NFYL
Sbjct: 301 GIVPPMKNFYL 311

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 37/55 (67%)

Query: 476 LQGNNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFTG 530
           L  N+TG S  +  + K+K V+TGE R+ SP+RSRQ+TGGS RS F  +   FTG
Sbjct: 495 LSKNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTG 549

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  462 bits (1190), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 213/308 (69%), Positives = 259/308 (84%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP I  Y  GT LTVG+H+  I KYLTSGGFAQ+Y+  I+P D ++ SNVACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P K+ LNTLRAEVDAMKLL+NNR+VVSYIDS+A K+  +NGSYEV +LMEYCE GGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL E+EIL I+ Q  QGVA MHALQP L+HRDIKIENVL S   E+KLCDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           VCG IRPPRN QELSYV+ D+LKNTTAQYR PEM+D++RGLPIDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFEK GE AIL+ +F++  +P YS++L+NLI  +L +NP++RPN+ +LL++I+++Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 GVPCPIQN 308
             P PI++
Sbjct: 301 NAPYPIRD 308

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  457 bits (1176), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 216/315 (68%), Positives = 253/315 (80%), Gaps = 8/315 (2%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MNQP IP YP G ++ VG+H+A I KYLTSGGFAQIY+VEI+P D Y+ SN+ACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P KSGLN LR EVDAMKLLKNNRHVVSYIDSNA KS F NGSYEV LLMEYCE G L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN++L+ RL E E+LNI++Q  QG+A MH L P L+HRDIKIENVL SG+G FK+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYK-- 238
           VCG IRPPRN QEL YVQHD++KNTTAQYR PEM+DL +G PI+ K  I  LG +     
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238

Query: 239 --LCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
             L +YT  F +  E AIL+ ++QYPA+PIYSDRLKN++RV+LS +P KRPNIC+LLEEI
Sbjct: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296

Query: 297 SSIQGVPCPIQNFYL 311
           S IQ +PCPI NFYL
Sbjct: 297 SKIQNIPCPIDNFYL 311

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 127/315 (40%), Gaps = 52/315 (16%)

Query: 479 NNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFTG---SMRAP 535
           +NTG+S   +   +++ V+T +S  +S I + Q+TG S++SA  +++ + +G   +++A 
Sbjct: 485 DNTGNSIVSRLGVQLRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGMANNVKAL 544

Query: 536 SLDXXXXXXXXXXXXXXXXXXXXYGRHN---IITNPIKEEDSRNMTKAKLAKRHTMPPGM 592
           S++                      + N   II   +    S ++  A  +  H+     
Sbjct: 545 SVENARNHLERLGSSYSIGSNNNIAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHS----- 599

Query: 593 LYDLENLEIENEGYHA------SEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESE-QPM 645
                 L  ENE Y           ++S SP K  V +  + +I++RV NLL  +E  P+
Sbjct: 600 -----ELSDENELYDTLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPV 654

Query: 646 ER-----------------NNIDTHHTNAVSHSMIPRNLNSREKDSLRYSSVV---INPL 685
           ++                  N   H     S S  P  L++R   S  +  VV   IN  
Sbjct: 655 KKTAAGYGKYTKRPKMVSPTNPHYHLVRQNSVSQTPLILSAR--GSSGHPVVVPALINRD 712

Query: 686 EDIGSSPKKAXX---XXXXXXXXXXXXXXXXTYLSKMFSKERISSTA----TEQLVTLDV 738
            D G  P K+                      +LS +   ++ S+T      + L    V
Sbjct: 713 NDNGKYPAKSKAPPVVPKKPDHLRPKPPKKPAHLSSLKINKKHSTTVLNTPADLLSDTAV 772

Query: 739 DTLERDFRKRFPSTL 753
           D LE+ F++R+PST+
Sbjct: 773 DELEKSFKQRYPSTV 787

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  458 bits (1178), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 203/315 (64%), Positives = 253/315 (80%), Gaps = 6/315 (1%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSN----VACLK 56
           MNQP IP Y  G +L +GTH+ +I+KYL  GGFAQ+Y+V +  +D+ +  N    +ACLK
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV--IDSSNARNELGTMACLK 58

Query: 57  RVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGG 116
           RVIVP KSGLNTLRAEVDAMKLLK N+++VSYIDS+A +S    G YEV LLMEYC  GG
Sbjct: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118

Query: 117 LIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLC 176
           +IDF+N+RL +RL E EIL I+S   QGVA MH LQP L+HRDIKIENVL S NG++K+C
Sbjct: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178

Query: 177 DFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFL 236
           DFGS C  +RPP+  QE +++ HDI+ NTTAQYR PEM+D Y G PIDEKSDIWALGVFL
Sbjct: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238

Query: 237 YKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           YKLCYYTTPFEK GENAIL+ KFQ+P++P YSD ++N+I +ML+++P KRPNIC++LE++
Sbjct: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298

Query: 297 SSIQGVPCPIQNFYL 311
           S +QGVPCPI+NF L
Sbjct: 299 SKLQGVPCPIENFML 313

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 492 KIKRVVTGESRNASPIRSRQDTGGSVRSAF 521
           KIK      S  ASP+ SRQ+TG S++SAF
Sbjct: 854 KIKVSTDSFSSTASPLSSRQNTGDSIKSAF 883

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  422 bits (1085), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 193/311 (62%), Positives = 245/311 (78%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60
           MN P+IP Y  GT +TVG+H   I KYLTSGG+AQIY+ +I P D +  +N+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P KS LNTLRAEVDAMK LK+++++VSYIDS+A KS + +G+YEV L+MEYC  GGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180
           MN+RLQNRL+E EIL I    +QGVA MH LQP L+HRDIKIENVL S + ++KLCDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240
           V GYIRPP+  +EL+YV+HDI+ +TTAQYR PEMLDL +G  +++KSDIWALGVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           YYTTPFE+TGE  IL+   ++P +P YSD +K LI  ML++NP  RPNI ++++ +S + 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 GVPCPIQNFYL 311
            V CPI N ++
Sbjct: 301 NVNCPIPNIHV 311

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  405 bits (1040), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 228/303 (75%)

Query: 9   YPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNT 68
           Y  GT L V +H  +I+ YLTSGGFAQ+Y   IT         + CLKRVIVP K  LN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNR 128
           LRAEVDAMK+LKNN+++VSYIDS+A +   +  SY VLLLMEYC G GL+DFMN RL+ R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 129 LSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPP 188
           L E EIL I++  +QGV +MH LQP LLHRDIKIENVL SG+G FKLCDFGSV G +R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 189 RNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK 248
            + +E  Y+Q+DILKNTTAQYR PEM++L  G PI+EKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 249 TGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQGVPCPIQN 308
            G  AI+  KF YPA+P Y+D LKN+IRV+LS NP +RPNIC+LLEE+  IQ    P+ N
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 309 FYL 311
           FY+
Sbjct: 309 FYV 311

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (65%)

Query: 479 NNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIR 525
           N+TG S  +    KIK   TG  R+ SPI+SRQ+TG S+RSAF  +R
Sbjct: 501 NSTGGSLIKSLGTKIKLTTTGGKRSQSPIKSRQNTGDSIRSAFNKVR 547

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  321 bits (822), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 162/320 (50%), Positives = 212/320 (66%), Gaps = 11/320 (3%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPV-----DTYSKS----- 50
           +N PN   YPNG +++VG HR  I  YL  GGFAQIY V+            SKS     
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLME 110
           ++ACLKRVIV  + GLN +R EV+ MK LK++ ++V Y DSNA +       +EVLLLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            C    L+D+MN RL+ +LSE+EIL I+   + G++NMH L   L+HRDIKIENVL   N
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIW 230
             FKLCD GS      P  + Q+++ +  +I  +TT QYR PEM+DLYR LPI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNIC 290
           ALG+FLYKL +YTTPFE TG+ AILHSK+ +P    YS ++ NLI +ML+ENP  RPNI 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNK-YSSKIINLIIIMLAENPNLRPNIF 310

Query: 291 ELLEEISSIQGVPCPIQNFY 310
           +++  I SI  +P PI++ Y
Sbjct: 311 QVVYHICSIMNLPVPIEDRY 330

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  311 bits (798), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 156/307 (50%), Positives = 203/307 (66%), Gaps = 9/307 (2%)

Query: 12  GTLLTVGTHRALIKKYLTSGGFAQIYAVEI--------TPVDTYSKSNVACLKRVIVPTK 63
           GTL+ VG+H+  I KYL  GGFA IY V+         TP  +  + ++ACLKRV+V  +
Sbjct: 35  GTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTDE 94

Query: 64  SGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNS 123
           +GLN LR EV+ MK LKN+ ++V Y DSNA +    +  YEVLLLME C    L+D+MN 
Sbjct: 95  NGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMNQ 154

Query: 124 RLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCG 183
           RL  +LSE E+L I+    + VA MH L   L+HRDIKIENVL      FKLCDFGS   
Sbjct: 155 RLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTSS 214

Query: 184 YIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYT 243
                   Q+++ + ++I  +TT QYR PEM+DLYR LPIDEKSDIWALG+FLYKL +YT
Sbjct: 215 CFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYT 274

Query: 244 TPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQGVP 303
           TPFE TG+ AILHSK+  PA   YS +L NLI +ML+ENP  RPNI +++ ++ +I  V 
Sbjct: 275 TPFELTGQFAILHSKYDIPANN-YSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKVD 333

Query: 304 CPIQNFY 310
            P ++ Y
Sbjct: 334 VPFEDKY 340

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  308 bits (789), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 205/320 (64%), Gaps = 22/320 (6%)

Query: 12  GTLLTVGTHRALIKKYLTSGGFAQIYAV----------------EITPVDTYSK-----S 50
           G ++ VG H+  I KYL  GGFAQIY+V                E + +D + +      
Sbjct: 22  GAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKLEPG 81

Query: 51  NVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLME 110
           N+ACLKRV+VP ++GLN LR EV+ M+ LK   ++V Y DSNA +    N  +EVLLLME
Sbjct: 82  NLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLLLME 141

Query: 111 YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            C    L+D+MN RL  +LSE EIL I+     G++ MH LQ  L+HRDIKIENVL   +
Sbjct: 142 LCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLVDSS 201

Query: 171 GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIW 230
             FKLCDFGS         + QE++ +  +I  +TT QYR PEM+DLYR LPIDEKSDIW
Sbjct: 202 NNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKSDIW 261

Query: 231 ALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNIC 290
           ALGVFLYKL +YTTPFE TG+ AILHSK++ P    YS RL NLI +ML+ENP  RPNI 
Sbjct: 262 ALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPNN-YSSRLINLIIIMLAENPNLRPNIY 320

Query: 291 ELLEEISSIQGVPCPIQNFY 310
           +++ ++    G+  PI++ Y
Sbjct: 321 QVMHQVCITIGIEPPIKDKY 340

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  310 bits (794), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 195/312 (62%), Gaps = 11/312 (3%)

Query: 9   YPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSN----------VACLKRV 58
           + NG+ + VG  +  I KYLT GGFAQIY V+         SN          +ACLKRV
Sbjct: 25  FANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLKRV 84

Query: 59  IVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLI 118
           +V  ++GLN +R EV+ MKLLK   ++V Y DSNA +       +EVLLLME C    L+
Sbjct: 85  LVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNKSLL 144

Query: 119 DFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDF 178
           DFMN RL  +LSE EIL I+      VA MH L P L+HRDIKIENVL      FKL DF
Sbjct: 145 DFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKLADF 204

Query: 179 GSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYK 238
           GS           Q+++ +  DI  +TT QYR PEM+DLY+ LPIDEKSDIWALG+FLYK
Sbjct: 205 GSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIFLYK 264

Query: 239 LCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISS 298
           L +Y TPFE TG+ AILHSK+ +P    YS RL NLI +MLSENP  RPNI ++L EI S
Sbjct: 265 LLFYITPFEMTGQFAILHSKYDFPQTN-YSSRLINLIIIMLSENPNLRPNIYQVLHEICS 323

Query: 299 IQGVPCPIQNFY 310
           I G    I + Y
Sbjct: 324 ISGTRLEITDKY 335

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  310 bits (794), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 163/322 (50%), Positives = 212/322 (65%), Gaps = 20/322 (6%)

Query: 6   IPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEIT-------PVDTYSK--------S 50
           I  +  G  + VG+H   I KYLT GGFAQIY V++T        +D  ++         
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 51  NVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLME 110
           ++ CLKRV+V  ++GL+ ++ EV+ MK L+   +VV Y DSNA ++   NG +EV LLME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
           YC    L+D+MN RL  +L+E+EILNI+     GV+ +H L   L+HRDIKIENVL   N
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 GEFKLCDFGSVCGYIRPP--RNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSD 228
             FKLCDFGS    I PP     Q++S + HDI  +TT QYR PEM+DL+R LP++EK+D
Sbjct: 206 NRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 229 IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
           IWALGVFLYKL +YTTPFE TG+ AILHSK++ P    YS+RL NLI VML+ENP  RPN
Sbjct: 264 IWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENPNLRPN 322

Query: 289 ICELLEEISSIQGVPCPIQNFY 310
           I ++L EI SI  V  PI + Y
Sbjct: 323 IYQVLSEICSILNVEVPIPDIY 344

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  303 bits (775), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 209/318 (65%), Gaps = 19/318 (5%)

Query: 9   YPNGTLLTVGTHRALIKKYLTSGGFAQIYAVE-ITPVDTYSK-------------SNVAC 54
           YP GT + VG+H+  + KY+  GGFAQIY V+ I  ++ ++               ++AC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEG 114
           LKRV+V   +GLN +R EV+ M+ L+    VV Y DSNA   + +   YEVLLLME+C  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 115 GGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFK 174
             L+D+MN RL  RLSE EI+ I+  T  G+A +H L+  L+HRDIKIENVL      FK
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 175 LCDFGS--VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWAL 232
           LCDFGS  +C  I    N ++++    +I  NTT QYR PEM+DLYR  PIDEKSDIWAL
Sbjct: 279 LCDFGSTSICFPIV--TNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWAL 336

Query: 233 GVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICEL 292
           GVFLYKL ++TTPFE+TG+ AILHSK+++P    YS +L NLI +ML+ENP+ RPNI ++
Sbjct: 337 GVFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQV 395

Query: 293 LEEISSIQGVPCPIQNFY 310
           L+ + SI G   P+ + Y
Sbjct: 396 LQYLCSINGWKVPLNDKY 413

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  298 bits (763), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 155/311 (49%), Positives = 200/311 (64%), Gaps = 10/311 (3%)

Query: 9   YPNGTLLTVGTHRALIKKYLTSGGFAQIYAVE----ITPVDTYSK-----SNVACLKRVI 59
           Y  GT++ VG H+  + KYL  GGFA+IY V+    ++ VD   K      +  CLKRV+
Sbjct: 29  YVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRVL 88

Query: 60  VPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLID 119
           V   +GLN +R EV+ M+ LK    VV Y DSNA +       YEVLLLME C    L+D
Sbjct: 89  VQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSLLD 148

Query: 120 FMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFG 179
           +MN RL  +LSE EIL I+      VA MH L   L+HRDIKIENVL      FKLCDFG
Sbjct: 149 YMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCDFG 208

Query: 180 SVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKL 239
           S    +    + Q+++ +  +I  +TT QYR PEM+DLYR LP++EKSDIWALGVFLYKL
Sbjct: 209 STSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLYKL 268

Query: 240 CYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSI 299
            +YTTPFE+TG+ AILHSK+++P    YS +L NLI VML+ENP  RPNI ++L +I  I
Sbjct: 269 MFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQICYI 327

Query: 300 QGVPCPIQNFY 310
            G+  P+ + Y
Sbjct: 328 SGIKNPMDDAY 338

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  303 bits (775), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 202/318 (63%), Gaps = 11/318 (3%)

Query: 3   QPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSN----------V 52
           +PN   Y  GT + VG H+  I KY+  GGFAQIYAV+        ++N          V
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  ACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYC 112
           ACLKRV+V  ++GLN +R EV+ MK L+   ++V Y DSNA +       +EVLLLME C
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135

Query: 113 EGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGE 172
               L+D+MN RL  +L+E EIL I+      V+ MH L   LLHRDIKIENVL      
Sbjct: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195

Query: 173 FKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWAL 232
           FKLCDFGS           Q+++ +  +I  +TT QYR PEM+DLYR LPIDEKSDIWAL
Sbjct: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255

Query: 233 GVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICEL 292
           G+FLYKL ++TTPFE TG+ AILHSK+++P    YS +L NLI +ML+ENP  RPNI ++
Sbjct: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQV 314

Query: 293 LEEISSIQGVPCPIQNFY 310
           L  I SI G+  PI++ Y
Sbjct: 315 LHNICSISGMKVPIEDQY 332

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  301 bits (772), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 205/316 (64%), Gaps = 10/316 (3%)

Query: 4   PNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVE----ITPVDTYSK-----SNVAC 54
           P +  +  G ++ VGTHR  +  YL  GGFAQIY V+    +   +  SK      +VAC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEG 114
           LKRV+V  ++GL+ +R EV+ MK L   +++V Y DSNA +    N  +EVLLLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFK 174
             L+D+MN RL  +L+E EIL I+   +  V+ MH L+  L+HRDIKIENVL      FK
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 LCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGV 234
           LCDFGS           QE++ +  +I  +TT QYRCPEM+DLYR LPI+EKSDIWALG+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLE 294
           FLYKL ++ TPFE TG+ AILHSK+++P    YS +L NLI +ML+ENP  RPNI ++L 
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLN 315

Query: 295 EISSIQGVPCPIQNFY 310
            I ++ GV  PI++ Y
Sbjct: 316 HICTMIGVEVPIEDKY 331

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  299 bits (765), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 160/323 (49%), Positives = 207/323 (64%), Gaps = 24/323 (7%)

Query: 9   YPNGTLLTVGTHRALIKKYLTSGGFAQIYAV-----------EITP--VDTYSKSNVACL 55
           Y  G ++ VG+HR  I +Y+  GGFAQIY+V           E +P   D     ++ACL
Sbjct: 18  YQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDLACL 77

Query: 56  KRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGS--------YEVLL 107
           KRVIV  ++GLN LR EV+ MK L    ++V Y DSNA  S   NG+        +EVLL
Sbjct: 78  KRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNA--SRLRNGTDSQPQENKFEVLL 135

Query: 108 LMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLR 167
           LME C    L+D+MN RL  +LSE EIL ++   +  +A MH L+  L+HRDIKIENVL 
Sbjct: 136 LMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVLV 195

Query: 168 SGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKS 227
                FKLCDFGS           ++++Y+  +I  +TT QYR PEM+DLYR LPIDEKS
Sbjct: 196 DQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS 255

Query: 228 DIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRP 287
           DIWALG+FLYKL ++TTPFE+TG+ AILHSKF++P    YS +L NLI VMLSENP  RP
Sbjct: 256 DIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQNN-YSFKLINLIIVMLSENPNLRP 314

Query: 288 NICELLEEISSIQGVPCPIQNFY 310
           NI ++L +I  ++ VP PI + Y
Sbjct: 315 NIYQVLHQICQLKQVPIPIADKY 337

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  298 bits (764), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 153/308 (49%), Positives = 198/308 (64%), Gaps = 10/308 (3%)

Query: 12  GTLLTVGTHRALIKKYLTSGGFAQIYAV---------EITPVDTYSKSNVACLKRVIVPT 62
           G+ + VG HR  I KYL  GGFA IY V         E  P  T      ACLKRV+V  
Sbjct: 32  GSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVLVTD 91

Query: 63  KSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMN 122
           ++GLN +R EV  MK L    ++V Y DS+A +S      +EV+LLME C    L+D+MN
Sbjct: 92  ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPNNSLLDYMN 151

Query: 123 SRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVC 182
            RL  +LSE EIL I+    + +A MH L   L+HRD+KIENVL  G+  FKLCDFGS  
Sbjct: 152 QRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCDFGSTS 211

Query: 183 GYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYY 242
             +      QE++ + ++I  +TT QYR PEM+DLYR LPIDEKSDIWALG+FLYKL +Y
Sbjct: 212 TCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 271

Query: 243 TTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQGV 302
           TTPFE TG+ AILHSK+++P    YS +L NLI +ML+ENP  RPNI ++++ + SI  V
Sbjct: 272 TTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMDNLCSIMKV 330

Query: 303 PCPIQNFY 310
             PI++ Y
Sbjct: 331 ENPIEDKY 338

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  302 bits (774), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 155/326 (47%), Positives = 206/326 (63%), Gaps = 25/326 (7%)

Query: 9   YPNGTLLTVGTHRALIKKYLTSGGFAQIYAVE-ITPVDTYSKSN---------------- 51
           +P GT + VG+H+  I KY+  GGFAQIYAV+ +  ++ +  SN                
Sbjct: 24  FPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNP 83

Query: 52  -------VACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYE 104
                  +ACLKRV+V  ++GLN +R EV+ MK LK   +VV Y DSNA +       +E
Sbjct: 84  MILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFE 143

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           VLLLME C    L+D+MN RL  +L+E EIL I+      V++MH L+  LLHRDIKIEN
Sbjct: 144 VLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIEN 203

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPID 224
           VL      FKLCDFGS    +      Q+++ +  +I  +TT QYR PEM+DLYR LPID
Sbjct: 204 VLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPID 263

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPT 284
           EKSDIWALG+FLYKL ++ TPFE TG+ AILHSK+++P    YS +L NLI +ML+ENP 
Sbjct: 264 EKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPN 322

Query: 285 KRPNICELLEEISSIQGVPCPIQNFY 310
            RPNI ++L+ I S+  V  PI++ Y
Sbjct: 323 LRPNIYQVLDNICSMMNVEVPIEDIY 348

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  297 bits (760), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 199/322 (61%), Gaps = 18/322 (5%)

Query: 6   IPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPV---------------DTYSK- 49
           I  +  G  L VGTH+  I  YLT GGFAQIY V+   V                 YS  
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 50  -SNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLL 108
             +VACLKRV+V  + GLN +R EV+ MK L+   ++V Y DSNA +S   N  YEVLLL
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRS 168
           ME C    L+++MN RL  +LSE E+L I+     GVA MH L+  L+HRDIKIENVL  
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 GNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSD 228
            N  FKLCDFGS           Q+++ +  ++  +TT QYR PEM+DLYR LPI+EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
           IWALGVFLYKL +YTTPFE TG+ A+LHSKF  PA   YS ++ NL+ +MLSEN   RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPANK-YSSKIINLVIIMLSENLNLRPN 326

Query: 289 ICELLEEISSIQGVPCPIQNFY 310
           I +++  I  +  V  PI + Y
Sbjct: 327 IYQVMHYICQLIQVDTPILDIY 348

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  296 bits (757), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 153/307 (49%), Positives = 196/307 (63%), Gaps = 9/307 (2%)

Query: 12  GTLLTVGTHRALIKKYLTSGGFAQIYAVEITPV--------DTYSKSNVACLKRVIVPTK 63
           G++L VG HR  I +YL  GGFA IY V                 + ++ACLKRV V  +
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVNDE 90

Query: 64  SGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNS 123
           +GLN LR EV+ MK LK   +VV Y DSNA +       +EVLLLME C  G L+D+MN 
Sbjct: 91  NGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMNQ 150

Query: 124 RLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCG 183
           RL  +LSE E+L I+    +G+++MH L+  L+HRDIKIENVL      FKLCDFGS   
Sbjct: 151 RLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTST 210

Query: 184 YIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYT 243
            +      QE++ + ++I  +TT QYR PEM+DLYR L I+EKSDIWALG+FLYKL +YT
Sbjct: 211 CLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFYT 270

Query: 244 TPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQGVP 303
           TPFE TG+ AILHSK+  P    +S +L NLI VML+ENP  RPNI ++L  I SI    
Sbjct: 271 TPFELTGQFAILHSKYDIPQNN-FSSKLINLIIVMLAENPYIRPNIYQILYHICSIMECD 329

Query: 304 CPIQNFY 310
            PI++ Y
Sbjct: 330 VPIEDHY 336

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  293 bits (751), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 151/317 (47%), Positives = 204/317 (64%), Gaps = 11/317 (3%)

Query: 4   PNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEI--------TPVDT--YSKSNVA 53
           PN  L    T + VGTHR  I ++L  GGFA IY V+           +D+      ++A
Sbjct: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83

Query: 54  CLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCE 113
           CLKRVIVP ++GLN LR EV+ MK L+ + ++V Y DSNA +    +  +E+LLLME C 
Sbjct: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143

Query: 114 GGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEF 173
              L+D+MN++L  +L+EAEIL I+   +  +A MH L   L+HRDIKIENVL   +  F
Sbjct: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203

Query: 174 KLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALG 233
           KLCDFGS           Q+++ + ++I  +TT QYR PEM+DLYR LPI+EKSDIWALG
Sbjct: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263

Query: 234 VFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELL 293
           +FLYKL +YTTPFE TG+ AILHSK++ P    YS +L NLI +ML+ENP+ RPNI +++
Sbjct: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQNG-YSSKLINLIIIMLAENPSLRPNIYQVM 322

Query: 294 EEISSIQGVPCPIQNFY 310
             + SI     P  + Y
Sbjct: 323 HHVCSILKCDVPFTDKY 339

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  293 bits (751), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 149/308 (48%), Positives = 197/308 (63%), Gaps = 10/308 (3%)

Query: 12  GTLLTVGTHRALIKKYLTSGGFAQIYAV---------EITPVDTYSKSNVACLKRVIVPT 62
           G+ + VG HR  I KYL  GGFA IY V         E  P       ++ACLKRV+V  
Sbjct: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133

Query: 63  KSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMN 122
           ++GLN +R EV  MK L    ++V Y DS+A ++   +  +EV LLME C    L+D+MN
Sbjct: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193

Query: 123 SRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVC 182
            RL  +LSE EIL I+    + +A MH L   L+HRD+KIENVL   N  FKLCDFGS  
Sbjct: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253

Query: 183 GYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYY 242
                    QE++ + ++I  +TT QYR PEM+DLYR LPI+EKSDIWALG+FLYKL +Y
Sbjct: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313

Query: 243 TTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQGV 302
           TTPFE TG+ AILHSK+++P    YS +L NLI +ML+ENP  RPNI ++++ + SI  V
Sbjct: 314 TTPFELTGQFAILHSKYEFPVNN-YSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372

Query: 303 PCPIQNFY 310
             P+++ Y
Sbjct: 373 KNPLEDKY 380

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  296 bits (758), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 201/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVE----ITPVDTYSK-----SN 51
           M  P +  Y  G ++ VGTH+  I  YL  GGFAQIYAV+    +   D  +       +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  VACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEY 111
           VACLKRV+V  ++GLN +R EV+ MK LK   +VV Y DSNA +       +EVLLLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNG 171
           C    L+D+MN RL  +LSE+EI+ I+   A  ++ MH L   L+HRDIKIENVL     
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWA 231
            FKL DFGS           Q+++ +  +I  +TT QYR PEM+DLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICE 291
           LG+FLYKL ++TTPFE TG+ AILHSK+++P    YS +L NLI +ML+ENP  RPNI +
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEISSIQGVPCPIQNFY 310
           +L  I  I     PI++ Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  295 bits (756), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 202/329 (61%), Gaps = 32/329 (9%)

Query: 2   NQP-NIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVE-ITPVDTYSK---------- 49
           N+P +I  Y  GT+LTVG  R  I KYLT GGFAQIY V  I  ++ +            
Sbjct: 32  NRPGSIEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSR 91

Query: 50  ----SNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNG---- 101
                +VACLKRV+VP ++GL+ +R EVD MK L N  ++V Y DSNA K   N+     
Sbjct: 92  NLKIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTT 151

Query: 102 -----------SYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHA 150
                       +E+LLLMEYC    L+DFMN RL  +L+E EIL  ++     V  MH 
Sbjct: 152 NNNDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHY 211

Query: 151 LQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYR 210
           L   L+HRDIKIENVL   N  FKL DFGS      P    Q+++ +  DI  NTT QYR
Sbjct: 212 LAQPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYR 271

Query: 211 CPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDR 270
            PEM+DLY+ LPIDEKSDIWALGV LYKL +YTTPFE TG+ AILHSK+++PA   YS +
Sbjct: 272 SPEMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPANN-YSSK 330

Query: 271 LKNLIRVMLSENPTKRPNICELLEEISSI 299
             NLI +ML+ENP  RPNI ++L  + SI
Sbjct: 331 FINLIIIMLAENPNLRPNIFQVLYYLKSI 359

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  296 bits (757), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 206/319 (64%), Gaps = 10/319 (3%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVE----ITPVDTYSKS-----N 51
           + +P +  Y  GT++ VG  +  I  ++  GGFAQIY+V+    +   +  SK+     +
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  VACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEY 111
           +ACLKRV+VP ++GL+ +R EV+ MK L+  + ++ Y DSNA +       YEVLLLME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNG 171
           C    L+D+MN RL  RL+E EIL ++  T   ++ MH L   L+HRDIKIENVL     
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 EFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWA 231
            FKLCDFGS           Q+++ +  +I  NTT QYR PEM+DLYR LPI+EKSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICE 291
           LG+FLYKL ++ TPFE TG+ +ILHSK+++PA   YS +L NLI +ML+ENP  RPNI +
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 292 LLEEISSIQGVPCPIQNFY 310
           ++  I S+ G   PI++ Y
Sbjct: 313 VMHHICSVIGCEVPIEDKY 331

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  295 bits (755), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 152/319 (47%), Positives = 201/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVE----ITPVDTYSK-----SN 51
           M  P +  Y  G ++ VGTH+  +  YL  GGFAQIY V+    +   D  +       +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  VACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEY 111
           VACLKRV+V  ++GLN +R EV+ MK LK   ++V Y DSNA +       +EVLLLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNG 171
           C    L+D+MN RL  +L+EAEI+ I+   A  ++ MH L   L+HRDIKIENVL     
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWA 231
            FKL DFGS           Q+++ +  +I  +TT QYR PEM+DLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICE 291
           LGVFLYKL ++TTPFE TG+ AILHSK+++P    YS +L NLI +ML+ENP  RPNI +
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEISSIQGVPCPIQNFY 310
           +L  +  I  V  PI++ Y
Sbjct: 313 VLYHLCEILNVEVPIEDKY 331

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  292 bits (748), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 200/319 (62%), Gaps = 10/319 (3%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVE----ITPVDTYSK-----SN 51
           M  P +  Y  G ++ VGTH+  I  YL  GGFAQIY V+    +   D  +       +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEY 111
           +ACLKRV+V  ++GLN +R EV+ MK LK   +VV Y DSNA +       +EVLLLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNG 171
           C    L+D+MN RL  +L+E EI+ I+   A  ++ MH L   L+HRDIKIENVL     
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWA 231
            FKL DFGS           Q+++ +  +I  +TT QYR PEM+DLYR LPI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICE 291
           LG+FLYKL ++TTPFE TG+ AILHSK+++P    YS +L NLI +ML+ENP  RPNI +
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEISSIQGVPCPIQNFY 310
           +L  +  I  V  PI++ Y
Sbjct: 313 VLCHLCDILNVEVPIEDKY 331

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  291 bits (745), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 201/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVE----ITPVDTYSK-----SN 51
           M  P +  +  G ++ VGTH+  +  YL  GGFAQIY V+    +   D  +       +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEY 111
           VACLKRV+V  ++GLN +R EV+ MK LK   +VV Y DSNA +       +EVLLLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNG 171
           C    L+D+MN RL  +L+E+EI+ I+      ++ MH L   L+HRDIKIENVL   N 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWA 231
            FKL DFGS           Q+++ +  +I  +TT QYR PEM+DLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICE 291
           LG+FLYKL ++TTPFE TG+ AILHSK+++P    YS +L NLI +ML+ENP  RPNI +
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEISSIQGVPCPIQNFY 310
           +L  +  I  +  PI++ Y
Sbjct: 313 VLYHLCEILNIEVPIEDKY 331

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  292 bits (748), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 200/313 (63%), Gaps = 12/313 (3%)

Query: 9   YPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITP-----------VDTYSKSNVACLKR 57
           Y  G L++VG H+  I+ YL  GGFAQIY V+              +++    ++ACLKR
Sbjct: 35  YKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIACLKR 94

Query: 58  VIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGL 117
           V+V  ++GLN +R EV+ MKLL+   ++V Y DSNA++       YE+LLLME C    L
Sbjct: 95  VLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPNNSL 154

Query: 118 IDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCD 177
           +D+MN RL+ +L+E EI+ I+  T   V+ MH L   L+H+DIK+EN+L   N  FKLCD
Sbjct: 155 LDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFKLCD 214

Query: 178 FGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLY 237
           FGS         +  +++ +  +I  +TT QYR PEM+DLYR LPI+E SDIWALGVFLY
Sbjct: 215 FGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGVFLY 274

Query: 238 KLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEIS 297
           KL ++ TPFE+TG+ +ILH+KF  P    Y  +L NLI +MLSEN   RPNI +++ EI 
Sbjct: 275 KLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVMYEIC 333

Query: 298 SIQGVPCPIQNFY 310
           SI   P PI++ Y
Sbjct: 334 SITNTPLPIEDKY 346

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  286 bits (731), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 200/314 (63%), Gaps = 18/314 (5%)

Query: 9   YPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITP-VDTYSKSN------------VACL 55
           +P G ++TVG+HR  +  YL  GGFAQIY V+     + + + N             ACL
Sbjct: 96  FPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACL 155

Query: 56  KRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGS----YEVLLLMEY 111
           KRV+V  + GLN +R+EV+ MK L+   ++V Y DSNA +    +G+    +EVLLLME 
Sbjct: 156 KRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMEL 215

Query: 112 CEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNG 171
           C    L+D+MN RL  +L+E EI  I+      VA MH L   L+HRDIKIENVL   N 
Sbjct: 216 CPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANN 275

Query: 172 EFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWA 231
            FKLCDFGS         + Q+++ +  D+  +TT QYR PEM+DL++ +PI+EKSDIWA
Sbjct: 276 NFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWA 335

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICE 291
           LGVFLYKL ++TTPFE+TG+ A+LHSKF++P    YS +L NLI VML+ENP+ RPNI +
Sbjct: 336 LGVFLYKLLFFTTPFERTGQFAMLHSKFEFPP-NSYSSKLINLIIVMLAENPSLRPNIYQ 394

Query: 292 LLEEISSIQGVPCP 305
           +L  +S +     P
Sbjct: 395 VLYYLSEVTNREVP 408

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  285 bits (728), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 197/307 (64%), Gaps = 9/307 (2%)

Query: 12  GTLLTVGTHRALIKKYLTSGGFAQIYAVEIT----PVDTYSK----SNVACLKRVIVPTK 63
           G+ + VG H+  + +YL  GGFA IY V        +D   +     +  CLKRV V  +
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDE 91

Query: 64  SGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNS 123
           +GLN LR EV+ MK L+N  ++V Y DSNA +       YEVLLLME C  G L+D+MN 
Sbjct: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ 151

Query: 124 RLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCG 183
           RL  +LSEAE+L I+     G+++MH  +  L+HRDIKIENVL   +  FKLCDFGS   
Sbjct: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211

Query: 184 YIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYT 243
            +    + QE++ + ++I  +TT QYR PEM+DLYR LPI+EKSDIWALG+FLYKL +YT
Sbjct: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271

Query: 244 TPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQGVP 303
           TPFE TG+ AILHSK++ P    +S +L NL+ +ML+ENP  RPN+ +++  I S+    
Sbjct: 272 TPFELTGQFAILHSKYEIPRNS-FSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMECE 330

Query: 304 CPIQNFY 310
             I + Y
Sbjct: 331 VKIDDLY 337

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  278 bits (710), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 143/314 (45%), Positives = 191/314 (60%), Gaps = 10/314 (3%)

Query: 6   IPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYA---------VEITPVDTYSKSNVACLK 56
           I  Y  G ++ VG H+  I KYL  GGFA+IY          ++I  +      ++ CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGG 116
           RV+V   +GLN +R EV  MK L    ++V   DSNA +       YEVLLLME C    
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLC 176
           L+D+MN RL  +L+E EIL I+      VA MH L   L+HRDIKIENVL      FKLC
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFL 236
           DFGS    +      ++++ +  ++  +TT QYR PEM+D+YR + I+EKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           YKL +Y TPFE+TG+ AILHSK+++P    YS +L NLI +ML+ENP  RPNI ++L  I
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQHS-YSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SSIQGVPCPIQNFY 310
             I  +  PI + Y
Sbjct: 395 CKIINIKTPIDDIY 408

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 93/356 (26%), Positives = 156/356 (43%), Gaps = 75/356 (21%)

Query: 11  NGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLR 70
           N ++L  G H A I++ L  GGF+ +Y V+     +   +++  LK++  P       + 
Sbjct: 18  NSSVLINGQHYA-IQRLLGEGGFSFVYLVQ-----SRENNDLFALKKIHCP----FGNIE 67

Query: 71  AEVDAMKLLKNNRHVVSYIDSNAVKSAF---NNGSYEVLLLMEYCEGGGLIDFMNSRLQN 127
           +  +AM+ + + +   S   ++ V S      +GS  V +L+ Y   G L+D +N+ L +
Sbjct: 68  SVSEAMREVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLD 127

Query: 128 --RLSEAEILNILSQTAQGVANMH-------------ALQPVLLHRD------------- 159
              +SE EI+ IL   A+G+  MH             ++   L +RD             
Sbjct: 128 GTTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLL 187

Query: 160 ---------------------------IKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQ 192
                                      IK  N++ S +G   +CD GS         ++ 
Sbjct: 188 NDSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRS 247

Query: 193 ELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK---- 248
           +L   Q    ++ T  +R PE+L++     IDEK DIW+LG  LY +C+  +PFE+    
Sbjct: 248 QLVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQL 307

Query: 249 TGEN---AILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQG 301
           +G +   AI   KF  P    YS  L  +I+  +  +  KRP+I ELL  +  +QG
Sbjct: 308 SGASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 92/339 (27%), Positives = 148/339 (43%), Gaps = 63/339 (18%)

Query: 13  TLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAE 72
           + +++   +  I+K L  GG + +Y VE    + ++      LK+    T+    ++ + 
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVESKEGELFA------LKK----TRCPFGSIGSI 66

Query: 73  VDAMKLLKNNR-----HVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQN 127
             AMK + N +     ++   +DS  V+    +GS  V +L+ Y   G L D +N  L +
Sbjct: 67  SPAMKEVANYQRFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLD 124

Query: 128 --RLSEAEILNILSQTAQGVANMHALQP-------------------VLL---------- 156
             ++SE +IL +    A+G+  +H   P                    LL          
Sbjct: 125 CTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGE 184

Query: 157 ------HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN-QQELSYVQHDILKNTTAQY 209
                 HRD+K  N++ S      + D GS C   R   N +Q L   Q     N T  Y
Sbjct: 185 SQQSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSY 243

Query: 210 RCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK----TGEN---AILHSKFQYP 262
             PE+LD+     I EK DIW+ G  +Y +C+  +PFE+    +G +   AI   K+  P
Sbjct: 244 AAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVP 303

Query: 263 AFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQG 301
               YS  L  LI   LS NP +RP++ EL+  +  +QG
Sbjct: 304 RGTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 94.4 bits (233), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 87/348 (25%), Positives = 154/348 (44%), Gaps = 65/348 (18%)

Query: 15  LTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKS-------NVACLKRVIVPTKS--G 65
           +++   R  I++ L  G  + +Y V+     T + S        +  LKR+  P  +   
Sbjct: 26  VSINGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIES 85

Query: 66  LNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRL 125
           ++    EVD  K  ++  ++++ +DS  V+    +GS  + +L+ Y   G L D +N  L
Sbjct: 86  ISAAMKEVDNYKRFQSP-YIITLVDSQVVQE--KDGSKTLCILLPYFPLGSLQDMVNRNL 142

Query: 126 --QNRLSEAEILNILSQTAQGVANMH--------------------------------AL 151
                +SEAE + I+   A+G+  +H                                 L
Sbjct: 143 LKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDTPL 202

Query: 152 QPVLL------------HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQH 199
           +  +L            HRDI++ N+L S  G   + D GS C        + +L+ +Q 
Sbjct: 203 ELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQD 262

Query: 200 DILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK----TGEN--- 252
            +  N +  Y  PE+L++     ID K+DIW++G   Y + +  +PFE+    +G +   
Sbjct: 263 WVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTY 322

Query: 253 AILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           AI   K+ +P    YS+ L  +I+  L  +PT RP+I ELL+ +  +Q
Sbjct: 323 AIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 86/333 (25%), Positives = 149/333 (44%), Gaps = 57/333 (17%)

Query: 15  LTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSN-VACLKRVIVPTKS--GLNTLRA 71
           ++V  HR  IK+ L  GGF+ +Y VE       S+ N +  LK++  P  S   ++    
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVE-------SRENGLMALKKIRCPFGSIGSISPAMK 71

Query: 72  EVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQN--RL 129
           EVD  +  K+  ++   IDS  V+    +GS  V +L+ Y   G L D +N  L +  ++
Sbjct: 72  EVDNYQKFKSP-YIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQV 128

Query: 130 SEAEILNILSQTAQGVANMHALQPV-------------------LL-------------- 156
            E E++ +    A+G+  +H   P                    LL              
Sbjct: 129 PELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQA 188

Query: 157 --HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEM 214
             H DIK  N++ S  G   + D GS         ++Q L   Q    ++ T  +  PE+
Sbjct: 189 YAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEI 248

Query: 215 LDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK----TGEN---AILHSKFQYPAFPIY 267
           LD+     I EK D+W+ G  +Y +C+  +PFE+    +G +   ++   K+  P+   Y
Sbjct: 249 LDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNY 308

Query: 268 SDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           S  L ++++  L+ +P  RP++ EL+  +  +Q
Sbjct: 309 SSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/275 (27%), Positives = 127/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++    D ++   VA   +  + ++     L +E+   K + +  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHP-NIV 142

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            +ID       F + S  V +L+E C  G L++ +  R    LSE E+    +Q    + 
Sbjct: 143 QFID------CFEDDS-NVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+    N   K+ DFG          N+ E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS----KFQY 261
             Y  PE+L   + G   +   DIW+LGV LY L     PF+    N I        F +
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           P     SD  K LIR +LS +P +RP++ E+++ +
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 130/273 (47%), Gaps = 32/273 (11%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRH-- 84
           +L  GGFA+ + ++      ++   VA   ++ + ++   N L +E+   ++ KN RH  
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEI---QIHKNMRHQN 156

Query: 85  VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQG 144
           +V +ID       F +    V +L+E C  G L+D +  R    L+E E+    +Q    
Sbjct: 157 IVHFID------CFED-DINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGA 207

Query: 145 VANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKN 204
           + +MH+    ++HRD+K+ N+    +   K+ DFG +   I    N+ E  Y        
Sbjct: 208 LDHMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAIIN---NENERKYTIC----- 256

Query: 205 TTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFE----KTGENAILHSKFQ 260
            T  Y  PE++   + +    + DIW+LGV ++ +     PF+     T  + I H  + 
Sbjct: 257 GTPNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYS 316

Query: 261 YPAFPIYSDRLKNLIRVMLSENPTKRPNICELL 293
           +P     S  +K LI+ +LS NP +RP I E+L
Sbjct: 317 FPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 66/197 (33%), Positives = 96/197 (48%), Gaps = 27/197 (13%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L D + S+  +RL   E   + +Q    V   H L  V  HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLNCV--HRDLKLE 162

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDL--YRGL 221
           NVL   NG  KL DF    G+ R    +  L  V        T  Y  PEM+    Y G 
Sbjct: 163 NVLLDKNGNAKLTDF----GFTRESMTKAVLETVCG------TTVYMAPEMIQHKPYDGF 212

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRL-----KNLIR 276
            +    DIW+LGV LY L     PF++  ++ +L  +      P+  +R+     +NLI 
Sbjct: 213 KV----DIWSLGVILYTLLCGCLPFDE--DDDLLTKQKIINDTPVIDERITIPEAQNLIE 266

Query: 277 VMLSENPTKRPNICELL 293
            +LS++PT+RPN   +L
Sbjct: 267 QLLSKDPTERPNTSAIL 283

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 102/200 (51%), Gaps = 33/200 (16%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L +++   +Q+R+S  E   + +Q    V   H+LQ V  HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQCV--HRDLKLE 157

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDL--YRGL 221
           N+L    G  K+ DFG    + R    +  L  V        T  Y  PE+++   Y G 
Sbjct: 158 NILLDKKGRAKITDFG----FTRECATKTMLETVC------GTTVYMAPELIERKSYDGF 207

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAF---PIYSDRL-----KN 273
            ID    IW+LGV LY + + T PF++  E     +K ++      P Y+D +     K+
Sbjct: 208 KID----IWSLGVILYTMIHGTMPFDEEDE-----TKTKWKIINEEPFYNDDVVSKDAKD 258

Query: 274 LIRVMLSENPTKRPNICELL 293
           LI  +L ++P++RP + ++L
Sbjct: 259 LISQLLCKDPSQRPQLSQVL 278

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 91/331 (27%), Positives = 142/331 (42%), Gaps = 73/331 (22%)

Query: 13  TLLTVGTHRALIKKYLTSGGFAQIY-AVEITP---------VDTYSKSNVACLKRVIVP- 61
           T + VG+ R ++ K +  G FA ++ A  ITP         VD+ S +N  C    IVP 
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 62  ----TKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGL 117
                K  L  L  E+  +K + ++ H+V  ID       F   S +  L+MEYC  G L
Sbjct: 89  SKLKNKKLLENLEIEIAILKKI-SHPHIVKLID-------FERTSKDFYLIMEYCSLGDL 140

Query: 118 IDFMNSRLQ----------------------NRLSEAEILNILSQTAQGVANMHALQPVL 155
              +  R Q                      N L +A ILN L Q +  +  + +    L
Sbjct: 141 TFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN--L 198

Query: 156 LHRDIKIENVLRSG-----NGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQ-- 208
           +HRDIK +N+L S      N      D G V  Y  P     +  + +   L NT+    
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPNTSMAET 256

Query: 209 ------YRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQ-- 260
                 Y  PE+L+  +    + K+D+W++G  LY++CY   PF K   +  L+ K +  
Sbjct: 257 LCGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPF-KASNHLELYKKIKKA 312

Query: 261 -----YPAFPIYSDRLKNLIRVMLSENPTKR 286
                +P +    + LK+LI  +L+ +P +R
Sbjct: 313 NDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 128/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++      ++   VA L    + ++     L +E+   K +K+ ++VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKH-QNVV 142

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            +ID       F + +  V +L+E C  G L+D +  R    L+E E+    +Q    + 
Sbjct: 143 QFID------CFEDDT-NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+    N   K+ DFG          N +E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 242

Query: 207 AQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----SKFQYP 262
             Y  PE+L + +      + DIW++GV LY L     PF+    N I        F +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSFP 301

Query: 263 AFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
                S+  K LI+ +LS +P +RP+I E+++ +
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 146/333 (43%), Gaps = 61/333 (18%)

Query: 13  TLLTVGTHRALIKKYLTSGGFAQIYAVEI-----TPVDTYSKSNVACLKRVIVPTKSGLN 67
           T + V   R  I++ L  GG + +Y V++     +  ++ + + +  LK++I P+   ++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRL-- 125
               E++  K  ++  +V+  IDS  ++    +GS  + +++ Y   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQSP-YVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLSEAEILNILSQTAQGVANMH---------------------------------ALQ 152
              +SEAE + I+    +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 153 PVLL-----------HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDI 201
             +L           HRDI   N+L S +G   + D GS         N+ +LS +Q  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 LKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE-------NAI 254
             N T  Y  PE+L+L     +  K DIW++G   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 LHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRP 287
              K+ +P    +S+RL ++I+  +  +P +RP
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 128/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++    + ++   VA   +  + ++     L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            +ID       F + S  V +L+E C  G L++ +  R    L+E E+    +Q    + 
Sbjct: 143 QFID------CFEDDS-NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+    N   K+ DFG          N+ E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS----KFQY 261
             Y  PE+L   + G   +   DIW+LGV LY L     PF+    N I        F +
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           P     SD  K LIR +LS +P +RP++ E+++ +
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 128/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++    + ++   VA   +  + ++     L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            +ID       F + S  V +L+E C  G L++ +  R    L+E E+    +Q    + 
Sbjct: 143 QFID------CFEDDS-NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+    N   K+ DFG          N+ E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS----KFQY 261
             Y  PE+L   + G   +   DIW+LGV LY L     PF+    N I        F +
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           P     SD  K LIR +LS +P +RP++ E+++ +
Sbjct: 301 PRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 108/213 (50%), Gaps = 17/213 (7%)

Query: 100 NGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRD 159
           N  Y + ++MEYC GG   D + +  +  L+E ++  ++     G+  +HA   +  HRD
Sbjct: 82  NEDYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHAQHKI--HRD 139

Query: 160 IKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYR 219
           IK  N+L + +G  K+ DFG V   +R     +  ++V        T  +  PE++ +  
Sbjct: 140 IKAANILLTDSGLVKVADFG-VSAEMR--STMKAKTFV-------GTPYWMAPEVV-MNE 188

Query: 220 GLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQYPAF-PIYSDRLKNLIR 276
           G+  +EKSDIW+LG+  Y+L     P  K     ++ +  K + P     Y++ +K+ I 
Sbjct: 189 GMGYNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIA 248

Query: 277 VMLSENPTKRPNICELLEEISSIQGVPCPIQNF 309
             L ++P KRP+  ELLE    ++G P  ++N 
Sbjct: 249 TCLIKDPEKRPSASELLEHDFMVKG-PGNVENL 280

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 127/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++    + ++   VA   +  + ++     L +E+   K + +  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHP-NIV 142

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            ++D       F + S  V +L+E C  G L++ +  R    L+E E+    +Q    + 
Sbjct: 143 QFVD------CFEDDS-NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+    N   K+ DFG          N+ E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS----KFQY 261
             Y  PE+L   + G   +   DIW+LGV LY L     PF+    N I        F +
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           P     SD  K LIR +LS +P +RP++ E+++ +
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 83/339 (24%), Positives = 144/339 (42%), Gaps = 61/339 (17%)

Query: 13  TLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVAC-----LKRVIVPTKSGLN 67
           T + V   R  I++ L  GG + +Y V++       ++ VA      LK++I P    ++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  TLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRL-- 125
               E++  K  ++  +V+  IDS  ++    +GS  + +++ +   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQSP-YVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 126 QNRLSEAEILNILSQTAQGVANMH---------------------------------ALQ 152
              +SEAE + I+    +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PVLL-----------HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDI 201
             +L           HRDI   N+L S +G   + D GS         N+ +L  +Q  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 LKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE-------NAI 254
             N T  Y  PE+L L     +D K DIW+LG   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELL 293
              K+ +P    +S+ L ++I+  +  +P +RP   +LL
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 107/244 (43%), Gaps = 32/244 (13%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L    H  ++  +D       F +  Y  +    
Sbjct: 1214 ERILVDTWVRDRKLGTIPSEIQIMATLNKQPHENILRLLD------FFEDDDYYYIETPI 1267

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F    L+N ++E E+  I  Q   G+ ++H     ++HRDIK ENV+    
Sbjct: 1268 HGETGCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDAT 1325

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS       P           D+   T   Y  PE+L  D Y G P     D
Sbjct: 1326 GFVKLIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEGKP----QD 1370

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWA+G+ LY + +   PF    E  IL  +  +      S   K LI ++L+ N  KRP 
Sbjct: 1371 IWAIGILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPT 1428

Query: 289  ICEL 292
            I ++
Sbjct: 1429 IDDI 1432

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 128/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++      ++   VA   ++ + ++     L +E+   K +K++ ++V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHS-NIV 155

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            +ID       F + +  V +L+E C  G L+D +  R    L+E E+    +Q    + 
Sbjct: 156 QFID------CFEDDA-NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            +H+ +  ++HRD+K+ N+    +   K+ DFG          N +E  Y         T
Sbjct: 207 YLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA----NDRERKYTVCG-----T 255

Query: 207 AQYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----SKFQY 261
             Y  PE+L   + G   +   DIW++GV +Y L     PF+    N I       K+ Y
Sbjct: 256 PNYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLCKYGY 313

Query: 262 PAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           P     S   + LI  +LS NP +RP I ++++++
Sbjct: 314 PKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 117/243 (48%), Gaps = 40/243 (16%)

Query: 68  TLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQN 127
           T+  E++  KL+  +++++S ID   + +        + +++E C  G L D +  R + 
Sbjct: 95  TILKEIEIHKLVNGHKNIISMIDHFEIDAT-------MYMVLELCGAGSLYDII-CRSKR 146

Query: 128 RLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRP 187
            L E E   ++ Q    V  +H  +  ++H D+K+ N+L   +   +LCDFG        
Sbjct: 147 SLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH------- 197

Query: 188 PRNQQELSYVQHDILKNT-----TAQYRCPEMLDLY-----RGLPIDEKSDIWALGVFLY 237
                  S+V  DI  N+     T  Y  PE++  +     + L   ++SDIW++G+ LY
Sbjct: 198 -------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLY 250

Query: 238 KLCYYTTPFEKTG-----ENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICEL 292
            + +  TPFE T      EN I+  K+ +      S+++K LI+ +L   P +R  I E+
Sbjct: 251 AMIFDKTPFEATTLRSTYEN-IVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEI 309

Query: 293 LEE 295
           + +
Sbjct: 310 VSD 312

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 120/268 (44%), Gaps = 38/268 (14%)

Query: 34   AQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNA 93
             ++ AV+   V  YS  N A L        S +  LR+EV  +K L ++ ++V Y+    
Sbjct: 1198 GEMMAVKQVEVPKYSSQNEAIL--------STVEALRSEVSTLKDL-DHLNIVQYL---- 1244

Query: 94   VKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQP 153
                F N +    L +EY  GG +   +  R+  R  E  I ++ +Q  +G+A +H+   
Sbjct: 1245 ---GFENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHSKG- 1298

Query: 154  VLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPE 213
             +LHRD+K +N+L   +G  K+ DFG         R  +++ Y   D+    T  +  PE
Sbjct: 1299 -ILHRDMKADNLLLDQDGICKISDFGIS-------RKSKDI-YSNSDMTMRGTVFWMAPE 1349

Query: 214  MLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYP----AFP 265
            M+D  +G     K DIW+LG  + ++     P+      A +     SK   P      P
Sbjct: 1350 MVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLP 1407

Query: 266  IYSDRLKNLIRVMLSENPTKRPNICELL 293
            + S   +N +      NP KRP   ELL
Sbjct: 1408 LISQIGRNFLDACFEINPEKRPTANELL 1435

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 99/197 (50%), Gaps = 25/197 (12%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L D + S   +R+   E + + +Q   GV   H+L  V  HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLNCV--HRDLKLE 158

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDL--YRGL 221
           N+L   +G+ KL DF    G+ R    +  L  +        T  Y  PE+++   Y G 
Sbjct: 159 NILLDKSGDAKLTDF----GFTRECMTKTTLETI------CGTTVYMAPELIERKSYDGF 208

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGEN----AILHSKFQYPAFPIYSDRLKNLIRV 277
            I    DIW+LGV LY +   + PF++  E      I+H   Q     + +D  K+LI  
Sbjct: 209 KI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTAD-AKDLILR 263

Query: 278 MLSENPTKRPNICELLE 294
           +L++NP  RP + ++L+
Sbjct: 264 LLAKNPNDRPTVEQILK 280

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 84.7 bits (208), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 91/337 (27%), Positives = 142/337 (42%), Gaps = 68/337 (20%)

Query: 15  LTVGTHRALIKKYLTSGGFAQIYAVE-ITPVDTYS--KSNVACLKRVIVPTKSGLNTLRA 71
           L++   R  IKK L    F+ IY V+ I  V   S  ++N+  LKR+  P       + +
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCP----FGNIES 81

Query: 72  EVDAMKLLKNNR-----HVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQ 126
              AMK + N +     +++  +DS   +    +GS  V +L+ Y   G L D  +  L 
Sbjct: 82  ISGAMKEVDNYKRFQSPYIIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNLL 139

Query: 127 NR--LSEAEILNILSQTAQGVANMH--------ALQ----------------------PV 154
           N   +SEAE + I+   A+G+  +H        A Q                      P+
Sbjct: 140 NGTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPL 199

Query: 155 LL---------------HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQH 199
            L               HRDIK  N+L S +G   + + GS            +L+ +Q 
Sbjct: 200 ELDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQA 259

Query: 200 DILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK----TGEN--- 252
            +  + T  Y  PE+L +     +D K DIW+LG   Y + +  +PFE+    +G +   
Sbjct: 260 WVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKY 319

Query: 253 AILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNI 289
           AI    F +P+   YS+ L  LI   L  NP  RP+I
Sbjct: 320 AIGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 98/195 (50%), Gaps = 25/195 (12%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           V +++EYC G  L + +    + RLS  E   + SQ A  V   H L+ V  HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHELKCV--HRDLKLEN 158

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD--LYRGLP 222
           VL  GNG  KL DF    G+ R    + +L  +        T  Y  PE+++   Y G  
Sbjct: 159 VLLDGNGHAKLTDF----GFTREMATRSQLETI------CGTTVYMAPELIERKCYDGFK 208

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFEKTGEN----AILHSKFQYPAFPIYSDRLKNLIRVM 278
           +    DIW+LG+ LY +     PF++  +      I++ +  +    I  D + +LI+ M
Sbjct: 209 V----DIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAI-DLIQGM 263

Query: 279 LSENPTKRPNICELL 293
           L +NP +R ++ ++L
Sbjct: 264 LRKNPNERISLAQVL 278

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 99/196 (50%), Gaps = 25/196 (12%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L D + S   +R+S  E   + +Q +  V   H++  V  HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQISGAVYYAHSMHCV--HRDLKLE 161

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD--LYRGL 221
           N+L   NG  KL DF    G+ R    +  L  V        T  Y  PE+++   Y G 
Sbjct: 162 NILLDKNGNAKLTDF----GFTRECMTKTTLETV------CGTTVYMAPELIERRTYDGF 211

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGE----NAILHSKFQYPAFPIYSDRLKNLIRV 277
            I    DIW+LGV LY L   + PF+   E      I++ +  Y +  I  D  K+LI  
Sbjct: 212 KI----DIWSLGVILYTLITGSLPFDDDDEVKTKWKIVNEEPNYDSTLI-PDDAKDLISR 266

Query: 278 MLSENPTKRPNICELL 293
           +L++NP +RP++ ++L
Sbjct: 267 LLAKNPKERPSLPQVL 282

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 130/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRH-- 84
           +L  GGFA+ + ++      ++   VA   ++ + ++     L +E+   ++ K+ RH  
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEI---QIHKSMRHFN 149

Query: 85  VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQG 144
           VV +ID       F + +  V +L+E C  G L++ +  R    ++E E+   ++Q    
Sbjct: 150 VVQFID------CFEDDT-NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGA 200

Query: 145 VANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKN 204
           +  MH+ +  ++HRD+K+ N+    N   K+ DFG          N +E  Y        
Sbjct: 201 IKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA----NDRERKYTV-----C 249

Query: 205 TTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQ 260
            T  Y  PE+L + +      + DIW++GV +Y L     PF+    N I     +  F 
Sbjct: 250 GTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDFA 308

Query: 261 YPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           +P     S+  K LI  +LS +P +RP+I E+++ +
Sbjct: 309 FPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/329 (24%), Positives = 138/329 (41%), Gaps = 61/329 (18%)

Query: 17  VGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVA-----CLKRVIVPTKSGLNTLRA 71
           V   R  I++ L  GG + +Y V+++       + +A      LK++I P+   ++    
Sbjct: 25  VNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMR 84

Query: 72  EVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRL--QNRL 129
           E++  K  ++  +V+  IDS  ++    +GS  + +++ Y   G L D +N RL     +
Sbjct: 85  EIENYKRFQSP-YVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEGTFV 141

Query: 130 SEAEILNILSQTAQGVANMH---------------------------------------- 149
           SEAE + I+    +G+  +H                                        
Sbjct: 142 SEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDML 201

Query: 150 ----ALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNT 205
               A      HRDI   N+L S +G   + D GS         N+ +LS +Q  +  N 
Sbjct: 202 SSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNC 261

Query: 206 TAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE-------NAILHSK 258
           T  Y  PE+L+L     +  K DIW+LG   Y L +  +PFE+  +        AI   K
Sbjct: 262 TLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGK 321

Query: 259 FQYPAFPIYSDRLKNLIRVMLSENPTKRP 287
           + +P    +S+ L ++I+  +  +P +RP
Sbjct: 322 YSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 113/245 (46%), Gaps = 34/245 (13%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH----VVSYIDSNAVKSAFNNGSYEVLLL 108
            +R++V T      L T+ +E+  M  L  N+H    +++ ID       F +  Y  +  
Sbjct: 1036 ERILVDTWVRDRKLGTIPSEIQIMAAL--NKHPDGNILTLID------FFEDDDYYYIET 1087

Query: 109  MEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRS 168
              + E G +  F    L+  ++E E   I  Q    + ++H+    ++HRDIK ENV+  
Sbjct: 1088 PVHGETGCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHSQG--IVHRDIKDENVVVD 1145

Query: 169  GNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEK-S 227
              G  KL DFGS       P           D+   T   Y  PE+L    G P D K  
Sbjct: 1146 SKGFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQ 1191

Query: 228  DIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRP 287
            DIWA+GV LY + +   PF    E  IL    ++      S+   NLI+++L++NP++RP
Sbjct: 1192 DIWAIGVLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRP 1249

Query: 288  NICEL 292
             I E+
Sbjct: 1250 TIDEV 1254

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 100/201 (49%), Gaps = 33/201 (16%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L D++   +  R+   E   + +Q    V   H+L  V  HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLNCV--HRDLKLE 157

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGL 221
           N+L    G  KL DF    G+ R    + +L  +        T  Y  PE+L  D Y G 
Sbjct: 158 NILLDMQGNAKLADF----GFTRECATKNQLETIC------GTTVYMAPELLRRDTYDGF 207

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAF---PIYSDRLKN----- 273
            I    DIW+LGV LY L   + PF++  E     ++ ++      P Y++++ N     
Sbjct: 208 KI----DIWSLGVILYTLINGSMPFDEEDE-----TRTEWKIINEEPDYNEKIFNANSIE 258

Query: 274 LIRVMLSENPTKRPNICELLE 294
           LI+ +L ++P KRP++ E+L+
Sbjct: 259 LIKSLLIKDPKKRPSMTEILK 279

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 121/277 (43%), Gaps = 38/277 (13%)

Query: 34   AQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNA 93
             ++ AV+   V  YS  N A L        S +  LR+EV  +K L ++ ++V Y+    
Sbjct: 1198 GEMMAVKQVEVPKYSSQNEAIL--------STVEALRSEVSTLKDL-DHLNIVQYL---- 1244

Query: 94   VKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQP 153
                F N      L +EY  GG +   +  R+  R  E  I ++ +Q  +G+A +H+   
Sbjct: 1245 ---GFENKDNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHSKG- 1298

Query: 154  VLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPE 213
             +LHRD+K +N+L   +G  K+ DFG         R  +++ Y   D+    T  +  PE
Sbjct: 1299 -ILHRDMKADNLLLDQDGICKISDFGIS-------RKSKDI-YSNSDMTMRGTVFWMAPE 1349

Query: 214  MLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYP----AFP 265
            M+D  +G     K DIW+LG  + ++     P+      A +     SK   P      P
Sbjct: 1350 MVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLP 1407

Query: 266  IYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQGV 302
            + S   +  +      NP KRP   ELL    S+  V
Sbjct: 1408 LISQVGRGFLDACFEINPEKRPTATELLSHRFSVVNV 1444

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 127/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++      ++   VA L    + T+     L +E+   K +++  ++V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMRHA-NIV 161

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            +ID       F + +  V +L+E C  G L++ +  R    L+E E+    +Q   G+ 
Sbjct: 162 QFID------CFEDET-NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+    N   K+ DFG          N +E  Y         T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 261

Query: 207 AQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----SKFQYP 262
             Y  PE+L + +      + DIW++GV +Y L     PF+    N I        F +P
Sbjct: 262 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFP 320

Query: 263 AFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
                S   + L++ +LS +P +RP+I E+L+ +
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 130/282 (46%), Gaps = 34/282 (12%)

Query: 20  HRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLL 79
           HR +   +L  GGFA+ + ++      ++   VA   ++ + ++     L +E+   K +
Sbjct: 74  HRGM---FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM 127

Query: 80  KNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILS 139
           K+  ++V + D       F + +  V +L+E C  G L+D +  R Q  L+E E+    +
Sbjct: 128 KHP-NIVQFTD------CFEDDT-NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTT 177

Query: 140 QTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQH 199
           Q    +  MH+ +  ++HRD+K+ N+    +   K+ DFG          N +E  Y   
Sbjct: 178 QIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA----NDRERKYTI- 230

Query: 200 DILKNTTAQYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH-- 256
                 T  Y  PE+L   + G   +   DIW++GV +Y L     PF+    N I    
Sbjct: 231 ----CGTPNYIAPEVLTGKHTGHSFE--VDIWSIGVMIYALLIGKPPFQAKEVNTIYERI 284

Query: 257 --SKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
               F +P     S   K LI+ +LS +P +RP++ E++E +
Sbjct: 285 KVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 97/195 (49%), Gaps = 23/195 (11%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V +  EYC G  L D + S LQ R+  +  + + +Q    V   H+L  V  HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHVLS-LQ-RVPSSACIELFTQIVGAVYYAHSLNCV--HRDLKLE 158

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGL 221
           N+L   NG  KL DF    G+ R    +  L  +        T  Y  PE++  + Y G 
Sbjct: 159 NILLDKNGNAKLTDF----GFTRECMTKTSLETIC------GTTVYMAPELIKRESYDGF 208

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKF-QYPAF--PIYSDRLKNLIRVM 278
            I    DIW+LGV LY +   + PF++  E         + P F   I S+  K+L+  +
Sbjct: 209 KI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLIKL 264

Query: 279 LSENPTKRPNICELL 293
           LS++P +RP++ E+L
Sbjct: 265 LSKDPNERPSMQEIL 279

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 127/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++      ++   VA   ++ + T+     L +E+   K +K+  ++V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKHP-NIV 152

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            ++D       F + +  V +L+E C  G L+D M  R    L+E E+    +Q    V 
Sbjct: 153 HFVD------CFEDDT-NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+    +   K+ DFG          N +E  Y         T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA----NNRERKYTV-----CGT 252

Query: 207 AQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----SKFQYP 262
             Y  PE+L + +      + DIW++GV +Y L     PF+    N I       ++ YP
Sbjct: 253 PNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYP 311

Query: 263 AFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
                S   K LI  +L  +P +RP+I E+++++
Sbjct: 312 KDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 126/274 (45%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + +       ++   VA   ++ + ++     L +E+   K +K+  ++V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-VNIV 155

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            +ID       F + +  V +L+E C  G L+D +  R    L+E E+    +Q    + 
Sbjct: 156 QFID------CFEDDT-NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+        K+ DFG          N +E  Y         T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLA----NDRERKYTV-----CGT 255

Query: 207 AQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----SKFQYP 262
             Y  PE+L + +      + DIW++GV +Y L     PF+    N I        F +P
Sbjct: 256 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFSFP 314

Query: 263 AFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
              + S   K LI+ +LS +P +RP++ E+++ I
Sbjct: 315 KDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 124/274 (45%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ +         ++   VA L    + ++     L +E+   K +KN  ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKN-VNIV 143

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            +ID       F + +  V +L+E C  G L+D +  R    L+E E+    +Q    + 
Sbjct: 144 QFID------CFEDDT-NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+    +   K+ DFG          N +E  Y         T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 243

Query: 207 AQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----SKFQYP 262
             Y  PE+L + +      + DIW++GV LY L     PF+    N I        F +P
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 263 AFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
                S   K LI+ +LS +P +RP++ E+++ +
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 110/244 (45%), Gaps = 32/244 (13%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L    H  ++  +D       F +  Y  +    
Sbjct: 987  ERILVDTWVRDRKLGTIPSEIQIMATLNAKPHENILMLLD------FFEDDDYYYIETAV 1040

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            +   G +  F    ++  ++E E + I  Q A G+ N+H     ++HRDIK ENV+   N
Sbjct: 1041 HGTSGSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCN 1098

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  K+ DFGS       P           D+   T   Y  PE+L  + Y G P     D
Sbjct: 1099 GFVKIVDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QD 1143

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWA+GV LY + Y   PF    E  IL +  +  +    SD    LIR +L+ + +KRP+
Sbjct: 1144 IWAIGVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPS 1201

Query: 289  ICEL 292
            I E+
Sbjct: 1202 IDEI 1205

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 120/268 (44%), Gaps = 38/268 (14%)

Query: 34   AQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNA 93
             ++ AV+   V  YS  N A L  V          LR+EV  +K L ++ ++V Y+    
Sbjct: 1201 GEMMAVKQVEVPKYSSQNEAILGTV--------EALRSEVSTLKDL-DHLNIVQYL---- 1247

Query: 94   VKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQP 153
                F N +    L +EY  GG +   +  R+  R  E+ I ++ +Q  +G+A +H+   
Sbjct: 1248 ---GFENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLKGLAYLHSKG- 1301

Query: 154  VLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPE 213
             +LHRD+K +N+L   +G  K+ DFG         R  +++ Y   D+    T  +  PE
Sbjct: 1302 -ILHRDMKADNLLLDQDGICKISDFGIS-------RKSKDI-YSNSDMTMRGTVFWMAPE 1352

Query: 214  MLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYP----AFP 265
            M+D  +G     K DIW+LG  + ++     P+      A +     SK   P      P
Sbjct: 1353 MVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLP 1410

Query: 266  IYSDRLKNLIRVMLSENPTKRPNICELL 293
            + S   ++ +      NP +RP   ELL
Sbjct: 1411 LISQVGRSFLDACFEINPEERPTATELL 1438

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 143/315 (45%), Gaps = 63/315 (20%)

Query: 44  VDTYSKSNVACLKRVIVP---TKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNN 100
           +D Y +     +++++ P    +S  N L+ E+D  +  K+  +++  +DS  ++    +
Sbjct: 77  IDGYDEPTDMVVRQIMCPFGDIESVSNALK-EIDNYRYFKS-PYIMQCLDSQVIQR--RD 132

Query: 101 GSYEVLLLMEYCEGGGLIDFMNSRLQN--RLSEAEILNILSQTAQGVANMH--------- 149
           GS  VL+L+ Y   G L D ++  L +  R+SE+E++ ++  T +G+  +H         
Sbjct: 133 GSKTVLILLPYLPLGSLRDAIDRNLLDGIRMSESEVIRVMIGTCRGLLYLHDPTSRGNLG 192

Query: 150 -ALQP----------------VLL---------------------HRDIKIENVLRSGNG 171
            ++ P                +LL                     H +IK  N+L S +G
Sbjct: 193 SSMGPQNGMDAVSMTLSDDAAMLLDGTPFEMDMLSSHSMKMDSYAHMNIKPSNILFSSDG 252

Query: 172 EFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWA 231
              + + GS+        N + L  ++    ++ T  Y  PE+L+L  G  +D   DIW+
Sbjct: 253 LPVITELGSLQKLDLKIENVKMLKSIKEWTEEHCTVYYMPPELLNLKVGTVLDCSVDIWS 312

Query: 232 LGVFLYKLCYYTTPFEKTGE-------NAILHSKFQYPAFPIYSDRLKNLIRVMLSENPT 284
           LG  LY L +  +PF++  +         I  +++ +P   +YS +L ++I   L  NPT
Sbjct: 313 LGCTLYTLLFGISPFKREEQVNEVPLKYGISKARYSFPEGHVYSKKLVSVIETCLQVNPT 372

Query: 285 KRPNICELLEEISSI 299
            RP + ELL ++  I
Sbjct: 373 MRPTVNELLGQLQDI 387

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 130/281 (46%), Gaps = 32/281 (11%)

Query: 20  HRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLL 79
           HR    ++L  GGFA+ + ++      ++   VA   ++ + ++     L +E+   K +
Sbjct: 82  HRG---QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM 135

Query: 80  KNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILS 139
            +  ++V +ID       F + +  V +L+E C  G L++ +  R    ++E E+   ++
Sbjct: 136 SHT-NIVQFID------CFED-NVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMT 185

Query: 140 QTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQH 199
           Q   G+  MH+ +  ++HRD+K+ N+    +   K+ DFG          N +E  +   
Sbjct: 186 QICGGIQYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFGLAAVLA----NDRERKFTI- 238

Query: 200 DILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL---- 255
                 T  Y  PE+L + +      + DIW++GV LY L     PF+    N I     
Sbjct: 239 ----CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIK 293

Query: 256 HSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
              F YP     S   K LI  +LS NP +RP+I E+++ +
Sbjct: 294 QRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 127/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + +       ++   VA L    + T+     L +E+   K +K+ +++V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMKH-QNIV 205

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            +ID       F + +  V +L+E C  G L++ +  R Q  L+E E+    +Q    + 
Sbjct: 206 QFID------CFEDDT-NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+    N   K+ DFG          N +E  +         T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLA----NDRERKFTV-----CGT 305

Query: 207 AQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----SKFQYP 262
             Y  PE+L + +      + D+W++GV +Y L     PF+    N I        F +P
Sbjct: 306 PNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFIFP 364

Query: 263 AFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
                S   K L++ +LS +P +RP+I E+++ +
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 82.0 bits (201), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 79/333 (23%), Positives = 137/333 (41%), Gaps = 61/333 (18%)

Query: 13  TLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVA-----CLKRVIVPTKSGLN 67
           T + V   R  I++ L  GG + +Y V++       ++ +       LK++I P+   ++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  TLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRL-- 125
               E++  K  ++  +V+  IDS   +    NGS  + +++ Y   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQSP-YVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLSEAEILNILSQTAQGVANMH------------------------------------ 149
              +SEAE + I+    +G+  +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 150 --------ALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDI 201
                   A      HRDI   N+L S  G   + D GS         ++ +LS +Q  +
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 202 LKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE-------NAI 254
             N T  Y  PE+L+L     +  K DIW++G   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRP 287
              K+ +P    +S+ L N+I+  +  +P +RP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 117/233 (50%), Gaps = 35/233 (15%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K ++H  +V++IDS  +K        ++ ++MEY EGG L D +   +   L+
Sbjct: 666 INEILVMKGSKHQNIVNFIDSYVLKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 715

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           EA+I  +  +T +G+  +H+    ++HRDIK +N+L S NGE KL DFG  C  I     
Sbjct: 716 EAQIGAVCRETLRGLQFLHSKG--VIHRDIKSDNILLSMNGEIKLTDFG-FCAQI----- 767

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTG 250
             E++  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+    
Sbjct: 768 -NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 821

Query: 251 ENAILH-------SKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
               L+        K + P   + S  LK+ +   L+ NP  R +  ELL ++
Sbjct: 822 PLRALYLIATNGTPKLKEPE--VLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 131/284 (46%), Gaps = 38/284 (13%)

Query: 20  HRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLL 79
           HR +   +L  GGFA+ + ++      ++   VA   ++ + ++     L +E+   ++ 
Sbjct: 74  HRGM---FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEI---QIH 124

Query: 80  KNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNI 137
           K+ RH  +V + D       F + +  V +L+E C  G L+D +  R Q  L+E E+   
Sbjct: 125 KSMRHPNIVQFTD------CFEDDT-NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFF 175

Query: 138 LSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYV 197
            +Q    +  MH+ +  ++HRD+K+ N+    +   K+ DFG          N +E  Y 
Sbjct: 176 TTQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA----NDRERKYT 229

Query: 198 QHDILKNTTAQYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH 256
                   T  Y  PE+L   + G   +   D+W++GV +Y L     PF+    N I  
Sbjct: 230 I-----CGTPNYIAPEVLTGKHTGHSFE--VDVWSIGVMIYALLIGKPPFQAKEVNTIYE 282

Query: 257 ----SKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
                 F +P     S   K LI+ +LS +P +RP++ E++E +
Sbjct: 283 RIKVCDFNFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 113/241 (46%), Gaps = 37/241 (15%)

Query: 62  TKSGLN--TLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLID 119
           T S LN   +  E+  MKL       +S+ +   +   + N S E+ L++EY +GG L D
Sbjct: 164 TDSALNPYGIEREIVIMKL-------ISHPNVMGLLEVWENKS-ELYLVLEYVDGGELFD 215

Query: 120 FMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN-VLRSGNGEFKLCDF 178
           ++ S+   +LSE E ++  +Q  QGV+  H+    + HRD+K EN +L   N   K+ DF
Sbjct: 216 YLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPENLLLDKKNKVIKIADF 271

Query: 179 GSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSDIWALGVFL 236
           G     +  P    E S          +  Y  PE++    Y G P    SD+W+ G+ L
Sbjct: 272 G--MAALELPNKLLETSC--------GSPHYASPEIVMGKPYHGGP----SDVWSCGIIL 317

Query: 237 YKLCYYTTPFEKTGENAIL----HSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICEL 292
           + L     PF       +L      +FQ P  P  ++  K+LI  +L  NP KR  I E+
Sbjct: 318 FALLTGHLPFNDDNIKKLLLKVQAGRFQLP--PYLTNDAKDLITRILVTNPEKRLTINEI 375

Query: 293 L 293
           L
Sbjct: 376 L 376

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 98/199 (49%), Gaps = 31/199 (15%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           V + +EYC G  L D++   L+ R+   E   + +Q    V   H+LQ V  HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQCV--HRDLKLEN 158

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLP 222
           +L   NG   L DF    G+ R    + +L  V        T  Y  PE++  + Y G  
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETV------CGTTVYMAPELIKREAYDGYK 208

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFE-----KTGENAILHSKFQYPAF--PIYSDRLKNLI 275
           +    D W+LG+ LY + +   PF+     +TG   I+H +   PA      S + K+LI
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLK-IMHEE---PAVLDEYTSPQAKDLI 260

Query: 276 RVMLSENPTKRPNICELLE 294
             +L +N  +RPN+ E+L+
Sbjct: 261 VRLLDKNAAQRPNLNEVLQ 279

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 114/248 (45%), Gaps = 32/248 (12%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVK--SAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M +L  N+H     D N ++    F +  Y  +    
Sbjct: 1011 ERILVDTWVRDRKLGTIPSEIQIMAVL--NKHP----DENILRLLDFFEDDDYYYIETPV 1064

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F    L+  ++E E   I  Q   G+ ++H  +  ++HRDIK ENV+    
Sbjct: 1065 HGETGSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSK 1122

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS       P           D+   T   Y  PE+L  + Y G P     D
Sbjct: 1123 GFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QD 1167

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWA+G+ LY + +   PF    E  I+    ++      S+   NLI+ +L++N  KRP 
Sbjct: 1168 IWAVGILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPT 1225

Query: 289  ICELLEEI 296
            I ++ +++
Sbjct: 1226 IQDIYDDV 1233

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 124/271 (45%), Gaps = 44/271 (16%)

Query: 34   AQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNA 93
             ++ AV+   V  YS  N A L        S +  LR+EV  +K L ++ ++V Y+    
Sbjct: 1204 GEMMAVKQVEVPKYSSQNEAIL--------STVEALRSEVSTLKDL-DHLNIVQYL---- 1250

Query: 94   VKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQP 153
                F N +    L +EY  GG +   +  R+  R  E+ I ++ +Q  +G+A +H+   
Sbjct: 1251 ---GFENKNSIYSLFLEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLRGLAYLHSKG- 1304

Query: 154  VLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPE 213
             +LHRD+K +N+L   +G  K+ DFG         R  +++ Y   D+    T  +  PE
Sbjct: 1305 -ILHRDMKADNLLLDQDGICKISDFGIS-------RKSKDI-YSNSDMTMRGTVFWMAPE 1355

Query: 214  MLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQY----PAFPIYSD 269
            M+D  +G     K DIW+LG  + ++     P+       ++ + F+      A PI  D
Sbjct: 1356 MVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNL---EVVAAMFKIGKSKSAPPIPED 1410

Query: 270  RLKNLIRVMLSE-------NPTKRPNICELL 293
             L  + RV  S        +P KRP   +LL
Sbjct: 1411 TLPLITRVGRSFLDACFEIDPEKRPTATKLL 1441

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/317 (26%), Positives = 139/317 (43%), Gaps = 57/317 (17%)

Query: 7   PLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGL 66
           P     TL    + R  + K + SG  A   A++I P     K NV   ++ +     G+
Sbjct: 60  PWKLGKTLGKGSSGRVRLAKNMQSGKLA---AIKIVP-----KRNVRHNQKQVTALPYGI 111

Query: 67  NTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQ 126
                E+  MKL       +++ +  A+   + N S E+ L++EY EGG L D++ +R  
Sbjct: 112 ---EREIIIMKL-------ITHPNIMALYEVWENKS-ELYLVLEYVEGGELFDYLIAR-- 158

Query: 127 NRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN-VLRSGNGEFKLCDFGSVCGYI 185
            +L E E ++   Q  QGV+  H     + HRD+K EN +L   N   K+ DFG      
Sbjct: 159 GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPENLLLDKKNKTVKIADFGMAA--- 213

Query: 186 RPPRNQQELSYVQHDILKNT--TAQYRCPE--MLDLYRGLPIDEKSDIWALGVFLYKLCY 241
                        + +L+ +  +  Y  PE  M   Y G P    SD+W+ G+ L+ L  
Sbjct: 214 ---------LETTNRLLETSCGSPHYASPEIVMGQKYHGSP----SDVWSCGIILFALLT 260

Query: 242 YTTPFEKTGENAIL----HSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEIS 297
              PF       +L    H ++Q P+    S   K+LI  +L  +P KR  + ++LE   
Sbjct: 261 GHLPFNDDNVRKLLLKVQHGRYQMPSN--VSKEAKDLISKILVVDPEKRITVDKILEHPL 318

Query: 298 SIQ-------GVPCPIQ 307
            ++       G+ CP++
Sbjct: 319 LVKYDNPGKGGLACPLE 335

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 118/254 (46%), Gaps = 29/254 (11%)

Query: 47  YSKSNVACLKRVI--VPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYE 104
           Y K+N  C  +V+        +  ++ EV  +  LK   ++  Y       S  NN   E
Sbjct: 38  YIKTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHY-----YGSYLNN--TE 90

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++MEYC GG L   +      ++ E  I  I+ +    +A MH  +  ++HRDIK  N
Sbjct: 91  LWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMHIHKDGVIHRDIKAAN 145

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPID 224
           VL + +G  KLCDFG      +    +Q ++          T  +  PE+  +  G+  D
Sbjct: 146 VLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEV--IMEGVYYD 194

Query: 225 EKSDIWALGVFLYKLCYYTTPF-EKTGENAI-LHSKFQYPAFP--IYSDRLKNLIRVMLS 280
            K DIW+LG+  Y++     P+ +     A+ L +K + P      +S  LK  I + L 
Sbjct: 195 TKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRQHSSALKEFIALCLD 254

Query: 281 ENPTKRPNICELLE 294
           E+P +RP+  ELL+
Sbjct: 255 EDPKERPSAEELLK 268

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 97/196 (49%), Gaps = 25/196 (12%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V +++EYC    L D++ S+   R+S  E   I +Q    V   H+L  V  HRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSLSCV--HRDLKLE 159

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGL 221
           N+L   +   KL DFG    + +           Q + +  TT  Y  PE+L  + Y G 
Sbjct: 160 NILLDKDNNAKLTDFGFTRDFSKN---------TQLETICGTTV-YMAPELLRREKYDGY 209

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFE----KTGENAILHSKFQYPAFPIYSDRLKNLIRV 277
            I    DIWALG+ LY +   T PF+    K  E  I+ +   Y     ++D   +L+  
Sbjct: 210 KI----DIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDN-KYFNDDSIDLVNR 264

Query: 278 MLSENPTKRPNICELL 293
           +LS++P+ RP I ++L
Sbjct: 265 LLSKDPSMRPTIEQIL 280

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 123/278 (44%), Gaps = 35/278 (12%)

Query: 24  IKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNR 83
           IK+ +  G F  +Y      +D  +K  VA     +  +   ++ L  E+  +  LK++ 
Sbjct: 18  IKECVGRGNFGDVYKA----IDNITKKYVAIKVINLEYSDEDIDLLAQEIFFLAELKSD- 72

Query: 84  HVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQ 143
           ++++YI +             + ++M+YC GG   D +     N + E ++  I+     
Sbjct: 73  YIINYITTIM-------EDVSMWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLL 125

Query: 144 GVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           G+  +H  + +  HRDIK  N+L + +G+ KL DFG V G I+    +            
Sbjct: 126 GLQYLHEQKKI--HRDIKAANILLTDDGQVKLGDFG-VSGQIKATLKRDTFV-------- 174

Query: 204 NTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS------ 257
             T  +  PE+++       DEK DIW+LG+  Y+L     P  K     ++ S      
Sbjct: 175 -GTPYWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKP 233

Query: 258 -KFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLE 294
            K   P    Y+D  K+ I   L ++P  RPN+  LL+
Sbjct: 234 PKLHGP----YNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 93/197 (47%), Gaps = 24/197 (12%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++MEYC GG   D +     N + E ++  I SQ  +G+  +H  + +  HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHEQKKI--HRDIKAAN 143

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML----DLYRG 220
           +L +  G  KL DFG V G IR    +              T  +  PE++    D Y  
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRATLKRGTFV---------GTPYWMAPEVVSKENDGY-- 191

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQYPAF-PIYSDRLKNLIRV 277
              DEK+DIW+LG+ +Y+L     P  K     ++ +  K + PA    YS   KN +  
Sbjct: 192 ---DEKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGHYSHSAKNFVSS 248

Query: 278 MLSENPTKRPNICELLE 294
            L +NP  R +  E++E
Sbjct: 249 CLVKNPVGRASAYEMVE 265

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 99/198 (50%), Gaps = 29/198 (14%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L + +   + +R+   E   + +Q    V   H+L  V  HRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSLNCV--HRDLKLE 157

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGL 221
           N+L   NG  KL DF    G+ R   ++  L  +        T  Y  PE++    Y G 
Sbjct: 158 NILLDKNGNAKLTDF----GFTRECVSKSSLETI------CGTTVYMAPELIQRQAYDGF 207

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQ-YPAFPIYSDRL-----KNLI 275
            I    DIW+LGV LY +   T PF++  E     +K++    FP ++D       K+LI
Sbjct: 208 KI----DIWSLGVILYTMINGTMPFDEDDETK---TKWKIVNDFPNFNDNFVSHEAKDLI 260

Query: 276 RVMLSENPTKRPNICELL 293
           + +L++ P++RP + ++L
Sbjct: 261 KRLLAKCPSERPTMEQIL 278

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 127/283 (44%), Gaps = 36/283 (12%)

Query: 19  THRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKL 78
            H  ++K+ +  G F  +Y      +D  +   VA     +  T   L  L  E+  +  
Sbjct: 19  AHNYIVKECVGRGNFGDVYRA----IDRTTNKVVAIKVVDLENTNERLEVLAQEIFFLAE 74

Query: 79  LKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNIL 138
           LK+  ++++YI +        + S  + ++MEYC GG   D +     N L E ++  I 
Sbjct: 75  LKSP-YIINYITT-----LLEDAS--MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYIT 126

Query: 139 SQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQ 198
            +  +G+  +H  + +  HRDIK  N+L +  G  KL DFG V G ++    +  +    
Sbjct: 127 REILKGLQYLHEQKKI--HRDIKAANILLTEEGHVKLGDFG-VSGQLKSTLRRGTIV--- 180

Query: 199 HDILKNTTAQYRCPEM----LDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAI 254
                  T  +  PE+    ++ Y     DEK DIW+LG+ +++L     P  K     +
Sbjct: 181 ------GTPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLKGVPPLVKLDPIRV 229

Query: 255 LH--SKFQYPAFP-IYSDRLKNLIRVMLSENPTKRPNICELLE 294
           L   S+   P     YSD  K+ + + L +NP +RP   +LL+
Sbjct: 230 LANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 91/198 (45%), Gaps = 21/198 (10%)

Query: 98   FNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLH 157
            F +  Y  + L  + E G +  F    L+  ++E E   I  Q   G+  +H     ++H
Sbjct: 870  FEDDDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVH 927

Query: 158  RDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML-- 215
            RDIK ENV+   NG  KL DFGS       P       +V        T  Y  PE+L  
Sbjct: 928  RDIKDENVIVDSNGFVKLIDFGSAAYTKTGPFE----VFVG-------TIDYAAPEILGG 976

Query: 216  DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLI 275
            + Y+G P     DIWALGV LY L Y   PF    E  IL  + ++      +    +LI
Sbjct: 977  NPYKGKP----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLI 1030

Query: 276  RVMLSENPTKRPNICELL 293
            R +L+++   RP+I E++
Sbjct: 1031 RWILTKSVNDRPSIDEIV 1048

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 101/199 (50%), Gaps = 29/199 (14%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L D +      R+  AE   + +Q    V   H+L  V  HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHL--LFSKRIPIAECTELFAQIVGAVYYAHSLNCV--HRDLKLE 161

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDL--YRGL 221
           N+L   +G  KL DFG    + R    +  L  V        T  Y  PE+++   Y G 
Sbjct: 162 NILLDKHGRAKLTDFG----FTRECMTRSTLETVC------GTTVYMAPELIERKSYDGF 211

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQY----PAFP--IYSDRLKNLI 275
            ID    IWALGV LY + Y   PF++  E   + +K++     P F   I S+ +K+LI
Sbjct: 212 KID----IWALGVILYTMIYGAMPFDEDDE---VKTKWKIVNEDPDFTNNISSNDVKDLI 264

Query: 276 RVMLSENPTKRPNICELLE 294
           + +L ++PT+RP I E+L+
Sbjct: 265 KKLLKKDPTERPTIREILK 283

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 97/196 (49%), Gaps = 25/196 (12%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L D + S   +R+S  E   + +Q +  V   H++  V  HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECGELFAQISGAVYYAHSMHCV--HRDLKLE 161

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGL 221
           N+L   NG  KL DF    G+ R    +  L  V        T  Y  PE++    Y G 
Sbjct: 162 NILLDKNGNAKLTDF----GFTRECMTKTTLETV------CGTTVYMAPELIGRKTYDGF 211

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGEN----AILHSKFQYPAFPIYSDRLKNLIRV 277
            I    D W+LGV LY L   + PF+   E      I++ + +Y    +  D  K+LI  
Sbjct: 212 KI----DTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDP-KLIPDDAKDLISR 266

Query: 278 MLSENPTKRPNICELL 293
           +L++NP +RP++ ++L
Sbjct: 267 LLAKNPGERPSLPQVL 282

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 115/235 (48%), Gaps = 39/235 (16%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K ++H  +V++IDS  +         ++ ++MEY EGG L D +   +   L+
Sbjct: 670 INEILVMKGSKHPNIVNFIDSYLLDG-------DLWVIMEYMEGGSLTDVVTHCI---LT 719

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T  G+  +H+    +LHRDIK +N+L S NG  KL DFG  C        
Sbjct: 720 EGQIGAVCRETLSGLQFLHSKG--VLHRDIKSDNILLSINGNIKLTDFG-FC-------- 768

Query: 191 QQELSYVQHDILKNT----TAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
               + V    LK T    T  +  PE++      P   K DIW+LG+ + ++     P+
Sbjct: 769 ----AQVNETTLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 821

Query: 247 -EKTGENAI-LHSKFQYPAFP---IYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
             +T   A+ L +    P        SD LK+ +   LS NP +R +  ELLE++
Sbjct: 822 LNETPLRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 97/196 (49%), Gaps = 25/196 (12%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L D + S  +  L E   L   +Q +  V   H++  V  HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLSLRRISLLECGEL--FAQISGAVYYAHSMHCV--HRDLKLE 161

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD--LYRGL 221
           N+L   NG  KL DF    G+ R    +  L  V        T  Y  PE+++   Y G 
Sbjct: 162 NILLDKNGNAKLTDF----GFTRECMTKTTLETV------CGTTVYMAPELIERRTYDGF 211

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGEN----AILHSKFQYPAFPIYSDRLKNLIRV 277
            I    DIW+LGV LY L     PF+   E      I++ + +Y A  +  D  ++LI  
Sbjct: 212 KI----DIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDA-KVIPDDARDLISR 266

Query: 278 MLSENPTKRPNICELL 293
           +L++NP +RP++ ++L
Sbjct: 267 LLAKNPGERPSLSQVL 282

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 114/246 (46%), Gaps = 32/246 (13%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLK--NNRHVVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L   +N++++S +D       F +  Y  +    
Sbjct: 1036 ERILVDTWVRDRKLGTIPSEIQIMSTLNKTSNKNILSILD------FFEDDDYYYVEQPV 1089

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + + G +  F     +  ++E E   I  Q   G++++H  +  ++HRDIK ENV+    
Sbjct: 1090 HGKTGCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAK 1147

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS       P           D+   T   Y  PE+L  + Y G P     D
Sbjct: 1148 GFVKLIDFGSAAYVKNGP----------FDVFVGTI-DYASPEVLRGEKYEGKP----QD 1192

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWALG+ LY + +   PF    E  IL    ++P     S    +LI+++L+ +  +RP+
Sbjct: 1193 IWALGILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPS 1250

Query: 289  ICELLE 294
            I ++ E
Sbjct: 1251 ITDISE 1256

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 127/275 (46%), Gaps = 29/275 (10%)

Query: 26  KYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHV 85
           ++L  GGFA+ + ++      ++   VA   ++ + T+     L +E+   K +K+ +++
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMKH-QNI 201

Query: 86  VSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGV 145
           V ++D       F +    V +L+  C  G L++ +  R    L+E E+     Q    +
Sbjct: 202 VQFVD------CFED-HINVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAI 252

Query: 146 ANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNT 205
             MH+ +  ++HRD+K+ N+    N   K+ DFG          N +E  Y         
Sbjct: 253 KYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLAAVLA----NDRERKYTVCG----- 301

Query: 206 TAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQY 261
           T  Y  PE+L L +      + DIW++GV ++ L     PF+    N I     +S++ +
Sbjct: 302 TPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTF 360

Query: 262 PAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           P     S   K LI+ +L  +P  RP+I E++E +
Sbjct: 361 PINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 121/275 (44%), Gaps = 33/275 (12%)

Query: 24  IKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNR 83
           +K+ +  G +  +Y       D      V  +K ++      LN + AE+  +K L N+ 
Sbjct: 27  LKQVIGRGSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEISLLKNL-NHH 80

Query: 84  HVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQ 143
           ++V Y         F   SYE+ +L+EYC  G L   + SR    LSE E    ++QT  
Sbjct: 81  NIVKY-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLL 132

Query: 144 GVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           G+  +H     ++HRDIK  N+L S +   KL DFG     +    N   L+        
Sbjct: 133 GLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG----- 180

Query: 204 NTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPA 263
             T  +  PE+L   RG      SDIW+LG  + ++     P+    +  I ++      
Sbjct: 181 --TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTY 235

Query: 264 FP--IYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           +P   +S+ LK+ +     +N  KRP   +LL+ +
Sbjct: 236 YPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 99/193 (51%), Gaps = 16/193 (8%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++MEYC GG   D +       + E+++  IL  T +G+  +H  + +  HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKKI--HRDIKAAN 143

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPID 224
           +L +  G+ KL DFG V G IR    +   ++V        T  +  PE+++  +    +
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRG--TFV-------GTPYWMAPEVIN-KQCKGYN 192

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQYPAF-PIYSDRLKNLIRVMLSE 281
           EK+DIW+LG+  Y+L     P  K     ++ +  K + P     YS++ K  + + L +
Sbjct: 193 EKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLIK 252

Query: 282 NPTKRPNICELLE 294
           +P +RP+I  LLE
Sbjct: 253 DPKQRPSIEALLE 265

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 127/283 (44%), Gaps = 35/283 (12%)

Query: 24  IKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNR 83
           +K+ +  G +  +Y       D      V  +K ++  +   LN + AE+  +K L N+ 
Sbjct: 27  LKQVIGRGSYGVVYKAINKHTD-----QVVAIKEIVYESDEELNDIMAEISLLKNL-NHD 80

Query: 84  HVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQ 143
           ++V Y         F   SYE+ +L+EYC  G L   + SR    LSE E  + ++QT  
Sbjct: 81  NIVKY-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTLL 132

Query: 144 GVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           G+  +H     ++HRDIK  N+L S +   KL DFG     +    N   L+        
Sbjct: 133 GLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG----- 180

Query: 204 NTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPA 263
             T  +  PE+L   RG      SDIW+LG  + ++     P+    +  I ++      
Sbjct: 181 --TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTY 235

Query: 264 FP--IYSDRLKNLIRVMLSENPTKRPNICELLEE--ISSIQGV 302
           +P   +S+ LK+ +     +N  KRP   +LL+   I+S + V
Sbjct: 236 YPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHAWITSTENV 278

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 113/256 (44%), Gaps = 38/256 (14%)

Query: 54   CLKRVIVP--------TKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEV 105
             +K+V VP        T S L  LR+EV  +K L ++ ++V Y+        F N +Y  
Sbjct: 1173 AVKQVEVPRYGSQDETTLSVLEALRSEVATLKDL-DHTNIVQYL-------GFENKNYVY 1224

Query: 106  LLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENV 165
             L +EY  GG +   +  RL  +  E  I  +  Q  +G++ +H+ +  +LHRD+K +N+
Sbjct: 1225 SLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHSKK--ILHRDMKADNL 1280

Query: 166  LRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDE 225
            L   +G  K+ DFG     I    N     Y   D+    T  +  PEM+D  +G     
Sbjct: 1281 LLDVDGICKISDFG-----ISKKSNNI---YSNSDMTMRGTVFWMAPEMVDTKQGY--SA 1330

Query: 226  KSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFP--------IYSDRLKNLIRV 277
            K DIW+LG  + ++     P+      A +    ++ + P        I S   K  +  
Sbjct: 1331 KVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKEFLDA 1390

Query: 278  MLSENPTKRPNICELL 293
                NP KRP   ELL
Sbjct: 1391 CFEINPEKRPTADELL 1406

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 79/350 (22%), Positives = 143/350 (40%), Gaps = 65/350 (18%)

Query: 8   LYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLN 67
            + +G  +++     L+   L  G    +Y V+  P  ++S   V  LK+V  P      
Sbjct: 17  FWFDGVRISINGKSYLVTTLLREGELTALYQVK-CPKRSHS-GGVYALKKVTCPIGRADF 74

Query: 68  TLRAEVDAMKLLK-NNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRL- 125
             RA  +     + N+ ++ + +D    +   +NG+  + +L+ Y   G L D +N+ + 
Sbjct: 75  VTRAMTEISNYQRFNSPYITNILDFQVAQH--DNGTKIIYMLLPYFPAGSLQDLINNMII 132

Query: 126 -QNRLSEAEILNILSQTAQGVANMHA---------------------------------- 150
             + LSE+ ++ ++    +GV  MH                                   
Sbjct: 133 RGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAME 192

Query: 151 ---LQPVL--------LHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPP---RNQQELSY 196
              L P L        +H  +  EN++ S  G   + +  S    +R P    +  +L  
Sbjct: 193 LDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLG 249

Query: 197 VQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE----- 251
           +Q  + +N+   Y CPE+LDL+    I  + DIW+LG   Y L Y  + F +  +     
Sbjct: 250 LQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTP 309

Query: 252 --NAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSI 299
             ++I    F +P  P YS  LK +++  L  +P KRP+I E L +   +
Sbjct: 310 IKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 109/247 (44%), Gaps = 32/247 (12%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L    H  ++  +D       F +  Y  L    
Sbjct: 1003 ERILVDTWVRDRTLGTIPSEIQIMVTLNRKPHENILRILD------FFEDDDYYYLETEM 1056

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F    L+  ++E E   +  Q A G+ ++H     ++HRDIK ENV+    
Sbjct: 1057 HGETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNK 1114

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS       P           D+   T   Y  PE+L  + Y G P     D
Sbjct: 1115 GFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QD 1159

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWA+GV LY + Y   PF    E  IL    +  +    S     LIR +L+ + +KRP 
Sbjct: 1160 IWAIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPT 1217

Query: 289  ICELLEE 295
            I +++E+
Sbjct: 1218 IDDIMED 1224

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 114/264 (43%), Gaps = 42/264 (15%)

Query: 35  QIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAV 94
           Q+YA+++  +D                T+  +  +R E+  +  LK   ++  Y  S  +
Sbjct: 40  QVYAIKVLNLDN---------------TEDEVEDIRKEIQFLSSLKQTPNITHYYGSYLI 84

Query: 95  KSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPV 154
            +       ++ ++MEYC GG L   +   +   + E  I  I+ +    + ++H  +  
Sbjct: 85  DT-------KLWVIMEYCAGGSLRTLLRPGI---IEEKYIGVIMREILVALISIH--RDN 132

Query: 155 LLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEM 214
           ++HRDIK  N+L + NG  KLCDFG           Q   S ++   +   T  +  PE+
Sbjct: 133 VIHRDIKAANILIANNGSVKLCDFGVAA--------QLSQSMLKRQTMAG-TPYWMAPEV 183

Query: 215 LDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF----EKTGENAILHSKFQYPAFPIYSDR 270
             +  G+  D K DIW+LG+  Y++     P+           I  SK        YS  
Sbjct: 184 --IMEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPPRLEGREYSQP 241

Query: 271 LKNLIRVMLSENPTKRPNICELLE 294
           LK  I + L E+P +RP   EL +
Sbjct: 242 LKEFIALCLDEDPKERPYAEELFK 265

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 121/275 (44%), Gaps = 33/275 (12%)

Query: 24  IKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNR 83
           +K+ +  G +  +Y       D      V  +K V+      LN + AE+  +K L N+ 
Sbjct: 27  LKQVIGRGSYGVVYKAINKHTD-----QVVAIKEVVYENDEELNDIMAEISLLKNL-NHN 80

Query: 84  HVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQ 143
           ++V Y         F   SYE+ +L+EYC  G L   + SR    LSE E    ++QT  
Sbjct: 81  NIVKY-------HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLL 132

Query: 144 GVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           G+  +H     ++HRDIK  N+L S +   KL DFG     +    N   L+        
Sbjct: 133 GLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG----- 180

Query: 204 NTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPA 263
             T  +  PE+L   RG      SDIW+LG  + ++     P+    +  I ++      
Sbjct: 181 --TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTY 235

Query: 264 FP--IYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           +P   +S+ LK+ +     +N  KRP   +LL+ +
Sbjct: 236 YPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 115/235 (48%), Gaps = 41/235 (17%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K+++H  +V++IDS  +K        ++ ++ME+ EGG L D +   +   L+
Sbjct: 594 INEIIVMKDSKHPNIVNFIDSFLLKG-------DLWVIMEFMEGGSLTDVVTHCI---LT 643

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T +G+  +H+    ++HRDIK +N+L S  G+ KL DFG  C  I     
Sbjct: 644 EGQIGTVCRETLRGLQFLHSNG--VIHRDIKSDNILLSMKGDIKLTDFG-FCAQIN---- 696

Query: 191 QQELSYVQHDILKNT---TAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFE 247
                  +H++ + T   T  +  PE++      P   K DIW+LG+ + ++     P+ 
Sbjct: 697 -------EHNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIESEPPYL 746

Query: 248 KTGENAILH-------SKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEE 295
                  L+        K + P   + SD L + +   L  NP +R +   LLE+
Sbjct: 747 NETPLRALYLIATNGTPKLKEPE--LLSDVLNDFLSWCLKVNPDERASASTLLED 799

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 91/199 (45%), Gaps = 31/199 (15%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           E+ L++EY +GG L D++ SR   RL E E ++   Q  QGV+  HA    + HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--ICHRDLKPE 245

Query: 164 N-VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTA--QYRCPE--MLDLY 218
           N +L   N   K+ DFG                 V + +L+ +     Y  PE  M   Y
Sbjct: 246 NLLLDKKNSTIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGKQY 293

Query: 219 RGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYPAFPIYSDRLKNL 274
            G P    SD+W+ G+ L+ L     PF       +L      K+Q P     S   ++L
Sbjct: 294 HGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQN--LSKEAQDL 347

Query: 275 IRVMLSENPTKRPNICELL 293
           I  +L+ NP KR    E+L
Sbjct: 348 IAKILTVNPAKRLTTEEIL 366

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 92/198 (46%), Gaps = 24/198 (12%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++MEYC GG   D +       L E ++  I     +G+  +H  + +  HRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQRKI--HRDVKAAN 149

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELS----YVQHDILKNTTAQYRCPEMLDLYRG 220
           VL + +G  KL DFG V G +R    +        ++  +I+ N++  Y           
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNTFVGTPYWMAPEIISNSSHGY----------- 197

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS---KFQYPAFPIYSDRLKNLIRV 277
              +EK+DIW+LG+ +Y+L     P+ K     ++ +   K        +SD  K  I  
Sbjct: 198 ---NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVSFSDAAKLFISA 254

Query: 278 MLSENPTKRPNICELLEE 295
            L ++P +RP   ELL++
Sbjct: 255 CLIKDPDERPTATELLQQ 272

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 107/244 (43%), Gaps = 32/244 (13%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L    H  +++ +D       F +  Y  +    
Sbjct: 1048 ERILVDTWVRDRKLGTIPSEIQIMATLNKKPHENILTLLD------FFEDDDYYYIETPM 1101

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F    L+  ++E E   I  Q A G+ ++H     ++HRDIK EN++    
Sbjct: 1102 HGETGSIDLFDLIELKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNK 1159

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS       P           D+   T   Y  PE+L  D Y G P     D
Sbjct: 1160 GFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGDPYEGKP----QD 1204

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWA+GV LY + +   PF    E  IL    +  +    S+    LIR +L+ +  KRP 
Sbjct: 1205 IWAIGVLLYTIIFKENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPT 1262

Query: 289  ICEL 292
            I E+
Sbjct: 1263 IEEI 1266

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 99/202 (49%), Gaps = 24/202 (11%)

Query: 101 GSY----EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLL 156
           GSY    ++ ++MEYC GG L   +      ++ E  I  I+ +    +  MH  +  ++
Sbjct: 83  GSYLNDTKLWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELLTAL--MHIHKDGVI 137

Query: 157 HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD 216
           HRDIK  NVL + +G  KLCDFG      +    +Q ++          T  +  PE+  
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEV-- 186

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPF-EKTGENAI-LHSKFQYPAFP--IYSDRLK 272
           +  G+  D K DIW+LG+  Y++     P+ E     A+ L +K + P      +S  LK
Sbjct: 187 IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALK 246

Query: 273 NLIRVMLSENPTKRPNICELLE 294
            +I + L E+P +RP+  +LL+
Sbjct: 247 EIIALCLDEDPKERPSAEDLLK 268

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 120/266 (45%), Gaps = 42/266 (15%)

Query: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120
           P ++  N ++ E+  MK   NN+HVV  I+     S     S ++ L++EYCE G ++  
Sbjct: 136 PKRNDPNKIKKEIAIMKKC-NNKHVVKLIEILDDLS-----SRKIYLVLEYCEKGPILWC 189

Query: 121 ------MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFK 174
                 ++SR   +LS      I      G+  +H+    ++HRDIK  N+L   NG  K
Sbjct: 190 PRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLHS--QGIIHRDIKPANLLMDKNGVVK 247

Query: 175 LCDFG---SVCGYIRPPRNQQELS-------YVQHDILKNTTAQYRCP-EMLDLYRGLPI 223
           + DFG   +  G I    ++ EL+       +   +I     A  R   +  +L+ G  I
Sbjct: 248 ISDFGVSLAANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCI 307

Query: 224 DEKSDIWALGVFLYKLCYYTTPFEKTGE----NAILHSKFQYPAFPIYSD---------- 269
             K DIWALG+ LY L +   PF    E      I++ K ++P F    D          
Sbjct: 308 SFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHISEISHIR 367

Query: 270 ---RLKNLIRVMLSENPTKRPNICEL 292
                K+L+  +L +NP KR +I ++
Sbjct: 368 EFVHAKDLLNKLLEKNPAKRISIPDI 393

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 129/286 (45%), Gaps = 38/286 (13%)

Query: 24  IKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNR 83
           IK+ +  G F  +Y       +  S   VA     +  T   +N L  E+  +  LK+  
Sbjct: 19  IKQCVGRGNFGDVYKA----CEKVSGKVVAVKVVNLEHTDEDINLLAQEIFFLAELKSP- 73

Query: 84  HVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQ 143
           ++ +YI +     +       + ++MEYC GG   D + +     L E++   I  +  +
Sbjct: 74  YITNYITTMTEDVS-------MWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLK 126

Query: 144 GVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           G+  +H  + +  HRDIK  N+L +  G+ KL DFG V G IR    +            
Sbjct: 127 GLEYLHEQKKI--HRDIKAANILLTDEGKVKLGDFG-VSGQIRATLKRGTFV-------- 175

Query: 204 NTTAQYRCPEML----DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS-- 257
             T  +  PE++    D Y     DEK+DIW+LG+ +Y+L   + P  K     ++ +  
Sbjct: 176 -GTPFWMAPEVVSKDSDGY-----DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLP 229

Query: 258 KFQYPAF-PIYSDRLKNLIRVMLSENPTKRPNICELL--EEISSIQ 300
           K + P     YS   K+ +   L +NP  RP+  ELL  E ++++Q
Sbjct: 230 KRKPPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 99/198 (50%), Gaps = 29/198 (14%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           V + +EYC G  L +++   ++ R+   E  ++ SQ    V   H+++ V  HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMKCV--HRDLKLEN 158

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDL--YRGLP 222
           +L    G+ KL DF    G+ R    +  L  V        T  Y  PE+++   Y G  
Sbjct: 159 ILLDKKGQAKLTDF----GFTRECATKGILETV------CGTTVYMAPELIERKPYEGYK 208

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQ-YPAFPIYSDRL-----KNLIR 276
           I    D W+LG+ LY + +   PF+   E   + +K++     P Y D       K+LI 
Sbjct: 209 I----DTWSLGIILYTMIHGAMPFD---EEDDIKTKYRIVNNEPFYDDNFIDANGKDLIM 261

Query: 277 VMLSENPTKRPNICELLE 294
            +L ++P++RP++ ++L+
Sbjct: 262 QLLQKDPSQRPSLTQVLQ 279

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 107/244 (43%), Gaps = 32/244 (13%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L  + H  ++  +D       F +  Y  +    
Sbjct: 1071 ERILVDTWVRDRQLGTILSEIQIMSTLNKHPHDNILRLLD------FFEDDDYYYIETPM 1124

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F     +  +SE E   I  Q    +  +H     ++HRDIK ENV+    
Sbjct: 1125 HGETGCIDLFDLIEFKTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQ 1182

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS       P           D+   T   Y  PE+L  + Y G P     D
Sbjct: 1183 GFIKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYVGKP----QD 1227

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWA+G+ LY + +   PF    E  IL ++ ++       +   +LI+ +L+ NPTKRP 
Sbjct: 1228 IWAIGILLYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPT 1285

Query: 289  ICEL 292
            I E+
Sbjct: 1286 IDEI 1289

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 107/244 (43%), Gaps = 32/244 (13%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L+   H  ++  +D       F +  Y  +    
Sbjct: 1099 ERILVDTWVRDRKLGTIPSEIQIMATLQKKPHENIMKLLD------FFEDDQYYYIESPM 1152

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F    L+  ++E E   +  Q   GV ++H     ++HRDIK ENV+    
Sbjct: 1153 HGETGSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNK 1210

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS     R P           D+   T   Y  PE+L  D Y G P     D
Sbjct: 1211 GCVKLIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLEGDPYEGKP----QD 1255

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWA+GV LY + Y   PF    E  IL    +     I S+    LI ++L  + +KRP 
Sbjct: 1256 IWAIGVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPT 1313

Query: 289  ICEL 292
            + ++
Sbjct: 1314 VDDI 1317

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 127/276 (46%), Gaps = 39/276 (14%)

Query: 28  LTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAE---VDAMKLLKNNR- 83
           L  GGFA+ + +         K +V       + +K  + T R +   +  +++ +N R 
Sbjct: 99  LGEGGFARCFHI---------KDDVGISFACKIVSKKSIKTERTKFKLLSEIQIHQNLRY 149

Query: 84  -HVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTA 142
            H+V ++D    +   N     V +L+E C  G L+D +  R    L+EAE+  + +Q  
Sbjct: 150 SHIVKFMD--CFEDELN-----VYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVC 200

Query: 143 QGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDIL 202
             +  MH+    ++HRD+K+ NV    N   K+ DFG          N  E  Y      
Sbjct: 201 GAINYMHSNN--IIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG-- 252

Query: 203 KNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----SK 258
              T  Y  PE++ L + +    ++DIW+LG+ +Y +     PF+      I       +
Sbjct: 253 ---TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQ 308

Query: 259 FQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLE 294
           +++P     ++ +K LI+ +L  +P++RP I ++L+
Sbjct: 309 YEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 118/268 (44%), Gaps = 38/268 (14%)

Query: 34   AQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNA 93
             ++ AV+   V  YS  + A +        S ++ +++EV  +K L ++ ++V Y+    
Sbjct: 1277 GEMMAVKQVEVPKYSSQDEAIM--------STVDAIKSEVSTLKDL-DHLNIVQYL---- 1323

Query: 94   VKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQP 153
                F N      L +EY  GG +   +  R+  R  E  I ++  Q  +G+A +HA   
Sbjct: 1324 ---GFENKDNIYSLFLEYVAGGSVGSLI--RIYGRFDEPLIRHLNIQVLRGLAYLHARG- 1377

Query: 154  VLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPE 213
             +LHRD+K +N+L   +G  K+ DFG         R  +++ Y   D+    T  +  PE
Sbjct: 1378 -ILHRDMKADNLLLDQDGVCKISDFGIS-------RKSKDI-YSNSDMTMRGTVFWMAPE 1428

Query: 214  MLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYP----AFP 265
            M+D  +G     K DIW+LG  + ++     P+      A +     SK   P      P
Sbjct: 1429 MVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGKSKSAPPIPEDTLP 1486

Query: 266  IYSDRLKNLIRVMLSENPTKRPNICELL 293
            + S   +  +      +P KRP   ELL
Sbjct: 1487 LISAEGREFLDACFEIDPDKRPTADELL 1514

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 112/247 (45%), Gaps = 32/247 (12%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L  + H  ++  +D       F +  Y  +    
Sbjct: 1141 ERILVDTWVRDRQLGTIPSEIQIMTTLNKSPHENIMQLLD------FFEDDDYYYIETPL 1194

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F     ++ ++E+E   I  Q   G+ ++H     ++HRD+K ENV+    
Sbjct: 1195 HGETGCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAK 1252

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS       P           D+   T   Y  PE+L  + Y G P     D
Sbjct: 1253 GFVKLIDFGSAAYVNSGP----------FDVFVGTI-DYAAPEVLSGEPYLGKP----QD 1297

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWA+G+ LY + +   PF    E  IL ++ +       S    +LI+ +L++NP KRP 
Sbjct: 1298 IWAIGILLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPT 1355

Query: 289  ICELLEE 295
            I E++ +
Sbjct: 1356 IDEIVND 1362

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 125/276 (45%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRH-- 84
           +L  GGFA+ + ++      ++   VA   ++ + ++     L +E+   ++ K+ RH  
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEI---QIHKSMRHFN 137

Query: 85  VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQG 144
           +V +ID       F + +  V +L+E C  G L+D +  R    L+E E+    +Q    
Sbjct: 138 IVQFID------CFEDDT-NVYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGA 188

Query: 145 VANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKN 204
           V  MH+ +  ++HRD+K+ N+    +   K+ DFG          N +E  Y        
Sbjct: 189 VKYMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLAAVLA----NDRERKYTV-----C 237

Query: 205 TTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----SKFQ 260
            T  Y  PE+L   +      + DIW+ GV +Y L     PF+    N I        + 
Sbjct: 238 GTPNYIAPEVL-TGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDYV 296

Query: 261 YPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           +P     S     LIR +LS +P +RP++ E+++ +
Sbjct: 297 FPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 112/230 (48%), Gaps = 35/230 (15%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K ++H  +V++IDS  +K        ++ ++MEY EGG L D +   +   L+
Sbjct: 372 INEILVMKGSKHSNIVNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 421

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T +G+  +H+    ++HRDIK +N+L S NG+ KL DFG  C  I     
Sbjct: 422 EGQIGAVCRETLKGLQFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQIN---- 474

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTG 250
             E++  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+    
Sbjct: 475 --EVNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 527

Query: 251 ENAILH-------SKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELL 293
               L+        K + P     SD LK  +   L  +P  R N  ELL
Sbjct: 528 PLRALYLIATNGTPKLKDPEN--LSDTLKEFLGWCLKVDPEDRANAAELL 575

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 97/196 (49%), Gaps = 25/196 (12%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L D + S  +  L E   L   +Q +  V   H++  V  HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLSLRRLSLLECGEL--FAQISGAVYYAHSMHCV--HRDLKLE 161

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD--LYRGL 221
           N+L   NG  KL DF    G+ R    +  L  V        T  Y  PE+++   Y G 
Sbjct: 162 NILLDRNGNAKLTDF----GFTRECMTKTTLETV------CGTTVYMAPELIERKTYDGF 211

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGE----NAILHSKFQYPAFPIYSDRLKNLIRV 277
            I    DIW+LGV LY L     PF+   E      I++ + +Y +  I  D  K+LI  
Sbjct: 212 KI----DIWSLGVILYTLITGYLPFDDDDEVKTKWKIVNEEPKYDSKFI-PDDAKDLISR 266

Query: 278 MLSENPTKRPNICELL 293
           +L++NP +RP++ ++L
Sbjct: 267 LLAKNPGERPSLPQVL 282

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 97/198 (48%), Gaps = 29/198 (14%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           V + +EYC G  L +++ ++    L E   L   SQ    V   H+++ V  HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSEL--FSQIVGAVYYAHSMKCV--HRDLKLEN 158

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDL--YRGLP 222
           +L    G  KL DF    G+ R    +  L  +        T  Y  PE+++   Y G  
Sbjct: 159 ILLDKKGHAKLTDF----GFTRECATKGILETI------CGTTVYMAPELIERKPYEGYK 208

Query: 223 IDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAF-PIYSDRL-----KNLIR 276
           I    D W+LG+ LY + + T PF++  E   + +K++   + P Y +       K LI 
Sbjct: 209 I----DTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIVHYNPTYDNDYIDSNGKELIS 261

Query: 277 VMLSENPTKRPNICELLE 294
            +L ++P +RP++ ++L+
Sbjct: 262 QLLEKDPNQRPSLTQVLQ 279

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 97/196 (49%), Gaps = 25/196 (12%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L + + +    R+S  E   + +Q    +   H+L  V  HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHLLA--LKRISLDECSRLFAQIVGAIYYAHSLNCV--HRDLKLE 157

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDL--YRGL 221
           N+L    G  KL DFG           ++ +S  Q D +  TT  Y  PE+ +   Y G 
Sbjct: 158 NILLDKKGNAKLTDFGFT---------RECVSKSQLDTICGTTV-YMAPELTERKSYDGF 207

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKF--QYPAF--PIYSDRLKNLIRV 277
            I    DIWALGV LY +   + PF++  E A    K   + P     + S   K+LI  
Sbjct: 208 KI----DIWALGVILYTMINGSMPFDEDDE-AKTKWKIVNEMPEINEDLVSPDAKDLIEQ 262

Query: 278 MLSENPTKRPNICELL 293
           +L+++P +RP+I ++L
Sbjct: 263 LLAKDPNERPSIEKIL 278

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 112/226 (49%), Gaps = 18/226 (7%)

Query: 74  DAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEV--LLLMEYCEGGGLIDFMNSRLQNRLSE 131
           D + LL    + ++ + S  + + F+    +V   ++MEYC GG   D +    +  L+E
Sbjct: 72  DEIDLLAQEIYFLAELHSPYITNYFSTFVEDVSMWIVMEYCGGGSCSDLLKCLPRGTLTE 131

Query: 132 AEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQ 191
            ++  I  +  +G+  +H+ + +  HRDIK  N+L + +G+ KL DFG V G +   R +
Sbjct: 132 EKVAFITREILRGLEYLHSQRKI--HRDIKAANILLTDDGKVKLGDFG-VSGQMMATRRR 188

Query: 192 QELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE 251
              ++V        T  +  PE++        +EK+DIW+LG+ +++L     P  +   
Sbjct: 189 D--TFV-------GTPFWMAPEVIARSE-QGYNEKADIWSLGITVFELLKGQPPLSQHDP 238

Query: 252 NAILHS--KFQYPAFPI-YSDRLKNLIRVMLSENPTKRPNICELLE 294
             +L S    + P     YS  ++  + + L+++P KRP   ELL+
Sbjct: 239 MKVLMSIPSRRPPKLEDRYSHAIREFVSLCLNKDPAKRPTASELLK 284

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 93/176 (52%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K +RH  +V++IDS  +K        ++ ++MEY EGG L D +   +   L+
Sbjct: 721 INEIIVMKGSRHENIVNFIDSYLMKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 770

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T  G+A +H+    ++HRDIK +N+L S NG+ KL DFG  C  I     
Sbjct: 771 EGQIGTVCKETLGGLAFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQIN---- 823

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
             E+   +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+
Sbjct: 824 --EVHLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 872

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 115/228 (50%), Gaps = 31/228 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K ++H  +V++IDS  +K        ++ ++MEY EGG L D +   L   L+
Sbjct: 693 INEIIVMKESKHENIVNFIDSYLLKG-------DLWVIMEYMEGGSLTDVVTHCL---LT 742

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           EA++  +  +T  G+  +H+    ++HRDIK +N+L S  G+ KL DFG  C  I     
Sbjct: 743 EAQVGAVCRETLSGLQFLHSKG--VIHRDIKSDNILLSMRGDIKLTDFG-FCAQI----- 794

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF-EKT 249
             EL+  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+  +T
Sbjct: 795 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 848

Query: 250 GENAI-LHSKFQYPAFP---IYSDRLKNLIRVMLSENPTKRPNICELL 293
              A+ L +    P+       SD L N +   L  NP +R +  +LL
Sbjct: 849 PLRALYLIATNGTPSLKEPEALSDALNNFLGWCLKVNPDERASAKDLL 896

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 133/286 (46%), Gaps = 47/286 (16%)

Query: 20  HRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLL 79
           +R LIK  +  G    +Y       DT S+ +VA +K++ +  +     +  E+  M+  
Sbjct: 620 YRDLIK--IGQGASGGVYIAH----DTESEDSVA-IKQMNLEKQPKKELILNEILVMRES 672

Query: 80  KNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILS 139
           K++ ++V++IDS   K        ++ ++MEY EGG L D +   L   LSE +I  +  
Sbjct: 673 KHS-NIVNFIDSYLAKG-------DLWIVMEYMEGGSLTDVVTHCL---LSEGQIGAVCR 721

Query: 140 QTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQH 199
           +T +G+  +H+    +LHRDIK +N+L S  G  KL DFG  C  I            ++
Sbjct: 722 ETLKGLQFLHSKG--VLHRDIKSDNILLSLKGNIKLTDFG-FCAQIN-----------EN 767

Query: 200 DILKNT---TAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH 256
           ++ + T   T  +  PE++      P   K DIW+LG+ + ++     P+        L+
Sbjct: 768 NLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALY 824

Query: 257 -------SKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEE 295
                   K + P     SD L   +   L  +P++R    ELL++
Sbjct: 825 LIATNGTPKLKEPE--ALSDTLTKFLDWCLKVDPSERATATELLDD 868

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 100/198 (50%), Gaps = 27/198 (13%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQ-NRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKI 162
           +V + +EYC G  L D +   LQ  R+   E + + SQ    V   H+L  V  HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLNCV--HRDLKL 165

Query: 163 ENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDL--YRG 220
           EN+L   +G  KL DF    G+ R     + +  V  + +  TT  Y  PE+ +   Y G
Sbjct: 166 ENILLDKDGNAKLTDF----GFTR-----ECMEKVNLETICGTTV-YMAPELTERKPYDG 215

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKTGEN----AILHSKFQYPAFPIYSDRLKNLIR 276
             I    DIW+LGV LY +   + PF++  E      I++ + +Y +    +   ++L+R
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEYNS-KFMTAEGEDLVR 270

Query: 277 VMLSENPTKRPNICELLE 294
            +L ++   RP++ E+L+
Sbjct: 271 KLLQKDSNLRPSVREILQ 288

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 94/194 (48%), Gaps = 26/194 (13%)

Query: 107 LLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVL 166
           +L EY  GG L+D++       L E+   N   Q    +  +HA    ++HRD+KIEN++
Sbjct: 204 MLFEYVSGGQLLDYIIQ--HGSLKESHARNFARQILSALKYLHANN--IVHRDLKIENIM 259

Query: 167 RSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLP-IDE 225
            S NG  K+ DFG    Y    ++++  +Y         +  +  PE+L   R  P I  
Sbjct: 260 ISSNGNIKIIDFGLSNLY---DKSKKLKTYC-------GSLYFAAPELL---RANPYIGP 306

Query: 226 KSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQ-----YPAFPIYSDRLKNLIRVMLS 280
           + D+W+ GV LY L     PF+    N +LH K +     YP F   S  + +L+  ML 
Sbjct: 307 EIDVWSFGVVLYVLVCGKVPFDDENSN-VLHEKIKQGRVFYPQF--LSIEVISLLSTMLV 363

Query: 281 ENPTKRPNICELLE 294
            +P KR  + ++++
Sbjct: 364 VDPFKRATLDQVMK 377

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 92/176 (52%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K +RH  +V++IDS  +K        ++ ++MEY EGG L D +   +   L+
Sbjct: 665 INEILVMKGSRHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 714

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T  G+  +H+    +LHRDIK +N+L S  G+ KL DFG  C  I     
Sbjct: 715 EGQIGAVCRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI----- 766

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
             EL+  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+
Sbjct: 767 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 816

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 120/278 (43%), Gaps = 41/278 (14%)

Query: 24  IKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVI----VPTKSGLNTLRAEVDAMKLL 79
           I + L  G F ++Y V   P      S + C  +V+    +   +     + E+D    L
Sbjct: 120 IGRKLGKGKFGKVYCVRHKP------SGLICALKVMNKMEIVNFNVQKQFKREIDIQYHL 173

Query: 80  KNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILS 139
            +      Y        AF + S  V L+MEY  GG L   +  +    +++    N + 
Sbjct: 174 NHKNLTKLY--------AFFHDSKNVYLVMEYLIGGELYKLL--KKNGPMNDITASNYVY 223

Query: 140 QTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQH 199
           Q    +  MH  +  ++HRD+K EN+L   N + KL DFG     I  P NQ+  +    
Sbjct: 224 QMTDALNYMHKRK--IIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC-- 276

Query: 200 DILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK-TGENA---IL 255
                 T  Y  PE++        DE  D+WALG+  Y+L     PFE+ T E     I 
Sbjct: 277 -----GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIA 328

Query: 256 HSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELL 293
            S  ++P  P  S   ++LI  +L   P++R N+ +++
Sbjct: 329 KSDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 93/200 (46%), Gaps = 32/200 (16%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++MEYC GG   D +     N L E ++  I+ +   G+  +H  + +  HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKI--HRDIKAAN 146

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEM----LDLYRG 220
           +L +  G  KL DFG V G+IR        S ++ D     T  +  PE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS-------KFQYPAFPIYSDRLKN 273
              +EK+DIW+LG+  Y+L     P  K     ++ +       K Q P    +SD  K+
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKD 247

Query: 274 LIRVMLSENPTKRPNICELL 293
            +   L + P  RP+   LL
Sbjct: 248 FVAGCLVKTPADRPSAYNLL 267

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 126/275 (45%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++      ++   VA   ++ + ++     L +E+   K +K+  ++V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHP-NIV 137

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            +ID       F + +  V +L+E C  G L+D +  R    L+E E+    +Q    + 
Sbjct: 138 QFID------CFEDDT-NVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH  +  ++HRD+K+ N+    N   K+ DFG          N +E  Y         T
Sbjct: 189 YMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 237

Query: 207 AQYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----SKFQY 261
             Y  PE+L   + G   +   DIW++GV +Y L     PF+    N I        + +
Sbjct: 238 PNYIAPEVLAGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQAKEVNIIYERIKSGDYIF 295

Query: 262 PAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           P     S  +  LI+ +LS +P +RP++ E+++ +
Sbjct: 296 PREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 117/264 (44%), Gaps = 32/264 (12%)

Query: 42  TPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNG 101
           T +DT  K     L +  +  +  +  +  E  A++ L N+  VV         S F + 
Sbjct: 201 TSIDTKKKYAAKVLNKEYLIRQKKVKYVSVEKIALQKLNNSHSVVRLF------STFQDE 254

Query: 102 SYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIK 161
           S  +  L+EY   G  +  M  +    L E       SQ    + ++H     ++HRDIK
Sbjct: 255 S-SLYFLLEYAPNGDFLSLM--KKYGSLDENCACYYGSQIIDAIDHLHV--SGIIHRDIK 309

Query: 162 IENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNT-----TAQYRCPEML- 215
            EN+L  G    KL DFG+    + P  N    S  ++D+   +     TA+Y  PE+L 
Sbjct: 310 PENILLDGEMRIKLTDFGT-AKLLEPTNNSSSKS--KYDLSTRSKSFVGTAEYVSPELLN 366

Query: 216 DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQY---PAFPIYSDR 270
           D +     D + DIWA G  L+++     PF+ T E        K QY   P FP+    
Sbjct: 367 DSF----TDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTPGFPLI--- 419

Query: 271 LKNLIRVMLSENPTKRPNICELLE 294
           +++L++ +L +N  +R  I ++ E
Sbjct: 420 IRDLVKKILIKNLDQRLTINQIKE 443

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 94/200 (47%), Gaps = 24/200 (12%)

Query: 107 LLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVL 166
           ++ EY  GG L+D++       L E    +     A G+A +HA    ++HRD+KIEN++
Sbjct: 219 MMFEYVSGGQLLDYIIQ--HGSLREPLARSFARAIASGLAYLHANN--VVHRDLKIENIM 274

Query: 167 RSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLP-IDE 225
            +  GE K+ DFG     +  PR +   +Y         +  +  PE+L   R  P I  
Sbjct: 275 LTAAGEIKIIDFG--LSNLFDPRAKL-TTYC-------GSLYFAAPELL---RAKPYIGP 321

Query: 226 KSDIWALGVFLYKLCYYTTPFEKTGENA----ILHSKFQYPAFPIYSDRLKNLIRVMLSE 281
           + DIW+ GV LY L     PF+    NA    I   K  YPA    S    +L+  ML+ 
Sbjct: 322 EIDIWSFGVILYVLVVGKVPFDDENSNALHEKIKRGKVSYPA--TLSIECISLLTKMLTV 379

Query: 282 NPTKRPNICELLEEISSIQG 301
           NP +R  + E++     ++G
Sbjct: 380 NPKRRATLKEIVTHHWMVRG 399

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 108/247 (43%), Gaps = 32/247 (12%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNN--RHVVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L  N   +++  +D       F +  Y  +    
Sbjct: 875  ERILVDTWVRDRKLGTIPSEIQIMATLNKNSQENILKLLD------FFEDDDYYYIETPV 928

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F     +  + E E   +  Q    + ++H     ++HRDIK ENV+   +
Sbjct: 929  HGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHGQG--IVHRDIKDENVIVDSH 986

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS   YI+             D+    T  Y  PE+L    Y+G P     D
Sbjct: 987  GFVKLIDFGS-AAYIKSG---------PFDVFVG-TMDYAAPEVLGGSSYKGKP----QD 1031

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWALGV LY + Y   P+    E  IL  + ++      S+    LI+ +L+    KRP 
Sbjct: 1032 IWALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEKVSEECIGLIKRILTREVDKRPT 1089

Query: 289  ICELLEE 295
            I E+ E+
Sbjct: 1090 IDEIYED 1096

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 90/371 (24%), Positives = 158/371 (42%), Gaps = 67/371 (18%)

Query: 42  TPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNG 101
           T  D+  K  V  L +  +  +  +  +  E +A++ L N+R +V    +      F + 
Sbjct: 200 TAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFFT------FQDE 253

Query: 102 SYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIK 161
           S  +  L+EY   G  +  M  +    LSE       +Q   G+  +H+    ++HRDIK
Sbjct: 254 S-SLYFLLEYAPNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHSKG--IIHRDIK 308

Query: 162 IENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNT-----TAQYRCPEML- 215
            EN+L   + + K+ DFG+    I  P+N+ E    + ++L  +     TA+Y  PE+L 
Sbjct: 309 PENILLDKDMKVKITDFGT--AKILEPKNEDE-DNPEFNLLTRSKSFVGTAEYVSPELLN 365

Query: 216 DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQY---PAFPIYSDR 270
           D Y    +D + DIWA G  ++++     PF+ T E        K QY     FP+    
Sbjct: 366 DSY----VDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVV--- 418

Query: 271 LKNLIRVMLSENPTKRPNICELLE---------EISSIQGVPCP-IQNFYLXXXXXXXXX 320
           +++L++ +L + P +R  I ++ +         E  S+   P P IQ + +         
Sbjct: 419 VRDLVKRILLKVPEQRLTIPQIEKHHFYKDISFEDGSVWTAPAPEIQPYKINAK------ 472

Query: 321 XXXXXXTTVPKIATAQPIQQLNARTQTMPIINT------KANTSLVTPITVPVLSENTRL 374
                        + QP+ +L        IIN       KA+T+  +   +P +      
Sbjct: 473 -------------SMQPVPELKDAPNKRTIINIPKRQLQKAHTNSSSTPNLPTIERPETP 519

Query: 375 PALELDIKVPQ 385
             LE D+ VP+
Sbjct: 520 QRLESDVDVPK 530

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 107/244 (43%), Gaps = 32/244 (13%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L    H  ++  +D       F +  Y  +    
Sbjct: 1033 ERILVDTWVRDRKLGTIPSEIQIMATLNKKPHENIMRLLD------FFEDDEYYYIESPM 1086

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F    L+  ++E E   +  Q A G+ ++H  +  ++HRDIK ENV+    
Sbjct: 1087 HGETGSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNR 1144

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  K+ DFGS     R P           D+   T   Y  PE+L  D Y G P     D
Sbjct: 1145 GRVKIIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLGGDPYEGKP----QD 1189

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            +WA+GV LY + Y   PF    E  IL    +     + S+    LI  +L+ +  +RP 
Sbjct: 1190 VWAVGVLLYTIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPT 1247

Query: 289  ICEL 292
            + ++
Sbjct: 1248 VDDI 1251

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 123/274 (44%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++      ++   VA L    + ++     L +E+   K +K+  ++V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKHP-NIV 150

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            + D       F + +  V +L+E C  G +++ +  R    L+E E+   + Q    + 
Sbjct: 151 QFTD------CFEDDT-NVYILLEICPNGSVMELLRQR--KHLTEPEVRFCMIQIIGAIR 201

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+        K+ DFG          N +E  Y         T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLA----NDKERKYTI-----CGT 250

Query: 207 AQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFE----KTGENAILHSKFQYP 262
             Y  PE+L   +      + DIW++GV LY L +   PF+    +T    I    F +P
Sbjct: 251 PNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFP 309

Query: 263 AFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           A    S   KNLI  +L  NP  RP++ E+ + +
Sbjct: 310 ADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 117/268 (43%), Gaps = 38/268 (14%)

Query: 34   AQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNA 93
             ++ AV+   V  YS  + A +        S +  LR+EV  +K L ++ ++V Y+    
Sbjct: 1237 GEMMAVKQVEVPKYSSQDEAII--------STVEALRSEVSTLKDL-DHLNIVQYL---- 1283

Query: 94   VKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQP 153
                F N      L +EY  GG +   +  R+  R  E  I ++ +Q  +G+A +H+   
Sbjct: 1284 ---GFENKDNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIRHLNTQVLRGLAYLHSRG- 1337

Query: 154  VLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPE 213
             +LHRD+K +N+L   +G  K+ DFG         R  +++ Y   D+    T  +  PE
Sbjct: 1338 -ILHRDMKADNLLLDQDGVCKISDFGIS-------RKSKDI-YSNSDMTMRGTVFWMAPE 1388

Query: 214  MLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYP----AFP 265
            M+D  +G     K DIW+LG  + ++     P+      A +     SK   P      P
Sbjct: 1389 MVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSKSAPPIPPDTLP 1446

Query: 266  IYSDRLKNLIRVMLSENPTKRPNICELL 293
            + S   ++ +      +P  RP    LL
Sbjct: 1447 LISQNGRDFLDACFEIDPDNRPTADNLL 1474

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 103/219 (47%), Gaps = 32/219 (14%)

Query: 85  VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQG 144
           ++S+ +  A+   + N S E+ L++EY +GG L D++ SR   +L E E ++   Q  +G
Sbjct: 170 LISHANVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEG 226

Query: 145 VANMHALQPVLLHRDIKIEN-VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           V+  H+    + HRD+K EN +L   N + K+ DFG     +             + +LK
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNKKIKIADFGMAALEL------------PNKLLK 272

Query: 204 NT--TAQYRCPE--MLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL---- 255
            +  +  Y  PE  M   Y G P    SD+W+ G+ L+ L     PF       +L    
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 HSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLE 294
             K+Q P     S   +NLI  +L  +P KR    E+LE
Sbjct: 329 SGKYQMPMN--LSLEARNLISKILVIDPEKRITTQEILE 365

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 119/264 (45%), Gaps = 32/264 (12%)

Query: 42  TPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNG 101
           T +DT  +     L +  +  +  +  +  E  A++ L N+  VV         S F + 
Sbjct: 197 TSIDTKKRYAAKVLNKEYLIRQKKVKYVSIEKTALQKLNNSPSVVRLF------STFQDE 250

Query: 102 SYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIK 161
           S  +  L+EY   G  +  M  +    L E       +Q    +  +H+    ++HRDIK
Sbjct: 251 S-SLYFLLEYAPNGDFLSLM--KKYGSLDETCARYYAAQIIDAIDYLHSNG--IIHRDIK 305

Query: 162 IENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNT-----TAQYRCPEML- 215
            EN+L  G  + KL DFG+    + P  N   +S  ++D+   +     TA+Y  PE+L 
Sbjct: 306 PENILLDGEMKIKLTDFGT-AKLLNPTNN--SVSKPEYDLSTRSKSFVGTAEYVSPELLN 362

Query: 216 DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQY---PAFPIYSDR 270
           D +     D + DIWA G  L+++     PF+ T E        K QY   P FP+    
Sbjct: 363 DSF----TDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTPGFPLI--- 415

Query: 271 LKNLIRVMLSENPTKRPNICELLE 294
           +++L++ +L +N  +R  I ++ E
Sbjct: 416 IRDLVKKILVKNLDRRLTISQIKE 439

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 124/274 (45%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++      ++   VA   ++ + ++     L +E+   K +++  ++V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHT-NIV 139

Query: 87  SYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVA 146
            ++D       F + +  V +L+E C  G L+D +  R    L+E E+    +Q    V 
Sbjct: 140 QFVD------CFEDDT-NVYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 NMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTT 206
            MH+ +  ++HRD+K+ N+    +   K+ DFG          N +E  Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLA----NDRERKYTV-----CGT 239

Query: 207 AQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----SKFQYP 262
             Y  PE+L   +      + DIW+ GV +Y L     PF+    N I        F +P
Sbjct: 240 PNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVFP 298

Query: 263 AFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
                S     LI+ +LS +P +RP++ E+++ +
Sbjct: 299 KDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 126/290 (43%), Gaps = 46/290 (15%)

Query: 22   ALIK-KYLTSGGFAQIY-AVEITPVDTYSKSNVACLKRVIVP--------TKSGLNTLRA 71
            A IK + +  G F  +Y  + +T         +  +K+V VP        T S L  L++
Sbjct: 1145 AWIKGEIIGKGSFGSVYLGLNVT------TGEMMAVKQVEVPRYGSQDETTLSVLEALKS 1198

Query: 72   EVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSE 131
            EV  +K L ++ ++V Y+        F N ++   L +EY  GG +   +  RL  R  E
Sbjct: 1199 EVSTLKDL-DHVNIVQYL-------GFENKNHVYSLFLEYVAGGSVGSLI--RLFGRFDE 1248

Query: 132  AEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQ 191
              I  +  Q  +G+A +H+    +LHRD+K +N+L   +G  K+ DFG     I    N 
Sbjct: 1249 DLIRFLAVQVLRGLAYLHSKG--ILHRDMKADNLLLDVDGICKISDFG-----ISKKSNN 1301

Query: 192  QELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE 251
                Y   D+    T  +  PEM+D  +G     K DIW+LG  + ++     P+     
Sbjct: 1302 I---YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEV 1356

Query: 252  NAILHSKFQYPAFP--------IYSDRLKNLIRVMLSENPTKRPNICELL 293
             A +    ++ + P        + S   K+ +      +P KRP   +LL
Sbjct: 1357 VAAMFKIGKFKSAPPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTADDLL 1406

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 123/271 (45%), Gaps = 28/271 (10%)

Query: 28  LTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVS 87
           L  G ++ +     T +D+  +  V  L +  +  +  +  +  E +A++ + N++ +V 
Sbjct: 185 LGDGAYSTVMLA--TSIDSKKQYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 88  YIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVAN 147
              +   +S+       +  L+EYC  G  +  M  +    L+E       +Q    +  
Sbjct: 243 LFFTFQDESS-------LYFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDY 293

Query: 148 MHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTA 207
           +H     ++HRDIK EN+L     + KL DFG+         N+ +L       +   TA
Sbjct: 294 LHTNG--IIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKSFV--GTA 349

Query: 208 QYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQY--- 261
           +Y  PE+L D +    +D + D+WA G  LY++     PF+ T E        K QY   
Sbjct: 350 EYVAPELLNDSF----VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFT 405

Query: 262 PAFPIYSDRLKNLIRVMLSENPTKRPNICEL 292
             FP+    +++L++ +L ++  +RP+I ++
Sbjct: 406 AGFPLI---IRDLVKKILVKDLNQRPSISQI 433

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 126/279 (45%), Gaps = 41/279 (14%)

Query: 24  IKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNR 83
           IK+ +  G F  +Y      +D  +   VA     +  T+  ++ L  E+  +  L+   
Sbjct: 38  IKECVGKGSFGDVYRA----IDKETGEMVAVKIINLEETQDDIDVLAQEIYFLSELRAP- 92

Query: 84  HVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQ 143
            V +Y      K+   + S  + ++ME+C GG   D +    ++RL E ++  I+ +   
Sbjct: 93  FVTTY-----YKTYVEDVS--MWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLY 145

Query: 144 GVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           G+  +H+ + +  HRD+K  N+L +  GE KL DFG V G I     +   ++V      
Sbjct: 146 GLEYLHSQRKI--HRDVKAANILLTDEGEVKLGDFG-VSGQIMATLKRN--TFV------ 194

Query: 204 NTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPA 263
             T  +  PE++    G   DEK+DIW+LG+   +L     P+ K     +L +      
Sbjct: 195 -GTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPPYAKYDPMKVLMN------ 245

Query: 264 FPI---------YSDRLKNLIRVMLSENPTKRPNICELL 293
            P+         ++   ++ I + L+++P  RP   +LL
Sbjct: 246 IPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 109/247 (44%), Gaps = 32/247 (12%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNN--RHVVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L  N   +++  +D       F +  Y  +    
Sbjct: 875  ERILVDTWVRDRKLGTIPSEIQIMATLNKNSQENILKLLD------FFEDDDYYYIETPV 928

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F     +  + E E   +  Q    + ++H     ++HRDIK ENV+   +
Sbjct: 929  HGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSH 986

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS   YI+             D+    T  Y  PE+L    Y+G P     D
Sbjct: 987  GFVKLIDFGS-AAYIKSG---------PFDVFVG-TMDYAAPEVLGGSSYKGKP----QD 1031

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWALGV LY + Y   P+    E  IL  + ++      S+   +LI+ +L+    KRP 
Sbjct: 1032 IWALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPT 1089

Query: 289  ICELLEE 295
            I E+ E+
Sbjct: 1090 IDEIYED 1096

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 107/244 (43%), Gaps = 32/244 (13%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  +    H  +++ +D       F +  Y  +    
Sbjct: 1110 ERILVDTWVRDRKLGTIPSEIQIMATISKEPHENILTLLD------FFEDDDYYYIETPV 1163

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F     +  ++E E   +  Q   GV ++H     ++HRDIK EN++    
Sbjct: 1164 HGETGSIDLFDLIEFKTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQ 1221

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  K+ DFGS       P           D+   T   Y  PE+L    Y G P     D
Sbjct: 1222 GFVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGSPYEGKP----QD 1266

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWA+G+ LY + +   PF    E  IL  + ++ +  + S++   LI  +L+ N  KRP 
Sbjct: 1267 IWAIGILLYTIVFKENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPT 1324

Query: 289  ICEL 292
            I ++
Sbjct: 1325 IDDI 1328

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 109/234 (46%), Gaps = 45/234 (19%)

Query: 72  EVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSE 131
           E++A+KLL +   V        ++    N  Y + +++E+  GG    ++  + + RL E
Sbjct: 103 EINALKLLTHPNIV-------RLEEVLQNSKY-IGIVLEFASGGEFYKYL--QRKRRLKE 152

Query: 132 AEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQ 191
                + +Q   GV  MH+    L+HRD+K+EN+L   N    + DFG V  +       
Sbjct: 153 PHACQLFAQLISGVTYMHSKG--LVHRDLKLENLLLDKNENLIITDFGFVNEF------- 203

Query: 192 QELSYVQHDILKNTTAQ--YRCPEML---DLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
               +  ++++K +     Y  PE++   + YR      K DIW+ G+ LY +     P+
Sbjct: 204 ----FGSNELMKRSCGSPCYAAPELVLSTEPYRA----RKVDIWSCGIILYAMLAGYLPW 255

Query: 247 EKTGENA-----------ILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNI 289
           +   +N            I  +  ++PA+   S   ++LIR +L+ NP++R +I
Sbjct: 256 DDDSQNPNGDDIGKLYQYITKTALKFPAY--ISPLARDLIRKILTANPSRRISI 307

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 92/200 (46%), Gaps = 32/200 (16%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++MEYC GG   D +     N L E ++  I+ Q   G+  +H  + +  HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRKI--HRDIKAAN 146

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEM----LDLYRG 220
           +L +  G  KL DFG V G+IR        S  + D     T  +  PE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STFKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS-------KFQYPAFPIYSDRLKN 273
              +EK+DIW+LG+  Y+L     P  K     ++ +       K Q P    +S+  K 
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSEAAKE 247

Query: 274 LIRVMLSENPTKRPNICELL 293
            +   L + P  RP+  +LL
Sbjct: 248 FVAGCLVKTPADRPSAYDLL 267

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 93/197 (47%), Gaps = 27/197 (13%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           E+ L++EY +GG L D++ SR   +L EAE ++   Q  QGV+  H+    + HRD+K E
Sbjct: 226 ELYLILEYVDGGELFDYLVSR--GKLPEAEAIHYFKQIIQGVSYCHSFN--ICHRDLKPE 281

Query: 164 NVL-RSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRG 220
           N+L        K+ DFG     +  P+   + S          +  Y  PE++    Y G
Sbjct: 282 NLLIDKKKKSIKIADFG--MAALELPKKLLQTSC--------GSPHYASPEIVMGKSYHG 331

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYPAFPIYSDRLKNLIR 276
            P    SD+W+ G+ L+ L     PF       +L      K+Q P     SD  K+LI 
Sbjct: 332 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQMPKN--LSDEAKDLIS 385

Query: 277 VMLSENPTKRPNICELL 293
            +L  +P+KR    E+L
Sbjct: 386 RILVVSPSKRLTTVEIL 402

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 125/286 (43%), Gaps = 57/286 (19%)

Query: 31   GGFAQIY-AVEITPVDTYSKSNVACLKRVIVPTKSGLN--TLRAEVDAMKL----LKNNR 83
            G F  ++ A+ IT         +  +K+V VP K GL   T+   VDA++L    LK+  
Sbjct: 1149 GSFGAVFLAMNIT------TGEMMAVKQVEVP-KYGLQNETVVNTVDALRLEVSTLKDLD 1201

Query: 84   H--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQT 141
            H  +V Y+   A      NG Y   L +EY  GG +   +  R+  R  +  I ++  Q 
Sbjct: 1202 HLNIVQYLGFEA-----KNGIYS--LFLEYVAGGSVGSLI--RMYGRFDDILIRHLTIQV 1252

Query: 142  AQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDI 201
             QG++ +H+    +LHRD+K +N+L   +G  K+ DFG              +S   +DI
Sbjct: 1253 LQGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDFG--------------ISRKSNDI 1296

Query: 202  LKNT------TAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL 255
              N+      T  +  PEM+D  +G     K DIW+LG  + ++     P+      A +
Sbjct: 1297 YSNSEMTMKGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAM 1354

Query: 256  HSKFQYPA--------FPIYSDRLKNLIRVMLSENPTKRPNICELL 293
                Q  +         P+ S+  K  +      +P KRP   +LL
Sbjct: 1355 FKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 107/247 (43%), Gaps = 32/247 (12%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNN--RHVVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L  N  ++++  +D       F +  Y  +    
Sbjct: 875  ERILVDTWVRDRKLGTIPSEIQIMATLNKNSQKNILKLLD------FFEDDDYYYIETPV 928

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F     +  + E E   +  Q    + ++H     ++HRDIK ENV+   +
Sbjct: 929  HGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--NQGIVHRDIKDENVIVDSH 986

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS       P           D+    T  Y  PE+L    Y+G P     D
Sbjct: 987  GFVKLIDFGSAAYVKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QD 1031

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWALGV LY + Y   P+    E  IL  + ++      S+    LI+ +L+    KRP 
Sbjct: 1032 IWALGVLLYTIIYKENPYYNIDE--ILEGELRFDKAEKVSEGCIGLIKRILTREVDKRPT 1089

Query: 289  ICELLEE 295
            I E+ E+
Sbjct: 1090 IDEIYED 1096

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 92/176 (52%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K ++H  +V++IDS  +K        ++ ++MEY EGG L D +   +   L+
Sbjct: 642 INEILVMKGSKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 691

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T  G+  +H+    +LHRDIK +N+L S  G+ KL DFG  C  I     
Sbjct: 692 EGQIGAVCRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI----- 743

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
             EL+  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+
Sbjct: 744 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 793

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 90/201 (44%), Gaps = 33/201 (16%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           E+ L++EY EGG L D++ SR   +L E E ++   Q  QGV+  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPE 196

Query: 164 N-VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTA---QYRCPEML--DL 217
           N +L   N   K+ DFG                    D L  T+     Y  PE++    
Sbjct: 197 NLLLDKKNLSVKIADFGMAA-------------LETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 218 YRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYPAFPIYSDRLKN 273
           Y G P    SD+W+ G+ L+ L     PF       +L      K+Q P     S+  K+
Sbjct: 244 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQN--ISNEAKD 297

Query: 274 LIRVMLSENPTKRPNICELLE 294
           LI  +L  +P  R  I E+LE
Sbjct: 298 LIAKILIVDPAMRITIDEVLE 318

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 96/202 (47%), Gaps = 24/202 (11%)

Query: 101 GSY----EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLL 156
           GSY     + ++MEYC GG L   +      ++ E  I  I+ +    +  +H  +  ++
Sbjct: 99  GSYLKNTSLWIIMEYCGGGSLRSLLRP---GKIDEKYIGVIMREILIALKYIH--KDNVI 153

Query: 157 HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD 216
           HRDIK  NVL + +G  KLCDFG      +    +Q ++          T  +  PE+  
Sbjct: 154 HRDIKAANVLINNDGSIKLCDFGVAAQLNQTKSRRQTMA---------GTPYWMAPEV-- 202

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPF-EKTGENAI-LHSKFQYPAFPI--YSDRLK 272
           +  G+  D K+DIW+ G+  Y++     P+ +     A+ L +K + P      YS  +K
Sbjct: 203 IMEGVYYDTKADIWSTGITAYEVTTGNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIK 262

Query: 273 NLIRVMLSENPTKRPNICELLE 294
             I   L E+P++RP   ELL+
Sbjct: 263 EFIATCLDEDPSERPTADELLK 284

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 92/176 (52%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K ++H  +V++IDS  +K        ++ ++MEY EGG L D +   +   L+
Sbjct: 663 INEILVMKGSKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 712

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T  G+  +H+    +LHRDIK +N+L S  G+ KL DFG  C  I     
Sbjct: 713 EGQIGAVCRETLSGLEFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI----- 764

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
             EL+  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+
Sbjct: 765 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 814

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 129/276 (46%), Gaps = 34/276 (12%)

Query: 24  IKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV---PTKSGLNTLRAEVDAMKLLK 80
           I++ +  G F  +Y         + K+N A +   +V    T+  ++ L  E+  +  L+
Sbjct: 17  IQECVGRGNFGDVYK-------AFDKTNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELR 69

Query: 81  NNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQ 140
           +      YI +N + +   + S  + ++MEYC GG   D + +   N L E ++  I  +
Sbjct: 70  S-----PYI-TNYITTMIEDVS--MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITRE 121

Query: 141 TAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHD 200
             +G+  +H  + +  HRDIK  N+L +  G+ KL DFG V G IR     +  ++V   
Sbjct: 122 VLKGLKYLHDQKKI--HRDIKAANILLTDEGKVKLGDFG-VSGQIRA--TMKRGTFV--- 173

Query: 201 ILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--K 258
                T  +  PE+++       +EK+DIW+LG+ +Y+L     P  K     ++ S  +
Sbjct: 174 ----GTPYWMAPEVVN-KESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPR 228

Query: 259 FQYPAF-PIYSDRLKNLIRVMLSENPTKRPNICELL 293
            + P     YSD  K  +   L ++P  RP+   LL
Sbjct: 229 RKPPKLHGQYSDVAKGFVAACLVKDPNLRPSAEMLL 264

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 86/179 (48%), Gaps = 23/179 (12%)

Query: 117 LIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLC 176
           L DF+  +  +++ E E   I  Q   G+ ++H L   ++HRDIK EN++    G  ++ 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGLG--IIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEK-SDIWALGVF 235
           DFGS       P        V H      T  Y  PE+L   +G P + K  D+WALG+ 
Sbjct: 822 DFGSAAYATNGPFQ------VFH-----GTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 236 LYKLCYYTTPFEKTGENAILHSKFQY-PAFPI-YSDRLKNLIRVMLSENPTKRPNICEL 292
           LY + +  TPF    E  I+ ++ +  PA     SD+ + LI  ML +    RP I E+
Sbjct: 868 LYIITFKQTPFNSVAE--IIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86
           YAL017W
          Length = 368

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 123/276 (44%), Gaps = 35/276 (12%)

Query: 28  LTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPT---KSGLNTLRAEVDAMKLLKNNRH 84
           L  G + Q+  V+    + +        +R+++ T        T+ +E+  +  L    H
Sbjct: 113 LGQGAYGQVSLVQNKSTEEFLILKKIFKERILLDTWVRDRKYGTVPSEIHILTKLTELPH 172

Query: 85  --VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGG---LIDFMNSRLQNRLSEAEILNILS 139
             VVS ID       F +  +  + +  + +G G   L DF++ R  + +S+ E   I+ 
Sbjct: 173 DNVVSMID------FFEDDDFYYVEMPIHGQGDGCIELFDFIDIR--DEVSDWECKLIIK 224

Query: 140 QTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQH 199
           Q    +  +H     ++HRDIK EN++    G  +L DFGS    +R P      +++  
Sbjct: 225 QLVSAIKYLHDRD--IVHRDIKDENIIMDARGHIQLIDFGSATNAVRGPFR----TFL-- 276

Query: 200 DILKNTTAQYRCPEMLDLYRGLP-IDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSK 258
                 T  Y  PE+    RG P + +  DIWALG+ LY L +   PF    + AIL   
Sbjct: 277 -----GTIDYEPPEVA---RGEPFLGKPQDIWALGILLYILRFKEPPF--LDQKAILTGD 326

Query: 259 FQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLE 294
            ++P     +    +LI  +LS    +RP I +++E
Sbjct: 327 LKFPQGTSVNTDCIDLINAILSPRVDERPTIDDIVE 362

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 107/244 (43%), Gaps = 32/244 (13%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L    H  ++  +D       F +  Y  +    
Sbjct: 997  ERILVDTWVRDRKLGTIPSEIQIMATLNTKPHENILMLLD------FFEDDEYYYIETPI 1050

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            +   G +  F    L+  ++E E   I  Q   G+ ++H     ++HRDIK ENV+   N
Sbjct: 1051 HGTSGSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLH--DNGIVHRDIKDENVIVDSN 1108

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  K+ DFGS       P           D+   T   Y  PE+L  + Y G P     D
Sbjct: 1109 GFVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QD 1153

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWA+GV LY + +   PF    E  IL +  +  +    SD    LIR +L+   +KRP+
Sbjct: 1154 IWAIGVLLYTIIFKENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPS 1211

Query: 289  ICEL 292
            I ++
Sbjct: 1212 ISKI 1215

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 102/214 (47%), Gaps = 32/214 (14%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           ++ ++MEYC GG + + +      R +E  I  IL +    +  +H     ++HRDIK  
Sbjct: 77  KIWIIMEYCNGGSVRNLIKI---GRFNEIYISVILRELLYALEYIH--HDNIIHRDIKAA 131

Query: 164 NVLRSGNGEFKLCDFGSVCG--YIRPPRNQQELSYVQHDILKNTTAQYRCPEML---DLY 218
           N+L + NG  KLCDFG      + +P R  Q ++          T  +  PE++    LY
Sbjct: 132 NILINQNGGIKLCDFGIAAKLEFSKPKR--QTMA---------GTPYWMAPEVIIESSLY 180

Query: 219 RGLPIDEKSDIWALGVFLYKLCYYTTPF-EKTGENAI-LHSKFQYPAF--PIYSDRLKNL 274
                D K+DIW++G+  Y++     P+ E     A+ L +K + P     +YS  LK  
Sbjct: 181 -----DTKADIWSVGITAYEITTGNPPYCEYDATKAMQLITKLKPPRLEGKMYSKSLKEF 235

Query: 275 IRVMLSENPTKRPNICELLEE--ISSIQGVPCPI 306
           I + L E+P++R    +LLE   I   Q  P  I
Sbjct: 236 IALCLDEDPSERLTSTKLLETEFIKEYQETPTKI 269

>Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON}
           YHL007C (REAL)
          Length = 980

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 92/176 (52%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K ++H  +V++IDS  +K        ++ ++MEY EGG L D +   +   L+
Sbjct: 704 INEILVMKGSKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 753

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T  G+  +H+    +LHRDIK +N+L S  G+ KL DFG  C  I     
Sbjct: 754 EGQIGAVCRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQI----- 805

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
             EL+  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+
Sbjct: 806 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 855

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 95/193 (49%), Gaps = 16/193 (8%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++MEYC GG   + +    +++L+E +   I+S+   G+  +H+ + +  HRDIK  N
Sbjct: 91  MWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVLVGLDYLHSQRKI--HRDIKSAN 148

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPID 224
           +L + NG  KL DFG V G +   R +              T  +  PE++D  +    +
Sbjct: 149 ILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV---------GTPFWMAPEVIDRNKK-GYN 197

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQYPAFPI-YSDRLKNLIRVMLSE 281
           E +DIW+LG+ + +L     P +K      L +  K   P     +S   K+ +   L +
Sbjct: 198 EMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHAKDFVAQCLIK 257

Query: 282 NPTKRPNICELLE 294
           +P++RP   ELL+
Sbjct: 258 DPSQRPTASELLK 270

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 90/195 (46%), Gaps = 28/195 (14%)

Query: 108 LMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLR 167
           ++E+  GG L+  +  R   RL E     I SQ    V  MHA    ++HRD+K ENVL 
Sbjct: 90  VLEFVSGGELLGLV--RRMGRLPEEWCRRIASQLVDTVDYMHAKG--VIHRDLKPENVLL 145

Query: 168 SGNGEFKLCDFGSVC----GYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPI 223
           S  G   + DFG+ C    G   P    +  S+V        TA+Y  PE+L L+     
Sbjct: 146 SQEGRIVITDFGAACCASEGGSAPGAADRAASFV-------GTAEYVSPELL-LHSQCSF 197

Query: 224 DEKSDIWALGVFLYKLCYYTTPFEKTGE------NAILHSKFQYPAFPIYSDRLKNLIRV 277
              SD+WALG  +Y+L     PF    E         L  ++ Y A P+    +  L++ 
Sbjct: 198 G--SDVWALGCIIYQLTQGAPPFRGDTELQSFEKIVALDYRWVYAAPPL----IVALVQS 251

Query: 278 MLSENPTKRPNICEL 292
           +L  +P +RP+  +L
Sbjct: 252 ILVLDPLQRPSAKQL 266

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 92/195 (47%), Gaps = 22/195 (11%)

Query: 104 EVLLLMEYCEGGGLIDFMN-SRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKI 162
           ++ ++MEYC GG L   +   ++  +     + N+L      VA ++  +  ++HRDIK 
Sbjct: 94  KLWVIMEYCAGGSLRTLLRPGKIDEKYLGVIVRNLL------VALLYIHKDNVIHRDIKA 147

Query: 163 ENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLP 222
            NVL +  G  KLCDFG           +Q ++          T  +  PE+  +  G+ 
Sbjct: 148 ANVLITNGGHVKLCDFGVAAQLTTANHKRQTMA---------GTPYWMAPEV--IMEGVY 196

Query: 223 IDEKSDIWALGVFLYKLCYYTTPF-EKTGENAI-LHSKFQYPAFPI--YSDRLKNLIRVM 278
            + K+DIW+LG+  Y++     P+ +     A+ L +K + P      YS  LK  I + 
Sbjct: 197 YNTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALC 256

Query: 279 LSENPTKRPNICELL 293
           L E+P  RP   ELL
Sbjct: 257 LDEDPEARPTAEELL 271

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 91/199 (45%), Gaps = 31/199 (15%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           E+ L++EY +GG L D++ SR   RLSE E ++   Q  +G A  H+    + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSFN--ICHRDLKPE 186

Query: 164 N-VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNT--TAQYRCPE--MLDLY 218
           N +L   N   K+ DFG                   + +L+ +  +  Y  PE  M   Y
Sbjct: 187 NLLLDKKNKRIKIADFGMAA------------LQTSNKLLETSCGSPHYASPEIVMGKTY 234

Query: 219 RGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYPAFPIYSDRLKNL 274
            G P    SD+W+ G+ L+ L     PF       +L      K+Q P     S   ++L
Sbjct: 235 NGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--AISLEAQDL 288

Query: 275 IRVMLSENPTKRPNICELL 293
           I  +L  +P KR  I ++L
Sbjct: 289 ISRILVVDPNKRITINDIL 307

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 91/199 (45%), Gaps = 31/199 (15%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           E+ L++EY +GG L D++ SR   +L E E ++   Q  QGVA  HA    + HRD+K E
Sbjct: 173 ELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPE 228

Query: 164 N-VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTA---QYRCPE--MLDL 217
           N +L   N   K+ DFG     +              D L +T+     Y  PE  M   
Sbjct: 229 NLLLDKKNKIIKIADFGMAALEVS-------------DKLLSTSCGSPHYASPEIVMGKS 275

Query: 218 YRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSD---RLKNL 274
           Y G P    +D+W+ G+ L+ L     PF       +L  K Q   + + SD     K+L
Sbjct: 276 YHGSP----TDVWSCGIILFALLTGHLPFNHDNIKKLLL-KVQSGVYHMPSDLSPDAKDL 330

Query: 275 IRVMLSENPTKRPNICELL 293
           I  +L  +P KR    E+L
Sbjct: 331 ISKILVVDPDKRLTTTEIL 349

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 96/199 (48%), Gaps = 31/199 (15%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           E+ L++EY +GG L D++ S+   +L+E+E ++   Q   G++  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 164 NVLRSGNGE-FKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTA--QYRCPEML--DLY 218
           N+L        K+ DFG                 V + +L+ +     Y  PE++    Y
Sbjct: 265 NLLLDKKRRIIKIADFGMAAL------------QVSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 219 RGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYPAFPIYSDRLKNL 274
            G P    SDIW+ G+ L+ L     PF       +L    + ++Q P++   S   KNL
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNL 366

Query: 275 IRVMLSENPTKRPNICELL 293
           I  +L  +P+KR +  ++L
Sbjct: 367 ISRILVVDPSKRISTEQIL 385

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 104/237 (43%), Gaps = 35/237 (14%)

Query: 66   LNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNS 123
            L T+ +E+  M  L    H  ++  ID       F +  Y  L    + E G +  F   
Sbjct: 1086 LGTIPSEIQIMYTLNRKPHDNILRMID------FFEDDQYYYLETPVHGESGCIDLFDLI 1139

Query: 124  RLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCG 183
              +  ++E E   I  Q A G+ ++H+L   ++HRDIK ENV+    G  K+ DFGS   
Sbjct: 1140 EFRTDMTEDEAKLIFKQVASGLQHLHSLG--IVHRDIKDENVIIDSKGYVKIIDFGSA-- 1195

Query: 184  YIRPPRNQQELSYVQH---DILKNTTAQYRCPEML--DLYRGLPIDEKSDIWALGVFLYK 238
                       +YV++   D+   T   Y  PE+L  + Y G P     DIWALG+ LY 
Sbjct: 1196 -----------AYVKNGPFDVFVGTI-DYAAPEVLAGNPYEGKP----QDIWALGILLYT 1239

Query: 239  LCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEE 295
            + +   PF    E  I+     +      +     LI+ ML +   KRP+I E+  +
Sbjct: 1240 IIFKENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDINEVFSD 1294

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 130/292 (44%), Gaps = 50/292 (17%)

Query: 23  LIKKYLTSGGFAQI----YAVEITPVDTYSKSNVACLKRVIVPTKSGLNT-LRAEVDAMK 77
           ++   L  G F ++         + +D   +  +  ++R  +P  S     +  E++A+K
Sbjct: 41  IVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIPKNSEKEVKIYREINALK 100

Query: 78  LLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNI 137
            L N+ ++V       ++    N  Y + +++EY  GG    ++  +   RL E+    +
Sbjct: 101 HL-NHPNIVR------LEEVLQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKESAACRL 150

Query: 138 LSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYV 197
            +Q   GV  MH+    L+HRD+K+EN+L   N    + DFG V  ++  P N       
Sbjct: 151 FAQLISGVYYMHSKG--LVHRDLKLENLLLDKNENLLITDFGFVNEFL--PEN------- 199

Query: 198 QHDILKNTTAQ--YRCPEMLDLYRGLPID-EKSDIWALGVFLYKLCYYTTPFEKTGENA- 253
             +++K +     Y  PE++   R  P +  K+DIW+ GV +Y +     P++   EN  
Sbjct: 200 --ELMKTSCGSPCYAAPELVVTAR--PYEARKADIWSCGVIMYAMLAGYLPWDDDPENPD 255

Query: 254 ----------ILHSKFQYPAF--PIYSDRLKNLIRVMLSENPTKRPNICELL 293
                     I  +  ++P +  P+  D    L+R +L  +P KR  I + L
Sbjct: 256 GDDIGKLYRYITRTPLKFPDYIAPVPRD----LLRAILVADPKKRITIAQTL 303

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 105/244 (43%), Gaps = 32/244 (13%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L    H  ++  +D       F +  Y  +    
Sbjct: 1155 ERILVDTWVRDRKLGTIPSEIQIMATLNKKPHENILRLLD------FFEDDEYYYIETPV 1208

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F      + ++E EI  +  Q   GV ++H     ++HRDIK EN++    
Sbjct: 1209 HGETGSIDLFDLIEFTSNMTEFEIKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDNK 1266

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  K+ DFGS       P           D+   T   Y  PE+L  + Y G P     D
Sbjct: 1267 GFIKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGKP----QD 1311

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWALG+ LY + +   PF    E  IL    ++      S     LI+++L+ N  KRP 
Sbjct: 1312 IWALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLILNRNVFKRPT 1369

Query: 289  ICEL 292
            I ++
Sbjct: 1370 IDDI 1373

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 89/200 (44%), Gaps = 19/200 (9%)

Query: 98   FNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLH 157
            F +  Y  L    + + G +  F     ++ ++E E   I  Q   G+ ++H     ++H
Sbjct: 1021 FEDDDYYYLETPPHGQTGSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVH 1078

Query: 158  RDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDL 217
            RDIK ENV+    G  KL DFGS       P           D+   T   Y  PE+L  
Sbjct: 1079 RDIKDENVIVDSKGFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG- 1126

Query: 218  YRGLPIDEKS-DIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIR 276
              G P + KS DIWA+G+ LY L Y   PF    E  IL  + ++      S   K LI 
Sbjct: 1127 --GNPYEGKSQDIWAIGILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALIT 1182

Query: 277  VMLSENPTKRPNICELLEEI 296
             +L+    KRP I E+ +++
Sbjct: 1183 KILNRCVRKRPTIDEICQDV 1202

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 100/209 (47%), Gaps = 28/209 (13%)

Query: 85  VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQG 144
           ++S+ +  A+   + N S E+ L++EY +GG L D++ S+   +LSE E ++   Q  QG
Sbjct: 192 LISHPNVMALYEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQG 248

Query: 145 VANMHALQPVLLHRDIKIEN-VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           V+  H+    + HRD+K EN +L   N   K+ DFG     +  P    + S        
Sbjct: 249 VSYCHSFN--ICHRDLKPENLLLDKKNKSIKIADFG--MAALELPNKLLQTSC------- 297

Query: 204 NTTAQYRCPEML--DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HS 257
             +  Y  PE++    Y G P    SD+W+ G+ L+ L     PF       +L      
Sbjct: 298 -GSPHYASPEIVMGKSYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAG 352

Query: 258 KFQYPAFPIYSDRLKNLIRVMLSENPTKR 286
           KF+ P+    S   ++LI  +L  +P+KR
Sbjct: 353 KFRMPS--TLSPEAQDLISRILVIDPSKR 379

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 90/199 (45%), Gaps = 31/199 (15%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           E+ L++EY +GG L D++ SR   +L E E ++   Q  QGV+  H+    + HRD+K E
Sbjct: 216 ELYLVLEYVDGGELFDYLVSR--GKLGEREAVHYFKQIVQGVSYCHSFN--ICHRDLKPE 271

Query: 164 N-VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNT--TAQYRCPE--MLDLY 218
           N +L   N   K+ DFG                 V + +L+ +  +  Y  PE  M   Y
Sbjct: 272 NLLLDKKNKSIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGRPY 319

Query: 219 RGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYPAFPIYSDRLKNL 274
            G P    SD+W+ G+ L+ L     PF       +L      KF  P     S   K+L
Sbjct: 320 HGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMPQN--LSAEAKDL 373

Query: 275 IRVMLSENPTKRPNICELL 293
           +  +L  NP KR    E+L
Sbjct: 374 MSKILVVNPFKRIATEEIL 392

>KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {ON}
           Anc_3.60 YNL298W
          Length = 883

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 110/238 (46%), Gaps = 36/238 (15%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFM-----NSRL 125
           V+ + ++K+++H  +V++I+S      +     ++ ++MEY EGG L D +     N   
Sbjct: 649 VNEIHVMKDSKHKNIVNFIES------YLKTEDDLWVVMEYMEGGSLTDIIENSPTNGST 702

Query: 126 QNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYI 185
            + L+E +I  I+ +T QG+  +H     ++HRDIK +NVL   +   K+ DFG  C  +
Sbjct: 703 HSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTHARVKITDFG-FCAKL 759

Query: 186 RPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTP 245
              RN++             T  +  PE++   +    DEK D+W+LG+   ++     P
Sbjct: 760 TDQRNKRATMV--------GTPYWMAPEVV---KQREYDEKVDVWSLGIMAIEMLESEPP 808

Query: 246 FEKTGENAILH-------SKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296
           +        L+        K +YP     S  +K  + V L  +   R +  ELL  +
Sbjct: 809 YLNEDPLKALYLIATNGTPKLKYPE--TLSLEIKRFLSVCLCVDVRYRASTEELLHHV 864

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 25/175 (14%)

Query: 72  EVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSE 131
           E+  MK  K+ R++V++IDS  +K        ++ ++MEY EGG L D +   +   L+E
Sbjct: 700 EIMVMKGSKH-RNIVNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTE 748

Query: 132 AEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQ 191
            +I  +  +T  G+  +H+    ++HRDIK +N+L S  GE KL DFG  C  I      
Sbjct: 749 GQIGAVCRETLAGLQFLHSKG--VIHRDIKSDNILLSMTGEIKLTDFG-FCAQIN----- 800

Query: 192 QELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
            E++  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+
Sbjct: 801 -EINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 849

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 124/283 (43%), Gaps = 35/283 (12%)

Query: 24  IKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNR 83
           +K+ +  G +  +Y       D      V  +K ++      LN + AE+ ++    NN 
Sbjct: 27  LKQVIGRGSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEI-SLLKNLNNN 80

Query: 84  HVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQ 143
           ++V Y         F   SYE+ +L+EYC  G L   + SR    LSE E    ++QT  
Sbjct: 81  NIVKY-------HGFIRKSYELYILLEYCANGSLRRLV-SRSPTGLSENESKTYVTQTLW 132

Query: 144 GVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           G+  +H     ++HRDIK  N+L S +   KL DFG     +    N   L+        
Sbjct: 133 GLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALTLAG----- 180

Query: 204 NTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPA 263
             T  +  PE+L   RG      SDIW+LG  + +L     P+    +  I ++      
Sbjct: 181 --TLNWMAPEILG-NRG--ASTLSDIWSLGATVVELLTKNPPYHNLTDANIYYAVENDTY 235

Query: 264 FP--IYSDRLKNLIRVMLSENPTKRPNICELLEE--ISSIQGV 302
           +P   +S+ LK+ +     +N  KRP   +LL+   I+S + V
Sbjct: 236 YPPTAFSESLKDFLSKCFVKNMYKRPTADQLLKHAWITSTENV 278

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 89/200 (44%), Gaps = 25/200 (12%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           V L MEYC GG     + +R    +SE +     S+    +  +H L    ++RD+K EN
Sbjct: 509 VYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLLG--FIYRDLKPEN 566

Query: 165 VLRSGNGEFKLCDFG---SVCGYIRP-PRNQQELSYVQHDILKNT--------TAQYRCP 212
           +L   +G   L DF          +P  R   + S V   +            T +Y  P
Sbjct: 567 ILLHKSGHIMLSDFDLSVQANDAAKPVKRVATQSSMVDTKVFSEGFRTNSFVGTEEYIAP 626

Query: 213 EMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENA------ILHSKFQYPAFPI 266
           E++   RG       D W LG+ +Y++ +  TPF+  GEN       IL ++  +P    
Sbjct: 627 EVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFK--GENTNETFCNILKNEVTFPEHHE 681

Query: 267 YSDRLKNLIRVMLSENPTKR 286
            S   K+LIR +LS+N +KR
Sbjct: 682 ISRHCKDLIRKLLSKNESKR 701

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 93/202 (46%), Gaps = 24/202 (11%)

Query: 101 GSY----EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLL 156
           GSY     + ++MEYC GG L   +      ++ E  I  I+ +    +  +H  +  ++
Sbjct: 80  GSYLRGTSLWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKVIH--KDNVI 134

Query: 157 HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD 216
           HRDIK  NVL +  G+ KLCDFG      +    +Q ++          T  +  PE+  
Sbjct: 135 HRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEV-- 183

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKT----GENAILHSKFQYPAFPIYSDRLK 272
           +  G+  D K DIW+LG+  Y++     P+           I+ SK        Y+ +LK
Sbjct: 184 IMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLK 243

Query: 273 NLIRVMLSENPTKRPNICELLE 294
             I + L E+P +R +  ELL+
Sbjct: 244 EFIALCLDEDPQERLSAEELLK 265

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 93/196 (47%), Gaps = 24/196 (12%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++MEYC GG   D +     N L E ++  I+ Q   G+  +H  + +  HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRKI--HRDIKAAN 141

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEM----LDLYRG 220
           +L +  G  KL DFG V G++R        S ++ D     T  +  PE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLR--------STMKRDTFVG-TPYWMAPEVVCCEVDGY-- 189

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQYPAFP-IYSDRLKNLIRV 277
              +EK+DIW+LG+  Y+L     P  K     ++ +  K + P     +SD  K  +  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAG 246

Query: 278 MLSENPTKRPNICELL 293
            L + P  RP+  +LL
Sbjct: 247 CLVKVPADRPSAYDLL 262

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 113/263 (42%), Gaps = 31/263 (11%)

Query: 48  SKSNVACLKRVIVPTKSGLNTLRAEVDAMKLL--KNNRHVVSYIDSNAVKSAFNNGSYEV 105
           S+  +   K+V  P K     +  E++  K++   ++ H+V      A++ AF  G    
Sbjct: 62  SEDRIFAGKKVHCPNKENKRKIIKELEIYKVICRSHHNHIV------ALRDAFQWGKESC 115

Query: 106 L-LLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++++YC    L   +  R    L+E E   ++ Q   G+  +H     ++H D+K+ N
Sbjct: 116 IYMILDYCSNNSLQSILQYR--GSLNEVECKELMIQLCGGIYWLHLNN--VIHGDLKLSN 171

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYR---CPEMLDLYRGL 221
           +L     + K+CDFGS       PR   E+    + +   T   ++      M  L    
Sbjct: 172 ILFDEGQQLKICDFGSSFIATSSPRGPGEIMGTPYYLAPETVYTHKNINKSGMAILLISF 231

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGENA-----------ILHSKFQYPAFPIYSDR 270
           PI    DIW++G+ LY L Y   PF K+ +             I     ++P        
Sbjct: 232 PI----DIWSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAG 287

Query: 271 LKNLIRVMLSENPTKRPNICELL 293
            + LI  MLS+NP +R  + E++
Sbjct: 288 AQQLILKMLSQNPLERITLVEIV 310

>NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {ON}
           Anc_6.262 YPL236C
          Length = 406

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 81/154 (52%), Gaps = 11/154 (7%)

Query: 157 HRDIKIENVLRSGNGEFKLCDFGSVC-GYIRPPRNQQELSYVQHDILKNTTAQYRCPEML 215
           HR+IK  N+L S +G   + D  S     I     +Q L + +  I    +  +  PE+L
Sbjct: 251 HRNIKPSNILFSSDGSQVISDLSSTSKSNIHLKTGKQILDFKEW-IDSCCSVPFMSPELL 309

Query: 216 DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK----TGENA---ILHSKFQYP-AFPIY 267
           DL  G  IDEK DIW+LG  +Y +    +PFE+    TG++    IL + F +P     +
Sbjct: 310 DLKMGSKIDEKVDIWSLGCTIYTIILGVSPFEREVQLTGKSIRMLILSANFTFPEGMERH 369

Query: 268 SDR-LKNLIRVMLSENPTKRPNICELLEEISSIQ 300
           + R L + I+  L  +PTKRP I +LL ++ ++Q
Sbjct: 370 ASRELIDTIKQCLQVDPTKRPTINQLLNDLQALQ 403

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 93/196 (47%), Gaps = 24/196 (12%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++MEYC GG   D +     N L E ++  I+ Q   G+  +H  + +  HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRKI--HRDIKAAN 141

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEM----LDLYRG 220
           +L +  G  KL DFG V G+IR        S ++ D     T  +  PE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIR--------STMKRDTFVG-TPYWMAPEVVCCEVDGY-- 189

Query: 221 LPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQYPAFP-IYSDRLKNLIRV 277
              +EK+DIW+LG+  Y+L     P  K     ++ +  K + P     +S+  K  +  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAG 246

Query: 278 MLSENPTKRPNICELL 293
            L + P  RP+  +LL
Sbjct: 247 CLVKAPADRPSAYDLL 262

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 103/218 (47%), Gaps = 32/218 (14%)

Query: 85  VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQG 144
           ++S+ +  A+   + N S E+ L++EY +GG L D++ S+   +L E E ++   Q  +G
Sbjct: 170 LISHANVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 VANMHALQPVLLHRDIKIEN-VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           V+  H+    + HRD+K EN +L   N + K+ DFG     +             + +LK
Sbjct: 227 VSFCHSFN--ICHRDLKPENLLLDKKNRKIKIADFGMAALEL------------PNKLLK 272

Query: 204 NT--TAQYRCPEML--DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL---- 255
            +  +  Y  PE++    Y G P    SD+W+ G+ L+ L     PF       +L    
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 HSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELL 293
             K+Q P     S   ++LI  +L  NP KR    E+L
Sbjct: 329 SGKYQMPMN--LSAEARDLISKILVINPEKRITTQEIL 364

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 135/298 (45%), Gaps = 33/298 (11%)

Query: 8   LYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLN 67
           ++   T++  G         L  G ++Q++ +  +  D+     V  L +  +  +  + 
Sbjct: 104 IFRRQTIIRKGIKDFKFGDMLGDGSYSQVF-LATSKTDSSKTYAVKVLNKEYLIKQKKVK 162

Query: 68  TLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQN 127
            +  E  A++ LK+   V++      +   F + +  +  L+EY   G  +  +  +   
Sbjct: 163 YVNIEKTALQNLKSVTGVIN------LSFTFQDEA-NLYFLLEYAPNGDFLSLI--KKFG 213

Query: 128 RLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRP 187
            L+E   +   +Q    + +MH+    ++HRDIK EN+L  GN + KL DFG+     + 
Sbjct: 214 TLNEECTIYYSAQIIDAIGSMHSHG--IIHRDIKPENILLDGNMKIKLTDFGTAKLLQKK 271

Query: 188 PRNQQELSYVQHDILKNT-----TAQYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCY 241
                +  Y   ++L  +     TA+Y  PE+L D Y     D K DIWA G  +Y++  
Sbjct: 272 SDKNGKPHY---NLLTRSSSFVGTAEYVSPELLSDNY----TDYKCDIWAFGCLVYQMIA 324

Query: 242 YTTPFEKTGE----NAILHSKFQYPA-FPIYSDRLKNLIRVMLSENPTKRPNICELLE 294
              PF+ T E      ++  +F + A FP     +++L++ +L + P KR  I ++ E
Sbjct: 325 GKPPFKATNEYLTFQKVMKVQFAFTAGFPTI---IRDLVKNILVKQPEKRLTIPQIKE 379

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 110/227 (48%), Gaps = 22/227 (9%)

Query: 74  DAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEV--LLLMEYCEGGGLIDFMNSRLQNRLSE 131
           D + +L    + +S + +  V + F     +V   ++ME+C GG   D +    ++RLSE
Sbjct: 77  DDIDVLAQEIYFLSELRAPFVTTYFKTFVEDVSMWIVMEFCGGGSCADLLKHLPEHRLSE 136

Query: 132 AEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQ 191
            ++  I+ +   G+  +H+ + +  HRDIK  N+L + +GE KL DFG V G I      
Sbjct: 137 NKVAYIIREVLFGLDYLHSQKKI--HRDIKAANILLTDDGEVKLGDFG-VSGQIMA--TL 191

Query: 192 QELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE 251
           +  ++V        T  +  PE++   +    +EK+DIW+LG+   +L     P+ K   
Sbjct: 192 KRTTFV-------GTPYWMAPEII-AKKDNGYNEKADIWSLGITAIELLTGQPPYAKHDP 243

Query: 252 NAIL-HSKFQYPAFPIYSDRL----KNLIRVMLSENPTKRPNICELL 293
             +L +   + P  P    R     ++ I + L ++P  RP+  ELL
Sbjct: 244 MKVLVNIPLRKP--PKLQGRFTGSARDFIALCLIKDPDLRPSAAELL 288

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 125/290 (43%), Gaps = 46/290 (15%)

Query: 22   ALIK-KYLTSGGFAQIY-AVEITPVDTYSKSNVACLKRVIVP--------TKSGLNTLRA 71
            A IK + +  G F  +Y  + +T         +  +K+V VP        T S +  LR+
Sbjct: 1173 AWIKGEMIGKGSFGAVYLGLNVT------TGEMMAVKQVEVPKFGSQDEATISVVEALRS 1226

Query: 72   EVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSE 131
            EV  +K L ++ ++V Y+        F N +    L +EY  GG +   +  RL  R  E
Sbjct: 1227 EVSTLKNL-DHLNIVQYL-------GFENKNSIYSLFLEYVAGGSVGSLI--RLYGRFDE 1276

Query: 132  AEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQ 191
            + I  +  Q  +G++ +H+    +LHRD+K +N+L   +G  K+ DFG         R  
Sbjct: 1277 SLIRFLTVQVLRGLSYLHSRG--ILHRDMKADNLLLDLDGVCKISDFGIS-------RKS 1327

Query: 192  QELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE 251
             ++ Y   D+    T  +  PEM+D  +G     K DIW+LG  + ++     P+     
Sbjct: 1328 NDI-YCNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEV 1384

Query: 252  NA----ILHSKFQYP----AFPIYSDRLKNLIRVMLSENPTKRPNICELL 293
             A    I  SK   P      P+ S   +  +      +P +RP    LL
Sbjct: 1385 VAAMFKIGKSKTAPPIPEDTLPLISKEGREFLDACFEIDPERRPTADTLL 1434

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 116/230 (50%), Gaps = 31/230 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K ++H  +V++IDS  ++        ++ ++MEY EGG L D +   +   L+
Sbjct: 710 INEILVMKASKHANIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 759

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T +G+  +H+    ++HRDIK +NVL S +GE KL DFG  C  I     
Sbjct: 760 EGQIGAVSRETLKGLQFLHSKG--VIHRDIKSDNVLLSMSGEIKLTDFG-FCAQI----- 811

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF-EKT 249
             E++  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+  +T
Sbjct: 812 -NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 865

Query: 250 GENAI-LHSKFQYPAFP---IYSDRLKNLIRVMLSENPTKRPNICELLEE 295
              A+ L +    P        SD LK+ +   L  NP +R    +LL +
Sbjct: 866 PLRALYLIATNGTPELKDADSLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 94/196 (47%), Gaps = 17/196 (8%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           +  L+EY   G L+  +  +      E   +   +Q    +  +H++   ++HRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNT-----TAQYRCPEML-DLY 218
           +L + + + KL DFG+    + P +  Q  S    ++L+ +     TA+Y  PE+L D Y
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 219 RGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQYPAFPIYSDRLKNLIR 276
                D + DIWA G  L++L     PF+ T E        K QY     +   L++LI+
Sbjct: 449 ----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIK 504

Query: 277 VMLSENPTKRPNICEL 292
            +L +NP  R  I ++
Sbjct: 505 KILIKNPNNRLTIHQI 520

>KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} similar
           to uniprot|P48562 Saccharomyces cerevisiae YNL298W CLA4
           Involved in localizing cell growth with respect to the
           septin ring protein kinase homologous to Ste20p
           interacts with CDC42
          Length = 879

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 99/201 (49%), Gaps = 26/201 (12%)

Query: 51  NVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLME 110
           N   +K++I+  +     +  E+  MK  K+N ++V++++      A+     ++ ++ME
Sbjct: 626 NKVAIKQMILSKQPRKELIVNEILVMKDSKHN-NIVNFLE------AYLKTEDDLWVVME 678

Query: 111 YCEGGGLIDFM-----NSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENV 165
           Y EGG L D +      S  Q+ L+E +I  I+ +T QG+  +H     ++HRDIK +NV
Sbjct: 679 YMEGGSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNV 736

Query: 166 LRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDE 225
           L    G  K+ DFG  C  +   R+++             T  +  PE++   +    DE
Sbjct: 737 LLDTRGRVKITDFG-FCAKLTDKRSKRATMV--------GTPYWMAPEVV---KQREYDE 784

Query: 226 KSDIWALGVFLYKLCYYTTPF 246
           K D+W+LG+   ++     P+
Sbjct: 785 KVDVWSLGIMTIEMLESEPPY 805

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 92/202 (45%), Gaps = 24/202 (11%)

Query: 101 GSY----EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLL 156
           GSY     + ++MEYC GG L   +      ++ E  I  I+ +    +  +H  +  ++
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMREVLVALKCIH--KDNVI 141

Query: 157 HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD 216
           HRDIK  NVL +  G  KLCDFG      +    +Q ++          T  +  PE+  
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEV-- 190

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKT----GENAILHSKFQYPAFPIYSDRLK 272
           +  G+  D K DIW+LG+  Y++     P+ +         I+ SK        YS  LK
Sbjct: 191 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSKPPRLEGRSYSPSLK 250

Query: 273 NLIRVMLSENPTKRPNICELLE 294
             I + L E+P +R +  +LL+
Sbjct: 251 EFIALCLDEDPKERLSADDLLK 272

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 94/216 (43%), Gaps = 48/216 (22%)

Query: 107 LLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVL 166
           +L EY  GG L+D++       L E          A  +  +HA    ++HRD+KIEN++
Sbjct: 202 MLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLKIENIM 257

Query: 167 RSGNGEFKLCDFG------------SVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEM 214
            S +GE K+ DFG            + CG          L +   ++LK     Y  PE+
Sbjct: 258 ISTSGEIKIIDFGLSNVFDTRKQLHTFCG---------SLYFAAPELLKANP--YIGPEV 306

Query: 215 LDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKF-----QYPAFPIYSD 269
                        DIW+ GV LY L     PF+    +++LH K      +YP     S 
Sbjct: 307 -------------DIWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPNH--LSI 350

Query: 270 RLKNLIRVMLSENPTKRPNICELLEEISSIQGVPCP 305
            + +L+  ML  +P KR N+ +++E    I+G   P
Sbjct: 351 EVISLLSKMLVVDPLKRANLTKVIEHPWMIRGYDFP 386

>Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL045W
            (REAL)
          Length = 1106

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 107/247 (43%), Gaps = 32/247 (12%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNN--RHVVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L  N   +++  +D       F +  Y  +    
Sbjct: 880  ERILVDTWVRDRKLGTIPSEIQIMATLNKNPQENILRLLD------FFEDDDYYYIETPV 933

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F     +  + E E   +  Q    + ++H     ++HRDIK EN++   +
Sbjct: 934  HGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVSSIKHLH--DQGIVHRDIKDENIIVDSH 991

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  KL DFGS       P           D+    T  Y  PE+L    Y+G P     D
Sbjct: 992  GFVKLIDFGSAAYTKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QD 1036

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWALGV LY + Y   P+    E  IL  + ++      SD   +LI+ +L+    KRP 
Sbjct: 1037 IWALGVLLYTIIYKENPYYNIDE--ILEGELRFDNAENVSDECISLIKGILTREVDKRPT 1094

Query: 289  ICELLEE 295
            I ++ ++
Sbjct: 1095 IDDIYQD 1101

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 108/256 (42%), Gaps = 37/256 (14%)

Query: 52   VACLK-----RVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNG 101
            + C+K     R++V T      L T+ +E+  M  L    H  ++  +D       F + 
Sbjct: 1176 IVCIKMIFKERILVDTWVRDRKLGTIPSEIQIMATLNKKPHENILRLLD------FFEDD 1229

Query: 102  SYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIK 161
            +Y  +    + E G +  F     +  ++E E   I  Q   G+ ++H     ++HRDIK
Sbjct: 1230 NYYYIETPIHGETGCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIK 1287

Query: 162  IENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYR 219
             ENV+    G  K+ DFGS       P           D+   T   Y  PE+L  + Y 
Sbjct: 1288 DENVIVDSKGLVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGEPYE 1336

Query: 220  GLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVML 279
            G P     DIWALG+ LY + +   PF    E  IL    ++ +    ++    LI+ +L
Sbjct: 1337 GKP----QDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVL 1390

Query: 280  SENPTKRPNICELLEE 295
                  RP I E+ ++
Sbjct: 1391 IRQVRNRPAIDEIFDD 1406

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 105/219 (47%), Gaps = 32/219 (14%)

Query: 85  VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQG 144
           ++S+ +  A+   + N S E+ L++EY +GG L D++ S+   +L E E ++   Q  +G
Sbjct: 170 LISHTNVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 VANMHALQPVLLHRDIKIEN-VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           V+  H+    + HRD+K EN +L   N   K+ DFG     +  P          + +LK
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFG--MAALELP----------NKLLK 272

Query: 204 NT--TAQYRCPEML--DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL---- 255
            +  +  Y  PE++    Y G P    SD+W+ G+ L+ L     PF       +L    
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 HSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLE 294
             K+Q P+    S   ++LI  +L  +P KR    E+L+
Sbjct: 329 SGKYQMPSN--LSSEARDLISKILVIDPEKRITTQEILK 365

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 90/199 (45%), Gaps = 31/199 (15%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           E+ L++EY +GG L D++ SR   RL E E ++   Q  +G A  H     + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPE 186

Query: 164 N-VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNT--TAQYRCPE--MLDLY 218
           N +L   N   K+ DFG                   + +L+ +  +  Y  PE  M   Y
Sbjct: 187 NLLLDKKNKRIKIADFGMAA------------LQTSNKLLETSCGSPHYASPEIVMGKNY 234

Query: 219 RGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYPAFPIYSDRLKNL 274
            G P    SD+W+ G+ L+ L     PF       +L      K+Q P     S   ++L
Sbjct: 235 NGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQS--VSSGAQDL 288

Query: 275 IRVMLSENPTKRPNICELL 293
           I  +L  +P KR +I E+L
Sbjct: 289 ISRILVVDPDKRISINEIL 307

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 90/201 (44%), Gaps = 33/201 (16%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           E+ L++EY EGG L D++ S+   +L E+E ++   Q  Q VA  H     + HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPE 203

Query: 164 NVLRSGNG-EFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTA---QYRCPEML--DL 217
           N+L        K+ DFG                    D L  T+     Y  PE++    
Sbjct: 204 NLLLDKKKRSIKIADFGMAA-------------LETSDKLLETSCGSPHYASPEIVLGRK 250

Query: 218 YRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYPAFPIYSDRLKN 273
           Y G P    SD+W+ G+ L+ L     PF       +L      K+Q P +   S   K+
Sbjct: 251 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKD 304

Query: 274 LIRVMLSENPTKRPNICELLE 294
           LI  +L  +P +R  I ++L+
Sbjct: 305 LISRILVVDPNRRITIDQILQ 325

>TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86
           YAL017W
          Length = 959

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 81/182 (44%), Gaps = 26/182 (14%)

Query: 117 LIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLC 176
           L D ++S+    LSE E   I  Q    V + H L   + HRDIK +NV+    G  KL 
Sbjct: 794 LFDIIDSK--QELSEIEYKLIFKQIVSAVKHSHTLG--IAHRDIKEQNVIIDSRGHCKLI 849

Query: 177 DFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDL--YRGLPIDEKSDIWALGV 234
           DFGS       P     LS+         T  Y  PE +    Y G P     DIWALGV
Sbjct: 850 DFGSAVYTHMGPF----LSFT-------GTIDYSAPETIRAMAYEGKP----QDIWALGV 894

Query: 235 FLYKLCYYTTPFEKTGENAILHSK--FQYPAFPIYSDRLKNLIRVMLSENPTKRPNICEL 292
            LY L +   PF+   E  IL +K  F  P+ PI S    NLI  ML      RP I ++
Sbjct: 895 LLYTLIFKQLPFKNVEE--ILEAKLNFSNPSIPI-SKECMNLIERMLELQVRNRPFIEDV 951

Query: 293 LE 294
            E
Sbjct: 952 YE 953

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 98/213 (46%), Gaps = 34/213 (15%)

Query: 107 LLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVL 166
           +L EY  GG L+D++       L E          A  +  +HA    ++HRD+KIEN++
Sbjct: 241 MLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLKIENIM 296

Query: 167 RSGNGEFKLCDFGSVCGYIRPPRNQ-----QELSYVQHDILKNTTAQYRCPEMLDLYRGL 221
            S +GE K+ DFG     +  PR Q       L +   ++LK   + Y  PE+       
Sbjct: 297 ISTSGEIKIIDFG--LSNMFDPRTQLHTFCGSLYFAAPELLK--ASPYVGPEV------- 345

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQ-----YPAFPIYSDRLKNLIR 276
                 D+W+ GV LY L     PF+    +++LH K +     YP     S  + +L+ 
Sbjct: 346 ------DVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVDYPQH--LSIEVISLLS 396

Query: 277 VMLSENPTKRPNICELLEEISSIQGVPCPIQNF 309
            ML  +P KR ++ +++E    I+G   P  ++
Sbjct: 397 KMLVVDPRKRASLKQVVEHHWMIRGYDFPAPSY 429

>Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar to
           Ashbya gossypii AER223C
          Length = 893

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 121/280 (43%), Gaps = 38/280 (13%)

Query: 19  THRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKL 78
           TH AL K+ +  G +  +Y       D      V  +K +    +  L+    E+D   L
Sbjct: 17  THYAL-KQVIGKGAYGVVYKAVNKATD-----QVIAIKAIEYQNEEELHEHMLEID---L 67

Query: 79  LKNNRHVVSYIDSNAVK-SAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNI 137
           LKN RH       N VK   F   S+E+ +L+EYC  G L D +    +  LSEA+    
Sbjct: 68  LKNLRH------ENIVKYHGFIQSSHELYILLEYCIRGSLRDLIK---KEALSEAKAKVY 118

Query: 138 LSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYV 197
           + QT +G+  +H     ++HRDIK  N+L + NG  KL DFG     +        ++Y 
Sbjct: 119 VKQTVRGLQYLH--DQGVIHRDIKAANLLLTENGIVKLADFG-----VSTRVTNMAMTYA 171

Query: 198 QHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS 257
                   +  +  PE++    G      SDIW+LG  + +L     PF      A  ++
Sbjct: 172 -------GSPNWMAPEVM---LGKGASTVSDIWSLGATVVELLTGNPPFHNLVNEAACYA 221

Query: 258 KFQYPAFP--IYSDRLKNLIRVMLSENPTKRPNICELLEE 295
                 +P    S + KN I     +N  KRP   +LL++
Sbjct: 222 IVNDVYYPPEHLSTQCKNFIERCFQKNMFKRPQAHQLLQQ 261

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 95/203 (46%), Gaps = 23/203 (11%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           V LLMEY   G L   + S      ++      + Q A  +  +H  Q  ++HRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLLRS--HGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPID 224
           +L   N   KL DFG     I  PR  +  +          T  Y  PEM+   R    D
Sbjct: 220 ILIGFNNVIKLTDFG---WSIINPRGVKRKTLC-------GTIDYLSPEMI---RSREYD 266

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGENA----ILHSKFQYPAFPIYSDRLKNLIRVMLS 280
           +K D+WALGV  Y+L   + PFE+  +      IL +  ++P     S  +K+LI  +L 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPE--TVSHDVKDLISKLLK 324

Query: 281 ENPTKRPNICELLEEISSIQGVP 303
            NP++R ++ ++++    I+  P
Sbjct: 325 YNPSERISMRDVMKHPWIIRNKP 347

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 93/176 (52%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           V+ + ++K ++H  +V++IDS   +        ++ ++MEY EGG L D +   +   L+
Sbjct: 741 VNEILVMKGSKHNNIVNFIDSYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 790

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T +G+  +H+    ++HRDIK +N+L S NG+ KL DFG  C  I     
Sbjct: 791 EGQIGAVSRETLKGLQFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQIN---- 843

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
             E++  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+
Sbjct: 844 --EVNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 892

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 90/201 (44%), Gaps = 24/201 (11%)

Query: 101 GSY----EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLL 156
           GSY     + +LMEYC GG L   +      ++ E  I  I+ +    +  +H  +  ++
Sbjct: 87  GSYLKDTSLWILMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKCIH--KDNVI 141

Query: 157 HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD 216
           HRDIK  NVL +  G  KLCDFG      +    +Q ++          T  +  PE+  
Sbjct: 142 HRDIKAANVLITNEGSVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEV-- 190

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKT----GENAILHSKFQYPAFPIYSDRLK 272
           +  G+  D K DIW+LG+  Y++     P+           I+ SK        YS  LK
Sbjct: 191 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLK 250

Query: 273 NLIRVMLSENPTKRPNICELL 293
             I + L E+P +R +  +LL
Sbjct: 251 EFIALCLDEDPKERLSADDLL 271

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 91/200 (45%), Gaps = 20/200 (10%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++MEYC GG +   +      ++ E  I  I+ +    +  +H  +  ++HRDIK  N
Sbjct: 114 LWIIMEYCAGGSVRTLLRP---GKIDEKYIAVIMRELLVALHYIH--KDNVIHRDIKAAN 168

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPID 224
           +L +  G  KLCDFG      +    +Q ++          T  +  PE+  +  G+  D
Sbjct: 169 LLITNEGNVKLCDFGVAAQLNQNTMRRQTMA---------GTPYWMAPEV--IMEGISYD 217

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKT----GENAILHSKFQYPAFPIYSDRLKNLIRVMLS 280
            K+DIW++G+  Y++     PF +         I  SK        +   LK  I + L 
Sbjct: 218 TKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLKEFIAMCLD 277

Query: 281 ENPTKRPNICELLEEISSIQ 300
           E+P +RP   +LL E + I+
Sbjct: 278 EDPQERPTADKLLHESAFIK 297

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 112/256 (43%), Gaps = 49/256 (19%)

Query: 45  DTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYE 104
           DTYSK N   ++R IV               MKL       +S+ +   +   + N S E
Sbjct: 156 DTYSKINPYGIEREIV--------------IMKL-------ISHPNVMGLYEVWENKS-E 193

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + L++EY +GG L D++ SR   +LSE E ++   Q  +GV+  H+    + HRD+K EN
Sbjct: 194 LFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSFN--ICHRDLKPEN 249

Query: 165 VLRSGN-GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGL 221
           +L        K+ DFG     +  P            +    +  Y  PE++    Y G 
Sbjct: 250 LLLDKKINTIKIADFG--MAALELPNKLL--------VTSCGSPHYASPEIVMGKSYHGS 299

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HSKFQYPAFPIYSDRLKNLIRV 277
           P    SD+W+ G+ L+ L     PF       +L      KFQ P     S   ++LI  
Sbjct: 300 P----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMPQN--ISLEAEDLISR 353

Query: 278 MLSENPTKRPNICELL 293
           +L  +P KR  I ++L
Sbjct: 354 ILVVDPEKRIQINDIL 369

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 120/282 (42%), Gaps = 52/282 (18%)

Query: 35  QIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAV 94
           Q+YA+++  +D+ S                 +  ++ EV  +  LK   +++ Y      
Sbjct: 70  QVYAIKVLNLDSESDE---------------VEDVQREVQFLSSLKQFPNIIRYF----- 109

Query: 95  KSAFNNGSY----EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHA 150
                 GSY     + ++M+YC GG +   +      ++ E  I  I+ +    +  +H 
Sbjct: 110 ------GSYLKDTNLWIIMDYCAGGSIRTLLRP---GKIDEKYIGIIMREILIALQYIH- 159

Query: 151 LQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYR 210
            +  ++HRDIK  NVL +  G+ KLCDFG      +    +Q ++          T  + 
Sbjct: 160 -KDNVIHRDIKAANVLVTNEGKVKLCDFGVAAQLNQTKLRRQTMA---------GTPYWM 209

Query: 211 CPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKT----GENAILHSKFQYPAFPI 266
            PE+  +  G   D K+DIW+LG+  Y++     P+ +         I  SK        
Sbjct: 210 APEV--IMEGAYYDTKADIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRS 267

Query: 267 YSDRLKNLIRVMLSENPTKRPNICELLEE--ISSIQGVPCPI 306
           YS  LK  I + L E+P +R +  EL +   I S + VP  I
Sbjct: 268 YSTSLKEFIALCLDEDPKERLSAEELQKTKFIKSQRAVPTTI 309

>NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa]
           {ON} Anc_2.496
          Length = 893

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 92/176 (52%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K +RH  +V++IDS  +         ++ ++MEY EGG L D +   +   L+
Sbjct: 654 INEILVMKGSRHPNIVNFIDSYLLDG-------DLWVIMEYMEGGSLTDVVTHCI---LT 703

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T  G+  +H+    +LHRDIK +N+L S +G+ KL DFG  C  I     
Sbjct: 704 EGQIGAVCRETLSGLQFLHSKG--VLHRDIKSDNILLSISGDIKLTDFG-FCAQI----- 755

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
             E++  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+
Sbjct: 756 -NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 805

>TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {ON}
           Anc_3.60 YNL298W
          Length = 885

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 93/181 (51%), Gaps = 27/181 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFM-----NSRL 125
           V+ + ++K++RH  +V++++      A+     ++ ++MEY EGG L D +     +  +
Sbjct: 651 VNEILVMKDSRHKNIVNFLE------AYLKTEDDLWVVMEYMEGGSLTDIIENSPADESI 704

Query: 126 QNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYI 185
            + L+E++I  I+ +T QG+  +H     ++HRDIK +NVL    G  K+ DFG  C  +
Sbjct: 705 NSPLTESQIAYIVRETCQGLKFLHDRH--IIHRDIKSDNVLLDTQGRVKITDFG-FCAKL 761

Query: 186 RPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTP 245
              R+++             T  +  PE++   +    DEK D+W+LG+   ++     P
Sbjct: 762 TDQRSKRATMV--------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLEGEPP 810

Query: 246 F 246
           +
Sbjct: 811 Y 811

>TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa]
           {ON} Anc_3.60 YNL298W
          Length = 934

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 92/181 (50%), Gaps = 27/181 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQN--- 127
           V+ + +++++RH  +V++++      A+     ++ ++MEY EGG L D + +  +N   
Sbjct: 700 VNEILVMQDSRHKNIVNFLE------AYLKTEDDLWVVMEYMEGGSLTDIIENSPENVTN 753

Query: 128 --RLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYI 185
              L+E +I  I+ +T QG+  +H     ++HRDIK +NVL    G  K+ DFG  C  +
Sbjct: 754 KSPLTEPQIAYIVRETCQGLKFLHERH--IIHRDIKSDNVLLDNQGRVKITDFG-FCAKL 810

Query: 186 RPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTP 245
              R+++             T  +  PE++   +    DEK D+W+LG+   ++     P
Sbjct: 811 TDQRSKRATMV--------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLEGEPP 859

Query: 246 F 246
           +
Sbjct: 860 Y 860

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 119/280 (42%), Gaps = 45/280 (16%)

Query: 31   GGFAQIY-AVEITPVDTYSKSNVACLKRVIVPTKSG--------LNTLRAEVDAMKLLKN 81
            G F  +Y  + +T         +  +K+V VP  S         +  LR+EV  +K L +
Sbjct: 1105 GSFGAVYLCLNVT------TGEMMAVKQVEVPKYSSQDENIISTVEALRSEVSTLKDL-D 1157

Query: 82   NRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQT 141
            + ++V Y+        F N      L +EY  GG +   +  R+  R  EA I ++  Q 
Sbjct: 1158 HLNIVQYL-------GFENKDNIYSLFLEYVAGGSVGSLI--RMYGRFDEAMIRHLTIQV 1208

Query: 142  AQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDI 201
             +G++ +H+    +LHRD+K +N+L   +G  K+ DFG         R   ++ Y   D+
Sbjct: 1209 LRGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDFGIS-------RKSNDI-YSNSDM 1258

Query: 202  LKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HS 257
                T  +  PEM+D  +G     K DIW+LG  + ++     P+      A +     S
Sbjct: 1259 TMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKS 1316

Query: 258  KFQYP----AFPIYSDRLKNLIRVMLSENPTKRPNICELL 293
            K   P      P+ S   +  +      +P  RP   +LL
Sbjct: 1317 KSAPPIPEDTLPLISQDGRQFLDSCFEIDPESRPTADKLL 1356

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 95/193 (49%), Gaps = 16/193 (8%)

Query: 105 VLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIEN 164
           + ++MEYC GG   + +    +++++E +   I+S+   G+  +H+ + +  HRDIK  N
Sbjct: 91  MWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHSQRKI--HRDIKSAN 148

Query: 165 VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPID 224
           +L + NG  KL DFG V G +   R +              T  +  PE++D  +    +
Sbjct: 149 ILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV---------GTPFWMAPEVIDRNKQ-GYN 197

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGENAILHS--KFQYPAFPI-YSDRLKNLIRVMLSE 281
           E +DIW+LG+ + +L     P +K      L +  K   P     +S   ++ +   L +
Sbjct: 198 EMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCLIK 257

Query: 282 NPTKRPNICELLE 294
           +P++RP   ELL+
Sbjct: 258 DPSQRPTAAELLK 270

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 115/264 (43%), Gaps = 38/264 (14%)

Query: 22   ALIK-KYLTSGGFAQIY-AVEITPVDTYSKSNVACLKRVIVPTKSG--------LNTLRA 71
            A IK + +  G F  +Y A+ +T         +  +K+V VP  S         +  L++
Sbjct: 1037 AWIKGEIIGKGSFGAVYLALNVT------TGEMLAVKQVTVPEFSSQDESAISMVEALKS 1090

Query: 72   EVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSE 131
            EV  +K L N+ ++V Y+          NG Y   L +EY  GG +   +  R+  R  +
Sbjct: 1091 EVSTLKDL-NHVNIVQYLGFEE-----KNGIYS--LFLEYVAGGSVGSLI--RMYGRFDD 1140

Query: 132  AEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQ 191
              I ++  Q  +G+A +H+    +LHRD+K +N+L   +G  K+ DFG         R  
Sbjct: 1141 QLIRHLTKQVLEGLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDFGIS-------RKS 1191

Query: 192  QELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE 251
              + Y   D+    T  +  PEM+D   G     K DIW+LG  + ++     P+     
Sbjct: 1192 NNI-YSNSDMTMRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEV 1248

Query: 252  NAILHSKFQYPAFPIYSDRLKNLI 275
             A +    +    P   D  K+L+
Sbjct: 1249 VAAMFQIGKSKTAPPIPDDTKDLV 1272

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 101/219 (46%), Gaps = 33/219 (15%)

Query: 28   LTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVS 87
            LT+G   ++ AV+   V  YS  +   L  V          LR+EV  +K L ++ ++V 
Sbjct: 1295 LTTG---EMMAVKQVEVPKYSAQDQNILDTV--------EALRSEVSTLKDL-DHLNIVQ 1342

Query: 88   YIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVAN 147
            Y+        F N      L +EY  GG +   +  RL  R  EA I  +  Q  +G+A 
Sbjct: 1343 YL-------GFENDHDIYSLFLEYVGGGSVGSLI--RLYGRFDEALIRFLTVQVLEGLAY 1393

Query: 148  MHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTA 207
            +H+    +LHRD+K +N+L   +G  K+ DFG         R  +++ Y   D+    T 
Sbjct: 1394 LHSKG--ILHRDMKADNLLLDLDGVCKISDFGIS-------RKSKDI-YSNSDMTMRGTV 1443

Query: 208  QYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
             +  PEM+D  +G     K DIW+LG  + ++     P+
Sbjct: 1444 FWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPW 1480

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 127/270 (47%), Gaps = 36/270 (13%)

Query: 28  LTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVS 87
           L  G ++ +     T +++  K  V  L +  +  +  +  +  E + ++ LKN + ++S
Sbjct: 161 LGDGSYSTVLLA--TSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLKNTKGIIS 218

Query: 88  YIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVAN 147
                 +   F + S  +  L+EY   G L+  M  R    ++E       +Q    +  
Sbjct: 219 ------LYFTFQDES-SLYFLLEYAPNGDLLSLM--RKHGSVNEKCTQYYAAQIIDALGF 269

Query: 148 MHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNT-- 205
           MH     ++HRD+K EN+L   + + KL DFG+    +    ++ +L Y   D+L  +  
Sbjct: 270 MH--DKGVIHRDLKPENILLDVDMKVKLTDFGT--ARLLDSTSEDDLKY---DLLTRSNS 322

Query: 206 ---TAQYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE----NAILHS 257
              TA+Y  PE+L D Y    +D + DIWA G  L+++     PF+   E      ++  
Sbjct: 323 FVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKV 378

Query: 258 KFQYPA-FPIYSDRLKNLIRVMLSENPTKR 286
           +F + A FP+    +++L++ +L +NP +R
Sbjct: 379 QFAFTAGFPM---TVRDLVKNILIKNPERR 405

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 114/230 (49%), Gaps = 31/230 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           ++ + ++K ++H  +V++IDS  ++        ++ ++MEY EGG L D +   +   L+
Sbjct: 709 INEILVMKASKHANIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 758

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T +G+  +H+    ++HRDIK +N+L S  GE KL DFG  C  I     
Sbjct: 759 EGQIGAVSRETLKGLQFLHSKG--VIHRDIKSDNILLSMTGEIKLTDFG-FCAQI----- 810

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF-EKT 249
             E++  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+  +T
Sbjct: 811 -NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 864

Query: 250 GENAI-LHSKFQYPAFP---IYSDRLKNLIRVMLSENPTKRPNICELLEE 295
              A+ L +    P        SD LK  +   L  +P +R    ELL +
Sbjct: 865 PLRALYLIATNGTPELKDADSLSDDLKGFLGWCLHVDPDERATASELLSD 914

>Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W
           (REAL)
          Length = 1081

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 130/297 (43%), Gaps = 39/297 (13%)

Query: 16  TVGTHRALIKKYLTSGGFAQIYA-------VEITPVDTYSKSNVACLKRVIVPTKSGLNT 68
           ++ + +++IKK +    F  I         V  T +DT  K     L +  +  +  +  
Sbjct: 165 SLKSKKSVIKKGIKDFKFGSIIGDGAYSTVVLATSIDTKKKYAAKVLNKEYLIRQKKVKY 224

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNR 128
           +  E  A++ L N+  VV         S F + S  +  L+EY   G  +  M  +    
Sbjct: 225 VSIEKTALQKLNNSLSVVRLF------STFQDES-SLYFLLEYAPNGDFLSLM--KKYGS 275

Query: 129 LSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPP 188
           + E       +Q    +  +H+    ++HRDIK EN+L       KL DFG+    + P 
Sbjct: 276 IDENCACYYAAQIIDAIDYLHS--NGIIHRDIKPENILLDEEMRIKLTDFGT-AKLLSPT 332

Query: 189 RNQQELSYVQHDILKNT-----TAQYRCPEML-DLYRGLPIDEKSDIWALGVFLYKLCYY 242
            N   +S  ++D+   +     TA+Y  PE+L D +     D + DIWA G  L+++   
Sbjct: 333 SN--SVSKPKYDLSTRSKSFVGTAEYVSPELLNDSF----TDYRCDIWAFGCILFQMIAG 386

Query: 243 TTPFEKTGENAILHS--KFQY---PAFPIYSDRLKNLIRVMLSENPTKRPNICELLE 294
             PF+ T E        K QY   P FP+    +++L++ +L +N  +R  I ++ E
Sbjct: 387 KPPFKATNEYLTFQKVMKVQYAFTPGFPLV---IRDLVKRILVKNLDQRLTINQIKE 440

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 105/232 (45%), Gaps = 45/232 (19%)

Query: 78  LLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEIL 135
           ++K +RH  VV++I+++  K         + ++MEY EGG L D +   L   LSE +I 
Sbjct: 565 VMKESRHNNVVNFINAHLSKG-------NLWIVMEYMEGGSLTDVVTHCL---LSEGQIG 614

Query: 136 NILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELS 195
            +  +T +G+  +H+    ++HRDIK +NVL S  G+ KL DFG  C  I          
Sbjct: 615 AVCRETLEGLKFLHSKG--VIHRDIKSDNVLLSMKGDIKLTDFG-FCAQI---------- 661

Query: 196 YVQHDILKNTTAQ-----YRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTG 250
              +DI  N T       +  PE++      P   K DIW+LG+ + ++     P+    
Sbjct: 662 ---NDIDLNRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNEA 715

Query: 251 ENAILH-------SKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEE 295
               L+        K + P     SD   N +   L   P +R +  ELL +
Sbjct: 716 PLKALYLIATNGTPKLKEPEN--LSDVFSNFLDRCLRVEPEERASAIELLAD 765

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 106/247 (42%), Gaps = 32/247 (12%)

Query: 56   KRVIVPT---KSGLNTLRAEVDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLME 110
            +R++V T      L T+ +E+  M  L    H  ++S +D       F +  Y  +    
Sbjct: 1156 ERILVDTWVRDRQLGTIPSEIQIMATLNKKPHDNILSLLD------FFEDDDYYYIETPV 1209

Query: 111  YCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGN 170
            + E G +  F     +  ++E E   I  Q   G+ ++H     ++HRDIK ENV+    
Sbjct: 1210 HGETGCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSK 1267

Query: 171  GEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGLPIDEKSD 228
            G  K+ DFGS       P           D+   T   Y  PE+L  + Y G P     D
Sbjct: 1268 GCVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QD 1312

Query: 229  IWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPN 288
            IWA+G+ LY + +   PF    E  IL  + ++      S+    LI+ +L  +  KRP 
Sbjct: 1313 IWAIGILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPL 1370

Query: 289  ICELLEE 295
            I E+  +
Sbjct: 1371 IEEIFND 1377

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 95/202 (47%), Gaps = 24/202 (11%)

Query: 101 GSY----EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLL 156
           GSY     + ++MEYC GG L   +      ++ E  I  I  +    +  +H  +  ++
Sbjct: 106 GSYLKDTSLWIIMEYCAGGSLRTLLRP---GKIDEKYIGVITREILIALKYIH--KDNII 160

Query: 157 HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD 216
           HRDIK  NVL +  G  KLCDFG      +  + +Q ++          T  +  PE+  
Sbjct: 161 HRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKRRQTMA---------GTPYWMAPEV-- 209

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPF-EKTGENAI-LHSKFQYPAFPI--YSDRLK 272
           +  G+  D K DIW+LG+  Y++     P+ E     A+ L +K + P      YS  LK
Sbjct: 210 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCEIEALRAMQLITKSKPPRLEGRNYSPLLK 269

Query: 273 NLIRVMLSENPTKRPNICELLE 294
             + + L E+P +R +  +LL+
Sbjct: 270 EFVALCLDEDPKERMSAEDLLK 291

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 125/284 (44%), Gaps = 51/284 (17%)

Query: 31   GGFAQIY-AVEITPVDTYSKSNVACLKRVIVP--------TKSGLNTLRAEVDAMKLLKN 81
            G F  +Y ++ IT  +      +  +K+V VP         K  +  L++EV  +K L +
Sbjct: 1160 GSFGAVYLSLNITTGE------MMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-D 1212

Query: 82   NRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQT 141
            + ++V Y+ S    + ++       L +EY  GG +   +  RL  R  E  I ++ +Q 
Sbjct: 1213 HLNIVQYLGSEIRGNIYS-------LFLEYVAGGSVGSLI--RLYGRFDEKLIRHLNTQV 1263

Query: 142  AQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDI 201
              G+  +H+    +LHRD+K +N+L   +G  K+ DFG           + +  Y   D+
Sbjct: 1264 LSGLKYLHS--KGILHRDMKADNLLLDEDGICKISDFG--------ISKKSKNIYSNSDM 1313

Query: 202  LKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQY 261
                T  +  PEM+D  +G     K DIW+LG  + ++     P+       ++ + FQ 
Sbjct: 1314 TMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNL---EVVAAMFQI 1368

Query: 262  ------PAFP-----IYSDRLKNLIRVMLSENPTKRPNICELLE 294
                  P  P     + S + K+ +      +P KRP   +LLE
Sbjct: 1369 GKSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 90/200 (45%), Gaps = 24/200 (12%)

Query: 101 GSY----EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLL 156
           GSY     + ++MEYC GG L   +   +   + E  I  I+ +    +  +H  +  ++
Sbjct: 108 GSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIH--KDNVI 162

Query: 157 HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD 216
           HRDIK  NVL +  G+ KLCDFG      +    +Q ++          T  +  PE+  
Sbjct: 163 HRDIKAANVLITNEGKVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEV-- 211

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKT----GENAILHSKFQYPAFPIYSDRLK 272
           +  G+  D K DIW+LG+  Y++     P+ +         I  SK        YS  LK
Sbjct: 212 IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRQYSSGLK 271

Query: 273 NLIRVMLSENPTKRPNICEL 292
             I + L E+P +R +  EL
Sbjct: 272 EFIALCLDEDPKERLSAEEL 291

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 129/295 (43%), Gaps = 46/295 (15%)

Query: 22   ALIKKYLTS-GGFAQIY-AVEITPVDTYSKSNVACLKRVIVP--------TKSGLNTLRA 71
            A +K  L   G F  +Y ++ +T         +  +K+V VP          S +  LR+
Sbjct: 1337 AWVKGELIGKGSFGSVYLSLNVT------TGEMMAVKQVEVPEFGSQNEAIVSTVEALRS 1390

Query: 72   EVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSE 131
            EV  +K L ++ ++V Y+        F   +    L +EY  GG +   +  R+  R  E
Sbjct: 1391 EVTLLKDL-DHINIVQYL-------GFEKKNNIYSLFLEYVAGGSIGSLI--RMYGRFDE 1440

Query: 132  AEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQ 191
            + I +  +Q   G++ +H+    +LHRD+K +N+L  G G  K+ DFG         R  
Sbjct: 1441 SLIRHSTTQILAGLSYLHSKG--ILHRDMKADNILLDGEGICKISDFGIS-------RKS 1491

Query: 192  QELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGE 251
            +++ Y   ++    T  +  PEM+D  +G     K DIW+LG  + ++     P+     
Sbjct: 1492 KDI-YSNSEMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIILEMFAGKRPWSNLEV 1548

Query: 252  NAIL----HSKFQYP----AFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISS 298
             A +     SK   P      P+ S   ++ +      +P KRP   ++L+ + S
Sbjct: 1549 VAAMFKIGQSKSAPPIPEDTLPLISQDGRDFLDDCFKIDPEKRPTAEQMLDHLFS 1603

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 95/201 (47%), Gaps = 24/201 (11%)

Query: 101 GSY----EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLL 156
           GSY    ++ ++MEYC GG L   +      ++ E  +  I+ +    +  +H  +  ++
Sbjct: 89  GSYLYDTKLWVIMEYCAGGSLRTLLRP---GKIDEKYLGVIVRKLLIALVYIH--KDNVI 143

Query: 157 HRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLD 216
           HRDIK  NVL +  G  KLCDFG           +Q ++          T  +  PE+  
Sbjct: 144 HRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMA---------GTPYWMAPEV-- 192

Query: 217 LYRGLPIDEKSDIWALGVFLYKLCYYTTPF-EKTGENAI-LHSKFQYPAFPI--YSDRLK 272
           +  G+  + K+DIW+LG+  Y++     P+ +     A+ L +K + P      YS  LK
Sbjct: 193 IMEGVYYNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLK 252

Query: 273 NLIRVMLSENPTKRPNICELL 293
             I + L E+P +RP   +LL
Sbjct: 253 EFIALCLDEDPEERPTAEDLL 273

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 103/219 (47%), Gaps = 32/219 (14%)

Query: 85  VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQG 144
           ++S+ +  A+   + N S E+ L++EY +GG L D++ S+   +L E E ++   Q  +G
Sbjct: 170 LISHTNVMALFEVWENKS-ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEG 226

Query: 145 VANMHALQPVLLHRDIKIEN-VLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILK 203
           V+  H+    + HRD+K EN +L   N   K+ DFG     +             + +LK
Sbjct: 227 VSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFGMAALEL------------PNKLLK 272

Query: 204 NT--TAQYRCPEML--DLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAIL---- 255
            +  +  Y  PE++    Y G P    SD+W+ G+ L+ L     PF       +L    
Sbjct: 273 TSCGSPHYASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQ 328

Query: 256 HSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLE 294
             K+Q P     S   ++LI  +L  +P KR    E+L+
Sbjct: 329 SGKYQMPMN--LSAEARDLISKILVIDPAKRITTQEILK 365

>CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa]
           {ON} some similarities with uniprot|Q03497 Saccharomyces
           cerevisiae YHL007c ser/thr protein kinase of the
           pheromone pathway
          Length = 867

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 93/180 (51%), Gaps = 34/180 (18%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           V+ + ++ +++H  +V+YIDS      + +G  ++ ++MEY EGG L D +   +   L+
Sbjct: 610 VNEIMVMSSSKHQNIVNYIDS------YLSG-LDLWVVMEYMEGGCLTDVVTYCV---LT 659

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +  QG+  +H+    +LHRDIK +NVL S NG+ KL DFG  C        
Sbjct: 660 EGQIGAVCREVLQGLEFLHSKG--VLHRDIKSDNVLLSMNGDIKLTDFG-FC-------- 708

Query: 191 QQELSYVQHDILKNTTA----QYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
               + V   ++K TT      +  PE++      P   K DIW+LG+ + ++     P+
Sbjct: 709 ----AQVNDTVIKRTTMVGTPYWMAPEIVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 761

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 94/176 (53%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNRLS 130
           V+ + ++K +RH  +V++IDS      F NG+  + ++MEY +GG L D +   +   L+
Sbjct: 608 VNEILVMKASRHENIVNFIDS-----YFLNGN--LWVIMEYMKGGSLTDVVTHCI---LT 657

Query: 131 EAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPPRN 190
           E +I  +  +T  G+  +H+    ++HRDIK +NVL S +G+ KL DFG  C  I     
Sbjct: 658 EQQISTVTRETLNGLRFLHSKG--VIHRDIKSDNVLLSLSGDIKLTDFG-FCAQI----- 709

Query: 191 QQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPF 246
             E++  +  ++   T  +  PE++      P   K DIW+LG+ + ++     P+
Sbjct: 710 -NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 759

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 97/198 (48%), Gaps = 27/198 (13%)

Query: 104 EVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIE 163
           +V + +EYC G  L D++  +   R+   E   + +Q    V   H+LQ V  HRD+K+E
Sbjct: 102 KVWMALEYCPGNELYDYLLQK--QRIPLDETSKLFAQIVGAVFYAHSLQCV--HRDLKLE 157

Query: 164 NVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEML--DLYRGL 221
           N+L    G   L DF    G+ R    + +L  +        T  Y  PE++  + Y G 
Sbjct: 158 NILLDKQGYAMLTDF----GFTRECATKTQLETI------CGTTVYMAPELIKRESYDGY 207

Query: 222 PIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHS-KFQYPAFPI---YSD-RLKNLIR 276
               K D W+LG+ LY + +   PF++  E+  L   K      PI   Y++   K+LI 
Sbjct: 208 ----KVDTWSLGIILYTMLHGFMPFDE--EDPTLTGLKIMNEMPPIVDAYTNVHAKDLIL 261

Query: 277 VMLSENPTKRPNICELLE 294
            +L + P++RP++ ++LE
Sbjct: 262 KLLRKTPSERPSLNKVLE 279

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,543,684
Number of extensions: 3090360
Number of successful extensions: 13023
Number of sequences better than 10.0: 1741
Number of HSP's gapped: 11739
Number of HSP's successfully gapped: 1796
Length of query: 756
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 639
Effective length of database: 40,065,477
Effective search space: 25601839803
Effective search space used: 25601839803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)